|name|,|description|,|price|,|category|,|offer_id|,|product_url|,|image_url||-||9's Bandeau Bikini for Girls in Aqua|,|Also available in lime green, this new tween bandeau bikini stands out from the crowd! The front of the top is textured with a scalloped overlay while the back of the suit is secured by tying a wide knot. The thin straps are tied behind her neck. The solid bottoms are accented with a touch of the scalloped overlay on her right hip. Pair it with the matching coverup shorts for the complete look! Polyamide/Elastane Blend. Hand wash in cold water and lay flat to dry. |,|$54.00$|,||,|9S-BANDEAU-BIKINI-GIRLS-AQUA|,|$URL$9s-bandeau-bikini-girls-aqua.html|,|http://ep.yimg.com/ay/yhst-17102259411242/9-s-bandeau-bikini-for-girls-in-aqua-18.jpg||-||9's One Piece Swimsuit with Fringe|,|She will really be the envy of all her friends in this fun one-piece swimsuit from To The 9's! The fuchsia and green ikat pattern is one that we have found throughout this collection. The one piece style boasts a sweetheart neckline that is accented with contrasting fuchsia fringe. Wide halter straps tie behind her neck. The back of the suit ties with a wide tie, mimicking a bikini's look. Polyamide/Elastane Blend. Hand wash in cold water and lay flat to dry. |,|$56.00$|,||,|9S-ONE-PIECE-SWIMSUIT-FRINGE|,|$URL$9s-one-piece-swimsuit-fringe.html|,|http://ep.yimg.com/ay/yhst-17102259411242/9-s-one-piece-swimsuit-with-fringe-15.jpg||-||9's Tween Sundress in Tribal Print Blue|,|A fun cover up style, this new dress is from tween designer To The 9's. Made to match many of their new swimwear this season, it's covered in a unique blue ikat pattern lined in a contrasting yellow. The soft v neck is accompanied by thin braided straps and a large wrap around ruffle. The open style back is made with a flyaway technique, making it more unique. |,|$62.00$|,||,|9S-TWEEN-SUNDRESS-TRIBAL-PRINT-BLUE|,|$URL$9s-tween-sundress-tribal-print-blue.html|,|http://ep.yimg.com/ay/yhst-17102259411242/9-s-tween-sundress-in-tribal-print-blue-1.jpg||-||A Bird Cream and Stripe Abbie Reversible Belt|,|^|A new reversible belt from A. Bird, this piece is created to match almost any of her new fall pieces. The belt features a side striped with light pink and brown while the solid cream is textured. The fabric measures about 19 inches and the bow wraps back around the front to tie in front of the fabric. Total length is roughly 36.5"". ^||,|$8.33$|,||,|A-BIRD-CREAM-STRIPE-ABBIE-REVERSIBLE-BELT|,|$URL$a-bird-cream-stripe-abbie-reversible-belt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/a-bird-cream-and-stripe-abbie-reversible-belt-15.jpg||-||A Bird Reversible Abbie Belt for Girls in Black|,|^|The perfect accessory for her new designer A. Bird outfit, this girls fabric belt is reversible. The fabric part of the belt measures roughly 19"" and features one side in a black plaid while the other is in a soft, solid velvet. The string wraps back around the front to tie in a bow. Total length is roughly 36.5"". ^||,|$8.33$|,||,|A-BIRD-REVERSIBLE-ABBIE-BELT-GIRLS-BLACK|,|$URL$a-bird-reversible-abbie-belt-girls-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/a-bird-reversible-abbie-belt-for-girls-in-black-16.jpg||-||Amiana Glitter Shoes in Pewter Sequins|,|Amiana is now offering these adorable girls flats that are great for dressing up her every day look! These flats are styled like comfortable boating shoes with toe that covers the majority of the top of her foot. A touch of elastic on both sides allow her comfortable fit to stretch with ease on her every step, removing stress from the top of the toe to help avoid creases. The dark pewter glitter covers the entire shoe, adding shimmer. The black rubber outsole grips the floor as she runs and walks. |,|$56.00$|,||,|AMIANA-GLITTER-SHOES-PEWTER-SEQUINS|,|$URL$amiana-glitter-shoes-pewter-sequins.html|,|http://ep.yimg.com/ay/yhst-17102259411242/amiana-glitter-shoes-in-pewter-sequins-1.jpg||-||Amiana Glitter Shoes in Pink|,|A pop of color, these designer girls shoes come from the Euro brand, Amiana. The rich magenta shade is added with shimmering glitter that covers the entire body of the shoe. The boat shoe style is a comfortable choice for all day wear while a touch of elastic on both sides allow the shoes to move with her as she walks. A gripping rubber sole finishes this shoe perfectly! |,|$56.00$|,||,|AMIANA-GLITTER-SHOES-PINK|,|$URL$amiana-glitter-shoes-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/amiana-glitter-shoes-in-pink-1.jpg||-||Amiana Kids Pewter Boots|,|From the fabulous designer Amiana LTD, these new girls boots are a welcomed arrival for fall. These boots feature a matte metallic silver that adds a touch of shimmer without outshining her fabulous outfit. The clean style of these shoes lends to only two seams, one on the front and one that wraps around the sides. The pull on style is easy to wear and offers her handles to get the boots on with ease. Rubber side walls line the rounded toe while a rubber outer sole gives her an easy grip. |,|$69.00$|,||,|AMIANA-KIDS-PEWTER-BOOTS|,|$URL$amiana-kids-pewter-boots.html|,|http://ep.yimg.com/ay/yhst-17102259411242/amiana-kids-pewter-boots-1.jpg||-||Amiana Mirror Sneaker in Silver|,|New from designer Amiana, these fabulous girls shoes are sure to be a favorite addition to her fall closet! Whether she is going to school or out running errands with mom, these sneakers are both stylish and comfortable for all day wear. The outside of the shoe boasts of an iridescent mirror finish on the metallic silver. The toe of the shoe is a basic white while the rubber sole provides grip. The shoes are laced up with a sheer white ribbon with a shimmer sheen. |,|$62.00$|,||,|AMIANA-MIRROR-SNEAKER-SILVER|,|$URL$amiana-mirror-sneaker-silver.html|,|http://ep.yimg.com/ay/yhst-17102259411242/amiana-mirror-sneaker-in-silver-1.jpg||-||Amiana Purple Glitter Shoes|,|A brilliant new design by Amiana, these girls flats are the perfect sneakers for school and play! The rich purple glitter catches every ray of light sent its way while complimenting her outfit. The rubber side wall lining the shape of the shoe is in a matching purple. Elastic slits are found on both sides of the shoe to allow for a more comfortable fit as she moves about. These shoes are available only in limited quantities so don't miss out! |,|$56.00$|,||,|AMIANA-PURPLE-GLITTER-SHOES|,|$URL$amiana-purple-glitter-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/amiana-purple-glitter-shoes-1.jpg||-||Amiana Shoes Girls High Tops in Black|,|For your trendsetter daughter who is into fashion at a young age, the girls black high tops by Amiana Shoes will be the perfect addition to her wardrobe. The black sneakers feature an easy zipper closure that climbs up the inner side of both shoes. Four straps wrap up the front of these fun shoes and are adorned with metal buckles. These sneakers look great with skinny jeans or leggings. Dress down your favorite dress with these cute shoes for a trendy new look. |,|$59.00$|,||,|AMIANA-SHOES-GIRLS-HIGH-TOPS-BLACK|,|$URL$amiana-shoes-girls-high-tops-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/amiana-shoes-girls-high-tops-in-black-24.jpg||-||Amiana Shoes Girls Sneakers Gold High Tops|,|Catching eyes wherever she travels, these new girls sneakers by Amiana Shoes will be the talk of her friends. The gold metallic shimmers with every ray of light that bounces off the shoe while the toe and soles bring in the classic sneaker look. Four buckled straps run up the front but a zipper runs up the inner side of her shoe to make it easier to get them on and off. |,|$59.00$|,||,|AMIANA-SHOES-GIRLS-SNEAKERS-GOLD-HIGH-TOPS|,|$URL$amiana-shoes-girls-sneakers-gold-high-tops.html|,|http://ep.yimg.com/ay/yhst-17102259411242/amiana-shoes-girls-sneakers-gold-high-tops-26.jpg||-||Amiana Shoes Leopard Print Girls High Top Sneakers|,|For her wild side, these new sneakers come from designer Amiana Shoes. Perfect to shoe off this school year, the light brown sneakers are covered with leopard sposts and trimmed in black. The black strings lace up the front while a zipper is located on the inner side of both feet. Try pairing with jeans, skirts, and even dresses for a unique finishing touch. |,|$39.00$|,||,|AMIANA-SHOES-LEOPARD-PRINT-GIRLS-HIGH-TOP-SNEAKERS|,|$URL$amiana-shoes-leopard-print-girls-high-top-sneakers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/amiana-shoes-leopard-print-girls-high-top-sneakers-26.jpg||-||Amiana Shoes Little Girls Gold Ballet Flats|,|Sophisticated and glamorous, these dress flats for girls come from Amiana Shoes. The shimmering metallic gold is trimmed with black patent leather on the toe and heal. The top edge is a line of soft black velvet to match the darling bow on her toe. Pairs wonderfully with many special occasion outfits including her holiday dresses. |,|$59.00$|,||,|AMIANA-SHOES-LITTLE-GIRLS-GOLD-BALLET-FLATS|,|$URL$amiana-shoes-little-girls-gold-ballet-flats.html|,|http://ep.yimg.com/ay/yhst-17102259411242/amiana-shoes-little-girls-gold-ballet-flats-2.jpg||-||Amiana Shoes Silver High Top Sneakers for Girls|,|Running with style, these new girls high top sneakers come from Amiana Shoes. The shoes are dressed in metallic silver that shimmers in the sunlight. The classic sneaker toes mimic vintage shoes while four straps with buckles run up the shoes. The inner side of her foot is completed by a zipper to make it easier to get on and off. |,|$59.00$|,||,|AMIANA-SHOES-SILVER-HIGH-TOP-SNEAKERS-GIRLS|,|$URL$amiana-shoes-silver-high-top-sneakers-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/amiana-shoes-silver-high-top-sneakers-for-girls-32.jpg||-||Amiana Sparkle Boots in Navy|,|A brilliant look for fall and winter, these new fabulous hi top sneakers come from European brand, Amiana. The boots are trimmed with a navy suede and laced with a standard shoe string. The body of the shoe is covered in dark navy sequins that shimmer as they catch every ounce of light. The tall style of these shoes make them the perfect companion for her skinny jeans and leggings! |,|$54.00$|,||,|AMIANA-SPARKLE-BOOTS-NAVY|,|$URL$amiana-sparkle-boots-navy.html|,|http://ep.yimg.com/ay/yhst-17102259411242/amiana-sparkle-boots-in-navy-1.jpg||-||Amiana Sparkle Boots in Silver|,|From the European girls shoe designer, Amiana, these new sneaker boots are a real gem. The grey boot rises past the ankle and is laced up with a grey, rope shoe string. With trimmings of flat grey, the eye catching silver glitter pops out, dancing with the light. The bottom sole is a great rubber grip as she walks and runs about. These boots are great paired with skinny jeans or leggings! |,|$54.00$|,||,|AMIANA-SPARKLE-BOOTS-SILVER|,|$URL$amiana-sparkle-boots-silver.html|,|http://ep.yimg.com/ay/yhst-17102259411242/amiana-sparkle-boots-in-silver-1.jpg||-||Arabella Rose Couture Girls Dress in Pink|,|A gorgeous special occasion dress for girls, this new creation by Arabella Rose will create a beautiful look for weddings and birthdays alike! The long sleeve bodice boasts of a textured ivory overlay that is sheer on her arms. The wide neckline adds elegance while the cuffs are finished with a single wide ruffle. The tutu inspired skirt is a perfect pink shade in layers of soft tulle. She is sure to feel like the princess she is when wearing this vintage inspired dress! For the perfect accessory, check out the Arabella Rose Floral Sash! 100% Cotton. Hand wash in cold water. Hang to dry. Made in the USA. |,|$85.50$|,||,|ARABELLA-ROSE-COUTURE-GIRLS-DRESS-PINK|,|$URL$arabella-rose-couture-girls-dress-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/arabella-rose-couture-girls-dress-in-pink-1.jpg||-||Arabella Rose Double Ruffle Pants for Girls in Black|,|Matching her gorgeous style, these new boutique girls pants come from romantic designer Arabella Rose. The waistline stretches with a touch of elastic for a comfortable, pull on fit. The leg is a wide cut for a flowing fit while a touch of ivory lace introduces the glamorous hemline accented with the double ruffle. Proudly Made in the USA. 100% Cotton. Hand wash in cold water and hang to dry. |,|$48.00$|,||,|ARABELLA-ROSE-DOUBLE-RUFFLE-PANTS-GIRLS-BLACK|,|$URL$arabella-rose-double-ruffle-pants-girls-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/arabella-rose-double-ruffle-pants-for-girls-in-black-1.jpg||-||Arabella Rose Floral Sash|,|The perfect finish to her elegant couture dress, this fabulous sash is a truly unique creation from Arabella Rose. The olive sash ties as a belt around her waist as a bow in the front. Next to this bow is a garden of flowers. The large champagne flower is accompanied by a pink rose. Small accent touches are added in lace and velvet. This sash is the perfect match to the Arabella Rose Couture Girls Dress in Pink. Made in the USA. |,|$42.00$|,||,|ARABELLA-ROSE-FLORAL-SASH|,|$URL$arabella-rose-floral-sash.html|,|http://ep.yimg.com/ay/yhst-17102259411242/arabella-rose-floral-sash-1.jpg||-||Arabella Rose Girls Lace Top Quinn|,|An elegant arrival from designer Arabella Rose, this new girls top is sure to be a hit throughout the coming seasons. The top boasts of a dark ivory lace overlay in a vintage inspired flower pattern. The neckline is wider than the classic jewel shape while the hem is a double scallop finish. The long sleeves are sheer in the matching lace, complete with bell ruffle cuffs. Pair this top with most any new jean or pant in her fall closet! 100% cotton. Hand wash cold. Lay flat to dry. |,|$44.25$|,||,|ARABELLA-ROSE-GIRLS-LACE-TOP-QUINN|,|$URL$arabella-rose-girls-lace-top-quinn.html|,|http://ep.yimg.com/ay/yhst-17102259411242/arabella-rose-girls-lace-top-quinn-2.jpg||-||Arabella Rose Girls Pink Party Dress Bristol Anne|,|Filled with vintage inspiration, this new designer girls dress comes from Arabella Rose, filled with love and style that your daughter is sure to adore! The empire bodice is a soft shade of pink covered with a sweet rose print. The long sleeve provide protection from chilly air and is finished with an scallop olive lace. The long skirt has a full circle shape that opens from the waistline. The skirt is also divided into different tiers by small ruffles . The pink, floral lace lays over the lining of the skirt , offering comfort and privacy. The dress is a pull on fit and the fabric allows slight stretch. Made in the USA. 100% Cotton. Hand wash in cold water. Hang to dry. |,|$100.50$|,||,|ARABELLA-ROSE-GIRLS-PINK-PARTY-DRESS-BRISTOL-ANNE|,|$URL$arabella-rose-girls-pink-party-dress-bristol-anne.html|,|http://ep.yimg.com/ay/yhst-17102259411242/arabella-rose-girls-pink-party-dress-bristol-anne-17.jpg||-||Arabella Rose Girls Vintage Top with Lace|,|^|In a vintage inspired gingham fabric, this new arrival for fall and winter was designed by Arabella Rose. The neckline is cut for a ""U"" shape and complimented with a classic peter pan collar in a sheer embroidered fabric with a scallop hem. A single fabric flower is found off centered at the empire waistline. The sleeves finish in an adorable bell ruffle with a crochet ribbon trim. The skirt to the top opens for a relaxed fit and boasts of a single scoop pocket on the front. The hemline is a trendy hi-low cut accented with a crochet ruffle. Made in the USA. 100% Cotton. Hand wash in cold water and hang to dry. ^||,|$79.50$|,||,|ARABELLA-ROSE-GIRLS-VINTAGE-TOP-LACE|,|$URL$arabella-rose-girls-vintage-top-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/arabella-rose-girls-vintage-top-with-lace-17.jpg||-||Arabella Rose Oversized Flower Hair Clip for Girls|,|New from accessory designer Arabella Rose, this adorable new hair clip is sure to become a quick favorite! The large flower ebs and flows between the different rich shades of pink that grace the petals. The size of the flower adds a unique feature and it pops out in her hair. Use this girls hair accessory to accent your favorite new designer outfits that fill her closet! This hair piece also looks great in photographs! Be sure to check out all of the beautiful hair accessories to compliment all of her new tops and dresses!  |,|$16.50$|,||,|ARABELLA-ROSE-OVERSIZED-FLOWER-HAIR-CLIP-GIRLS|,|$URL$arabella-rose-oversized-flower-hair-clip-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/arabella-rose-oversized-flower-hair-clip-for-girls-1.jpg||-||Arabella Rose Secret Garden Girls Dress (3)|,|^|Becoming one of her favorite new dresses, this elegant girls summer dress is part of the ""Secret Garden"" collection created by designer Arabella Rose. The bodice features a wide neckline and short puffy cap sleeves. A stretch of elastic is found on the hem of both sleeves as well as on the back of the neckline. The small pink magenta polka dots cover the entire bodice. The waistline is complimented with a touch of ivory lace and a green ribbon bow while the floral sash ties on the back. The feminine skirt is filled with frills! A trio of matching, wide ruffles wrap the back and both sides. The hemline brings back the pink dots while a sheer georgette fabric ruffle peaks out from underneath. This fabric is a fun pink gingham print. This dress is meant for summer adventures, weddings, and photos that you won't ever forget! Be sure to check out the matching glamorous headband! This designer girls dress is made in the USA with 100% cotton. Hand wash with care and hang to dry. ONE SIZE 3 ONLY LEFT.  ^||,|$89.00$|,||,|ARABELLA-ROSE-SECRET-GARDEN-GIRLS-DRESS|,|$URL$arabella-rose-secret-garden-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/arabella-rose-secret-garden-girls-dress-28.jpg||-||Arabella Rose Secret Garden Ivory Girls Pant|,|Arabella Rose is now offering this classic, wide leg pant for girls as a part of their fall and winter collection. The ivory shade makes these pants easy to pair with just about any boutique top found in her wardrobe. The waistline stretches with elastic for a fit that she can pull on her self. Ivory lace wraps around the pant to introduce the wide, flowing ruffles at the hem. The comfortable fit is enhanced by the wide legs that allow the fabric to move with her every step. 100% Cotton. Hand wash in cold water. Hang to dry. Made in the USA. |,|$48.00$|,||,|ARABELLA-ROSE-SECRET-GARDEN-IVORY-GIRLS-PANT|,|$URL$arabella-rose-secret-garden-ivory-girls-pant.html|,|http://ep.yimg.com/ay/yhst-17102259411242/arabella-rose-secret-garden-ivory-girls-pant-2.jpg||-||Arabella Rose Victorian Inspired Pant for Girls|,|A quite elegance, this new arrival comes from lovely Arabella Rose who boasts of their sweet, vintage inspired designs. The ivory pant is a wide leg with a stretch, elastic waistline. The relaxed fit is one that she will love all day long! The wide hemline is created from a unique, crochet lace finished with an angled edge. Pair these little girls pants with any of the new tops from Arabella Rose for an outfit that cannot be beat! 100% Cotton. Hand wash only. Hang to dry. |,|$45.75$|,||,|ARABELLA-ROSE-VICTORIAN-INSPIRED-PANT-GIRLS|,|$URL$arabella-rose-victorian-inspired-pant-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/arabella-rose-victorian-inspired-pant-for-girls-1.jpg||-||Arabella Rose Vintage Jewels Sage Girls Top|,|From the vintage inspired brand, Arabella Rose, this new designer Hi-low top is a beautiful blend of vintage looks with modern day trends. The U neckline features a peter pan collar in a scallop embroidered fabric. At the center of the neckline lays a large velvet bow matching the ribbons that accent the bell ruffle cuffs on her long sleeves. The fit of the top opens from the waist falling to a ruffled, hi-low hemline. A row of buttons fasten in the back to secure the fit. The final touch to this top are two ties that create a bow on her back and accent the shape of the top. Made in the USA. 100% Cotton. Hand wash in cold water and hang to dry. |,|$81.00$|,||,|ARABELLA-ROSE-VINTAGE-JEWELS-SAGE-GIRLS-TOP|,|$URL$arabella-rose-vintage-jewels-sage-girls-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/arabella-rose-vintage-jewels-sage-girls-top-33.jpg||-||Arabella Rose Yesteryear Handmade Headband|,|Matching one of the most fabulous pieces in the spring and summer season, this new girls oversized headband comes from Arabella Rose. The large flower is filled with a rich pink town and small touches of green. It is placed upon a wide stretch headband made of darling lace that is finished with scallop edges. The bloom is accented with ribbon bows and touches of country lace. This piece looks great with most any outfit, but is specifically matched to the elegant Arabella Rose Secret Garden Girls Dress. |,|$24.00$|,||,|ARABELLA-ROSE-YESTERYEAR-HANDMADE-HEADBAND|,|$URL$arabella-rose-yesteryear-handmade-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/arabella-rose-yesteryear-handmade-headband-6.jpg||-||Ashely Anne Red and White Crinkled Velvet Holiday Clip|,|The perfect finishing touch for that special holiday outfit, this new hair clip from Ashley Anne is mad from crinkled velvet and boasts of a sparkling flower-shaped jewel center. Attached to an alligator clip for easy use. |,|$5.50$|,||,|ASHLEY-ANNE-CRINKLED-HOLIDAY-CLIP|,|$URL$ashley-anne-crinkled-holiday-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/ashely-anne-red-and-white-crinkled-velvet-holiday-clip-11.jpg||-||Ashley Anne Striped Red Flower Head Band|,|This pink, red, white, and green striped headband is decorated with a red flower on the side. Pink and red sequins make a flashy center to the flower. Adorable hair accessory! |,|$9.00$|,||,|ASHLEYANNEREDFLOWERHEADBAND|,|$URL$ashleyanneredflowerheadband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/ashley-anne-striped-red-flower-head-band-10.jpg||-||Ashley Anne White Crinkle Hair Clip|,|Ashley Anne hair clip with white velvet crinkle flower. Silver gems make a flower shape to form a classy center. SOLD OUT 12/21/10 |,|$5.00$|,||,|ASHLEYANNEWHITECRINKLEHAIRCLIP|,|$URL$ashleyannewhitecrinklehairclip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/ashley-anne-white-crinkle-hair-clip-7.jpg||-||Ashley Anne White Headband Pink Flowers|,|Easy to wear white mesh headband is touched with 3 soft pink roses and a light pink tulle. |,|$10.00$|,||,|ASHLEY-ANNE-WHITE-HEADBAND-PINK-FLOWERS|,|$URL$ashley-anne-white-headband-pink-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/ashley-anne-white-headband-pink-flowers-10.jpg||-||Baby Biscotti Baby Blanket Ivory|,|A cotton blanket that is perfect for your newborn angle, this arrival is a design by Baby Biscotti. The light ivory cotton is an understated elegance that looks fabulous in photographs. The edge of the blanket has a small threaded scallop accent. A single corner boasts of a large, crushed lace rose that is soft to the touch and accompanied by a single pale pink ribbon bow. Be sure to look at the matching clothing to create a baby shower gift that is sure to delight! This blanket measures 36 1/2 inches long and 26 inches wide. 100% Cotton. Machine Wash in cold water. Tumble dry in low heat. |,|$31.50$|,||,|BABY-BISCOTTI-IVORY-BABY-BLANKET|,|$URL$baby-biscotti-ivory-baby-blanket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-baby-blanket-ivory-1.jpg||-||Baby Biscotti Baby Booties in Pink|,|Fancy and elegant, these baby booties come from designer Baby Biscotti to match several of the arrivals in their fall and winter collection. A satin strap runs across the top of her foot to help secure the hold and stretches with the touch of elastic. A cute lace tulle bow is found on both toes. Light pink tulle ruffles run around the bootie for a final touch in style! 100% Cotton. Hand Wash in Warm Water. Lay Flat to Dry. |,|$13.50$|,||,|BABY-BISCOTTI-BABY-BOOTIES-PINK|,|$URL$baby-biscotti-baby-booties-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-baby-booties-in-pink-1.jpg||-||Baby Biscotti Baby Sachet Booties|,|Keeping her feet warm and stylish, these new infant booties come from designer Baby Biscotti. The light pink cotton is shaped around each foot and is held on by a single stretch strap that ruffles across the top of both feet. A pale yellow flower created with a light, sheer fabric is found upon the toes with a decorated center. Other matching accessories include a hat and blanket, be sure to check out the Baby Biscotti brand page to see all of the possibilities! 100% cotton. Hand wash cold, line dry. |,|$13.50$|,||,|BABY-BISCOTTI-BABY-SACHET-BOOTIES|,|$URL$baby-biscotti-baby-sachet-booties.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-baby-sachet-booties-1.jpg||-||Baby Biscotti Baby Sachet Pink Infant Hat|,|^|Going with her new ""Sachet"" footed romper or fun dress, this Baby Biscotti hat is a new arrival. The pale pink cotton boasts of a folded brim with a scallop thread hem. Two flowers in yellow and pink are found off to the left side of the hat. These accents match perfectly to the other creations from the collection. The light colors are perfect for any time from spring through summer! 100% cotton. Hand wash cold, line dry. ^||,|$12.00$|,||,|BABY-BISCOTTI-BABY-SACHET-PINK-INFANT-HAT|,|$URL$baby-biscotti-baby-sachet-pink-infant-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-baby-sachet-pink-infant-hat-1.jpg||-||Baby Biscotti Cherished Heirloom White Christening Gown|,|New from designer Baby Biscotti, this graceful christening gown is one that she is sure to cherish for years and years to come. The dress features an exquisite raw silk look that is timeless in fashion. White rosettes and ruffles accent the bodice and the hemline, adding a subtle, dainty elegance! The matching bonnet finishes the look and makes her picture perfect! 100% silk, dry clean for best results. |,|$94.50$|,||,|BABY-BISCOTTI-CHERISHED-HEIRLOOM-WHITE-CHRISTENING-GOWN|,|$URL$baby-biscotti-cherished-heirloom-white-christening-gown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-cherished-heirloom-white-christening-gown-2.jpg||-||Baby Biscotti Christening Gown with Bonnet|,|Surely elegant and graceful, Baby Biscotti is now offering this fabulous christening gown for spring and summer. The empire waist is fastened on her back and accented with sheer waves and a cluster of flowers. The short puffy sleeves are sheer and reminiscent of a princess gown. Long strips of sheer fabric cascade in rich waves down the skirt, completely to the hemline. A matching bonnet comes with this gorgeous girls christening gown. 100% polyester. Delicate hand wash cold, line dry. |,|$66.75$|,||,|BABY-BISCOTTI-CHRISTENING-GOWN-BONNET|,|$URL$baby-biscotti-christening-gown-bonnet.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-christening-gown-with-bonnet-11.jpg||-||Baby Biscotti Footie in Baby Sachet Pink (Size Newborn)|,|^|A new baby romper, this designer infant outfit comes from fabulous Baby Biscotti. The long sleeve bodice features a light pink shade and quaint scallop thread edging. The front is dressed with gorgeous ruffles. The sheer tulle goes from light yellow to light pink while a few small flowers are sprinkled around. The solid cotton creates the legs of this romper down to the cute little feet. A row of snaps is found in the inseam for dressing. Be sure to look at all of the matching pieces from the ""Sachet"" collection for spring. 100% polyester. Machine wash cold, tumble dry low. SIZE NEWBORN ONLY LEFT.  ^||,|$39.00$|,||,|BABY-BISCOTTI-FOOTIE-BABY-SACHET-PINK|,|$URL$baby-biscotti-footie-baby-sachet-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-footie-in-baby-sachet-pink-1.jpg||-||Baby Biscotti Hide and Seek White Baby Blanket|,|^|Baby Biscotti is now offering this fabulous baby girls blanket as a part of their ""Hide and Seek"" collection. The cotton is soft and finished with a classic straight stitch on the hemline. A single corner of the blanket features a trio of flowers with decorated centers! Be sure to find the other matching accessories and create an ultimate baby girls gift for the next shower you attend! 100% cotton. Machine wash cold, tumble dry low. ^||,|$29.00$|,||,|BABY-BISCOTTI-HIDE-SEEK-WHITE-BABY-BLANKET|,|$URL$baby-biscotti-hide-seek-white-baby-blanket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-hide-and-seek-white-baby-blanket-8.jpg||-||Baby Biscotti Hide and Seek White Newborn Gown|,|^|Also available in pink, this new baby girls gown comes from famous designer, Baby Biscotti. The long sleeves found on the gown offer her flip paw cuffs that fold to help protect her from scratching herself. A bouquet of sweet flowers ring around the neckline in white. The wrap style of the gown is fastened with a row of snaps that fall down the front completely to the hem. The fabric is selected carefully so that it is sure not to irritate her skin and a touch of accent around the hemline adds elegance with the sheer white. Be sure to check out all of the other pieces from the ""Hide and Seek"" collection for spring and summer! Body: 100% cotton. Overlay: 100% polyester. Hand wash cold, line dry. ^||,|$39.00$|,||,|BABY-BISCOTTI-HIDE-SEEK-WHITE-NEWBORN-GOWN|,|$URL$baby-biscotti-hide-seek-white-newborn-gown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-hide-and-seek-white-newborn-gown-1.jpg||-||Baby Biscotti Infant Dress in Pink and Yellow|,|^|A sweet infant dress, this new creation comes from designer Baby Biscotti for spring or summer fun. The sleeveless dress is fastened on her back and has a shapeless A fit. The ruffles that dance across the front are layered like frosting and fall from pale yellow to a soft pink. Matching small flowers are found sprinkled about. Solid pink bloomers are worn beneath the dress. They offer her a stretch waistband with elastic while both legs are finished with a ruffle. This piece is part of the ""Sachet"" collection. Made with cotton blend. Machine wash cold, tumble dry low. ^||,|$39.00$|,||,|BABY-BISCOTTI-INFANT-DRESS-PINK-YELLOW|,|$URL$baby-biscotti-infant-dress-pink-yellow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-infant-dress-in-pink-and-yellow-1.jpg||-||Baby Biscotti Ivory Baby Booties|,|Making a sweet baby girls gift, these new infant booties come from Baby Biscotti to match the Ivory Take Home Gown and the Ivory Baby Blanket. The soft cotton booties are soft and cozy on her little fit while a pink satin strap sits upon the top of her foot. A single bloom sits upon the toe of both booties, made with the soft crushed lace. 100% Cotton. Hand wash in warm water. Lay flat to dry. |,|$13.50$|,||,|BABY-BISCOTTI-IVORY-BABY-BOOTIES|,|$URL$baby-biscotti-ivory-baby-booties.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-ivory-baby-booties-1.jpg||-||Baby Biscotti Ivory Take Home Gown|,|^|A sweet arrival, this adorable baby gown comes from Baby Biscotti, the younger sister line to Biscotti and Kate Mack. The ivory take home gown features long sleeves finished with flip paw cuffs that protect her delicate face from scratches as she sleeps. The wrap style on the front is closed with a line of snaps while it forms a ""V"" shaped neckline. Fabric blooms decorate this neckline and match the hem of the gown. A matching hat is available in limited quantities. 100% Cotton. Machine wash in cold water, inside out. Tumble Dry Low. ^||,|$43.50$|,||,|BABY-BISCOTTI-IVORY-TAKE-HOME-GOWN|,|$URL$baby-biscotti-ivory-take-home-gown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-ivory-take-home-gown-21.jpg||-||Baby Biscotti Macherie Amour Pink Baby Blanket|,|A perfect gift for the newborn princess in your life, this boutique baby blanket is sure to celebrate the special occasion with grace and elegance! The soft shade of pink covers this blanket, perfect for any baby girl! A small scallop accent is created on the edge of this blanket. A heart adorns a single corner, created with ruffles of tulle and touches of velvet ribbon. 100% Cotton. Machine Wash in Cold Water. Tumble Dry Low. Measures 27 inches wide and 36 inches long. |,|$31.50$|,||,|BABY-BISCOTTI-MACHERIE-AMOUR-PINK-BABY-BLANKET|,|$URL$baby-biscotti-macherie-amour-pink-baby-blanket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-macherie-amour-pink-baby-blanket-11.jpg||-||Baby Biscotti Newborn Gown in Pink|,|^|New from designer Baby Biscotti, this baby girls gown is an elegant choice for most any occasion. The long sleeve gown features a wrap neckline accented with matching flowers. The cuffs have flip paws to help protect her from scratches. A row of small snaps un down the front, fastening it closed. The hemline is accented with sheer pale pink accents. The gown looks stunning in photographs and is sure to make a great baby shower gift! Body: 100% cotton. Overlay: 100% polyester. Hand wash cold, line dry. SIZE NEWBORN ONLY REMAINING.  ^||,|$39.00$|,||,|BABY-BISCOTTI-NEWBORN-GOWN-PINK|,|$URL$baby-biscotti-newborn-gown-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-newborn-gown-in-pink-1.jpg||-||Baby Biscotti Pink Girls Blanket|,|^|A solid new designer blanket for your new baby girl, this design comes from Baby Biscotti. The light pink cotton is found on both sides of this blanket, making it extremely comfortable on her delicate skin. The only decoration is found in a single corner. Three flowers are grouped together in a coordinating fabric and a sparkling center. This baby girls blanket matches the new outfits found in Baby Biscotti's ""Hide and Seek"" collection! 100% cotton. Machine wash cold, tumble dry low. ^||,|$31.50$|,||,|BABY-BISCOTTI-PINK-GIRLS-BLANKET|,|$URL$baby-biscotti-pink-girls-blanket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-pink-girls-blanket-1.jpg||-||Baby Biscotti Pink Blanket Baby Sachet|,|^|A perfect match to four other new arrivals, this baby girls blanket was designed by Baby Biscotti. The blanket is made completely with cotton in the pale pink that fills the ""Sachet"" collection for spring and summer. A single corner of the blanket is decorated with two light yellow and a single pink flower that are grouped together. A light pink blanket is a must have staple for all new baby girls! CachCach fills every design with both style and quality. 100% cotton. Machine wash cold, tumble dry low. ^||,|$31.50$|,||,|BABY-BISCOTTI-PINK-BLANKET-BABY-SACHET|,|$URL$baby-biscotti-pink-blanket-baby-sachet.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-pink-blanket-baby-sachet-1.jpg||-||Baby Biscotti Pink Infant Birthday Girl Dress (12 mos)|,|^|This new Baby Biscotti designer is the perfect special occasion dress for infants, sure to look lovely at birthday or wedding celebrations! The pale pink shades this entire piece while the empire bodice has a raw satin sheen. Her classic neckline is fastened close in the back and is framed by cap sleeves. A row of chiffon flowers are finished with pearl bead centers and line the waist. From the waist, the sheer fabric flows into an elegant skirt. Silk/Polyester Blend. Dry Clean Only. ONE SIZE 12 MOS ONLY LEFT. ^||,|$61.50$|,||,|BABY-BISCOTTI-PINK-INFANT-BIRTHDAY-GIRL-DRESS|,|$URL$baby-biscotti-pink-infant-birthday-girl-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-pink-infant-birthday-girl-dress-1.jpg||-||Baby Biscotti Pink Infant Outfit - Hide and Seek|,|Created by Baby Biscotti, this adorable new infant outfit is a sure hit. The fitted top is cut with a sleeveless neckline that fastens in the back. Two quaint flowers sit off to her left while small scallops of thread edge the piece. The bottom of the top is ruffled with sheer pink accents. Solid bloomer shorts are paired with the top. They have an easy pull on fit with the stretch waistband that matches the ruffled hem found on both legs. Body: 100% cotton. Overlay: 100% polyester. Hand wash cold, line dry. |,|$39.00$|,||,|BABY-BISCOTTI-PINK-INFANT-OUTFIT-HIDE-SEEK|,|$URL$baby-biscotti-pink-infant-outfit-hide-seek.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-pink-infant-outfit-hide-and-seek-1.jpg||-||Baby Biscotti Pink Infant Ruffle Gown|,|^|Baby Biscotti now offers this fabulous infant gown that is perfect for her take home outfit or for her photo debut! The light pink fabric is a soft cotton while the long sleeves are finished with a flip paw cuff. The flip paw cuff allows you to protect her from fingernail scratches while she sleeps. The front of the gown features glorious cascades of ruffles in various fabrics for a great textured look. A trio of buttons fasten on the back of the gown. Matching accessories are also available while supplies last. 100% Cotton. Machine Wash in Cold Water on Gentle Cycle. Line Dry. SIZE NEWBORN ONLY LEFT. ^||,|$44.25$|,||,|BABY-BISCOTTI-PINK-INFANT-RUFFLE-GOWN|,|$URL$baby-biscotti-pink-infant-ruffle-gown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-pink-infant-ruffle-gown-1.jpg||-||Baby Biscotti Rose Crush Baby Romper|,|^|For your new baby princess, this infant romper comes from designer Baby Biscotti, known for elegance and quality. The ivory cotton is soft upon her skin while the long sleeves have the flip paw cuffs that protect her from fingernail scratches. A row of snaps run up the back of the roper and is found on the inseam for easy changing. The closed foot found on the legs keep her feet safe from chilly air. Soft matching lace creates the fabric rosettes that are found skirting the waistline and next to the classic neck shape. 100% Cotton. Machine wash in cold water, inside out. Tumble dry on low heat.SIZE NEWBORN ONLY LEFT. ^||,|$46.50$|,||,|BABY-BISCOTTI-ROSE-CRUSH-BABY-ROMPER|,|$URL$baby-biscotti-rose-crush-baby-romper.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-rose-crush-baby-romper-1.jpg||-||Baby Biscotti Rose Crush Infant Hat in Ivory|,|New from Baby Biscotti, this delicate infant hat is a sweet accessory to match her new romper or gown from their fall and winter collection. The folded brim is finished with a quaint touch of lace. A soft crushed ivory lace creates a luxurious rose bloom to match the other pieces in the collection. This baby hat is sure to be made with quality and love. 100% Cotton. Hand wash in warm water. Line Dry. |,|$12.00$|,||,|BABY-BISCOTTI-ROSE-CRUSH-INFANT-HAT-IVORY|,|$URL$baby-biscotti-rose-crush-infant-hat-ivory.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-rose-crush-infant-hat-in-ivory-1.jpg||-||Baby Biscotti Summer Capri Set Little Sprite (Newborn)|,|^|Matching older styles that come from Biscotti as a part of the ""Water Sprite"" collection, this baby girls set is sure to fit in to the new life that sweeps through spring. Blue top is fastened in the back with snaps while the light blue fabric is covered with a small pink flower print. A petal flower is found off centered on the neckline while the cap sleeves feature two fun ruffles! The hemline is cut in a scallop pattern that is accented with cute ruffles and three petal flowers. Pants are paired below in the same sweet fabric. The relaxed fit opens slightly at the scallop hem of both legs. Made with cotton blend. Machine wash cold, tumble dry low. SIZE NEWBORN ONLY LEFT. ^||,|$39.00$|,||,|BABY-BISCOTTI-SUMMER-CAPRI-SET-LITTLE-SPRITE|,|$URL$baby-biscotti-summer-capri-set-little-sprite.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-summer-capri-set-little-sprite-11.jpg||-||Baby Biscotti White Booties Hide and Seek|,|^|In a classic white, this new creation comes from the loved brand Baby Biscotti for spring and summer. The cotton booties wrap around her feet to help keep them warm. The soft cotton is delicate on her skin and a single band stretches across the top of her foot with elastic. A single flower on the toe is accented with a cute center decoration. These baby booties match perfectly the new white ""Hide and Seek"" newborn gown! 100% cotton. Delicate hand wash cold, reshape and line dry. ^||,|$13.00$|,||,|BABY-BISCOTTI-WHITE-BOOTIES-HIDE-SEEK|,|$URL$baby-biscotti-white-booties-hide-seek.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-white-booties-hide-and-seek-1.jpg||-||Baby Biscotti White Bow Hat Wrapped in Ruffles|,|From designer Biscotti, this wrapped in ruffles hat in white is the perfect adornment. The soft cotton features a ruffled bow in a satin finish. Hand wash, line dry. |,|$6.00$|,||,|BABY-BISCOTTI-WHITE-BOW-HAT-WRAPPED-RUFFLES|,|$URL$baby-biscotti-white-bow-hat-wrapped-ruffles.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-white-bow-hat-wrapped-in-ruffles-21.jpg||-||Baby Biscotti White Newborn Hat|,|^|A solid white hat, this new arrival from designer Baby Biscotti comes to match the new ""Hide and Seek"" gown. The hat is made with a great cotton that is perfect for a new little princess. Two matching flowers are set off to one side. When creating the perfect baby shower gift, pair this hat with its gown to really thrill the mom-to-be! A designer gown and accessory are always a quality choice for her first day home or sweet newborn photos! 100% cotton. Delicate hand wash cold, reshape and line dry. ^||,|$12.00$|,||,|BABY-BISCOTTI-WHITE-NEWBORN-HAT|,|$URL$baby-biscotti-white-newborn-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-white-newborn-hat-1.jpg||-||Baby Biscotti White Velour Baby Blanket Winter Wonderland|,|A wonderful pair for her new Baby Biscotti Winter Wonderland dress, this baby girls blanket is one she'll love to carry wherever she goes. The soft white velour is like heaven on her delicate skin. A satin ruffle runs around the outside of the blanket. A trio of silver butterflies have made a single corner their home. Made with a cotton blend. Machine wash cold, tumble dry low. |,|$19.00$|,||,|BABY-BISCOTTI-WHITE-VELOUR-BABY-BLANKET-WINTER-WONDERLAND|,|$URL$baby-biscotti-white-velour-baby-blanket-winter-wonderland.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-white-velour-baby-blanket-winter-wonderland-2.jpg||-||Baby Bling Black Headband with Gem Rosette|,|Truly elegant, this perfect new hair accessory has arrived from Baby Bling. The headband features a rosette hand turned from ribbon. The gem center is certain to reflect every ray of light that comes its way. A large feather stands out from underneath along side a touch of tulle ruffles. Made in the USA. 100% Nylon. |,|$16.00$|,||,|BABY-BLING-BLACK-HEADBAND-GEM-ROSETTE|,|$URL$baby-bling-black-headband-gem-rosette.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-bling-black-headband-with-gem-rosette-1.jpg||-||Baby Bling Bright Aqua Headband with Rosette|,|A bold, beautiful blue, this little girls Baby Bling headband fits infants through toddlers. The wide headband stretches as it comfortably wraps around her head. A ribbon rosette is created to sit off to one side completed with a sparkling center. A fancy finishing touch is found in the tulle ruffle and feathers. Made in the USA. 100% Nylon. |,|$16.00$|,||,|BABY-BLING-BRIGHT-AQUA-HEADBAND-ROSETTE|,|$URL$baby-bling-bright-aqua-headband-rosette.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-bling-bright-aqua-headband-with-rosette-1.jpg||-||Baby Bling Fancy Headband in Black Tulle|,|Baby Bling is now offering this elegant new headband to accessorize her special occasion dresses. The black band stretches comfortably and allows for a personal fit that will stay in place. Black tulle is ruffled to create the blooms that are set off to one side. Bead accents finish this design in the center of the flowers. Made in the USA. 100% Nylon. |,|$11.00$|,||,|BABY-BLING-FANCY-HEADBAND-BLACK-TULLE|,|$URL$baby-bling-fancy-headband-black-tulle.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-bling-fancy-headband-in-black-tulle-1.jpg||-||Baby Bling Flower Headband in Pink|,|A beautiful accessory she will love wearing, this fabulous little girls headband comes from Baby Bling. The pink headband features a comfortable stretch that allows for a personal fit. Off set to one side we find a garden of flower appliques. These flowers are layered with light and rose pink petals. The center of these flowers has a dazzling gem proudly reflecting the light.Made in the USA. 100% Nylon. |,|$18.00$|,||,|BABY-BLING-FLOWER-HEADBAND-PINK|,|$URL$baby-bling-flower-headband-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-bling-flower-headband-in-pink-1.jpg||-||Baby Bling Girls Lavender Headband|,|In gorgeous lavender, this fabulous accessory from Baby Bling is certain to be a favorite to pair with her closet of clothes! The light purple headband that stretches for a perfect fit around her head is just the beginning! A matching ribbon is turned into spirals as it leads to the sparkling gems. This rosette is placed on a bed of feathers and tulle. Made in the USA. 100% Nylon. |,|$16.00$|,||,|BABY-BLING-GIRLS-LAVENDER-HEADBAND|,|$URL$baby-bling-girls-lavender-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-bling-girls-lavender-headband-1.jpg||-||Baby Bling Girls Rosette Headband in Pink|,|The perfect pink accessory, this fabulous Baby Bling headband is certainly a gorgeous look for every day or birthdays! The rose pink band has a large stretch in fit. The matching rosette flower is created with spirals of hand turned ribbon and a cute gem center. A pleated ruffle of tulle is found accenting the bloom alongside a wide feather. Made in the USA. 100% Nylon. |,|$16.00$|,||,|BABY-BLING-GIRLS-ROSETTE-HEADBAND-PINK|,|$URL$baby-bling-girls-rosette-headband-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-bling-girls-rosette-headband-in-pink-1.jpg||-||Baby Bling Grey Rosette Headband for Girls|,|An elegant design that will compliment all of her special occasion dresses, this fabulous little girls headband is from Baby Bling. A spiral of ribbons twist into the center of the rosette that is decorated with a large button. A sparkling tulle and a touch of feathers are darling accents upon which the flower is placed. The grey stretch band has a comfortable fit on her head and allows this accessory to fit multiple sizes. Made in the USA. 100% Nylon. |,|$16.00$|,||,|BABY-BLING-GREY-ROSETTE-HEADBAND-GIRLS|,|$URL$baby-bling-grey-rosette-headband-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-bling-grey-rosette-headband-for-girls-1.jpg||-||Baby Bling Ivory Headband with Tulle Flowers|,|In neutral ivory, this new hair accessory for little girls is a sweet creation that is perfectly suited for almost all of her special occasions! A beautiful decoration is set off to the side, boasting of its tulle flowers. The center of these blooms is decorated with beads. The stretch of the headband is certainly comfortable as it gives a custom fit. Pair this with any outfit or dress! Made in the USA. 100% Nylon. |,|$11.00$|,||,|BABY-BLING-IVORY-HEADBAND-TULLE-FLOWERS|,|$URL$baby-bling-ivory-headband-tulle-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-bling-ivory-headband-with-tulle-flowers-1.jpg||-||Baby Bling Mint Rosette Headband|,|In trendy cool mint, this adorable headband new from Baby Bling fits sizes from newborn to 4T. The light band stretches around her head for a perfect fit. The bold mint rosette is created from ribbon and features a gem center. Final touches of tulle and sweet boa feathers truly complete the look. Made in the USA. 100% Nylon. |,|$16.00$|,||,|BABY-BLING-MINT-ROSETTE-HEADBAND|,|$URL$baby-bling-mint-rosette-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-bling-mint-rosette-headband-1.jpg||-||Baby Bling Orange Flower Headband with Bling|,|A great color all year round, this orange hair accessory was created for little girls by Baby Bling. A glimmering center is found adorning the ribbon rosette. This decoration is set off centered to one side of her head. Final accents of tulle and feathers are a perfect touch! Made in the USA. 100% Nylon. |,|$16.00$|,||,|BABY-BLING-ORANGE-FLOWER-HEADBAND-BLING|,|$URL$baby-bling-orange-flower-headband-bling.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-bling-orange-flower-headband-with-bling-1.jpg||-||Baby Bling Red Girls Headband with Rosette|,|Whether she is posing for holiday photos or celebrating Valentine's Day, this adorable new headband from Baby Bling has her covered! The rich red tone is a gorgeous color all year round and is certain to compliment her outfit. The pleated ruffle of tulle is covered with sparkling glitter and accompanied by a feather. The main decoration is a spiral rosette with a gem center. Made in the USA. 100% Nylon. |,|$16.00$|,||,|BABY-BLING-RED-GIRLS-HEADBAND-ROSETTE|,|$URL$baby-bling-red-girls-headband-rosette.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-bling-red-girls-headband-with-rosette-1.jpg||-||Baby Bling Rosette Headband in White|,|A perfect fancy headband that can be versatile with many of her dresses and outfits, this accessory was designed by Baby Bling. The stretch of the headband is both comfortable and perfect for all day wear. A hand turned rosette is set off to one side of her head and decorated with a large center. A touch of boa feathers is placed beneath adding a unique, beautiful detail. Made in the USA. 100% Nylon. |,|$16.00$|,||,|BABY-BLING-ROSETTE-HEADBAND-WHITE|,|$URL$baby-bling-rosette-headband-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-bling-rosette-headband-in-white-1.jpg||-||Baby Bling Silver Headband for Girls with Flowers|,|Complimenting many of her outfits, this new little girls headband is a creation by Baby Bling. The unique band has a great stretch that is comfortable on her head. The band is lightly colored in grey. A garden of flowers are worn off to one side of her head colored in white and silver. A detail of a sparkling center finishes this look off perfectly! Made in the USA. 100% Nylon. |,|$18.00$|,||,|BABY-BLING-SILVER-HEADBAND-GIRLS-FLOWERS|,|$URL$baby-bling-silver-headband-girls-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-bling-silver-headband-for-girls-with-flowers-1.jpg||-||Baby Bling Tulle Flower Headband in Purple|,|Sweet lavender, this darling headband from Baby Bling is certain to be one of her favorites to wear with her boutique outfits! Ivory beads are placed at the center of both tulle flowers. These flowers are meant to sit off to one side of her head. The band has an easy stretch that is comfortable and secure on her head. |,|$11.00$|,||,|BABY-BLING-TULLE-FLOWER-HEADBAND-PURPLE|,|$URL$baby-bling-tulle-flower-headband-purple.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-bling-tulle-flower-headband-in-purple-1.jpg||-||Baby Bling White Hairclip with Rhinestone|,|The floral center of this girls hairclip is a chunky rhinestone. White bow is about 2.5 inches across. By Baby Bling. |,|$9.00$|,||,|WHITE-BABY-BLING-BOW|,|$URL$white-baby-bling-bow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-bling-white-hairclip-with-rhinestone-10.jpg||-||Baby Nay Infant Girls Dress English Garden (3 Mos & 6 Mos)|,|From designer Baby Nay, this new infant dress is part of their spring collection. The empire bodice has short, puffy sleeves while a large rose print covers the cotton fabric. The dress hides its onesie fit underneath the light lime skirt. The skirt is broken up into three tiers that have a full circle shape and are covered with large polka dots. Three changing snaps are found on the onesie underneath. Made with cotton blend. Machine wash cold, tumble dry low. |,|$19.00$|,||,|BABY-NAY-INFANT-GIRLS-DRESS-ENGLISH-GARDEN|,|$URL$baby-nay-infant-girls-dress-english-garden.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-nay-infant-girls-dress-english-garden-1.jpg||-||Baby Sara Adorable Little Girls Outfit|,|Baby Sara has designed this wonderful new outfit for little girls. The ivory top boasts of its fun sheer ruffle tiers that cover the front. Soft vintage rose pink flowers accent the sleeveless neckline. The back of the top is a solid blend fabric that allows stretch in its pull over fit. The top is paired with light rose pink shorts. The waist has a drawstring tie and a thin ribbon that wraps completely around. Whether she has casual summer or spring day plans, she will certainly enjoy this wonderful designer girls outfit. 95% cotton 5% spandex. Hand wash cold, dry flat. |,|$34.00$|,||,|BABY-SARA-ADORABLE-LITTLE-GIRLS-OUTFIT|,|$URL$baby-sara-adorable-little-girls-outfit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-adorable-little-girls-outfit-27.jpg||-||Baby Sara Animal Print Dress and Legging with Faux Fur (Size 18 Mos)|,|^|From Baby Sara's new fall 2013 collection, this designer girls dress will have her seeing spots! The ivory dress features solid long sleeves and a layered neckline. The empire waistline features a flower and bow centered on the front as a garnish. The skirt opens to an A line shape and boasts of the dual patterned hemline in two tiers. The leopard print leggings are made with a stretch fabric that allows for a comfortable fit perfect for all day wear. The faux fur mocks the look of leg warmers in a plush ivory. Made with polyester blend. Hand wash cold, flat dry. (1) 18 MOS ONLY LEFT. ^||,|$46.00$|,||,|BABY-SARA-ANIMAL-PRINT-DRESS-LEGGING-FAUX-FUR|,|$URL$baby-sara-animal-print-dress-legging-faux-fur.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-animal-print-dress-and-legging-with-faux-fur-17.jpg||-||Baby Sara Creme Ruffle Dress with Leopard Leggings|,|Darling and sweet this creation comes from beloved designer Baby Sara. Baby Sara is known for their comfortable outfits and on trend styles, and this outfit is no different! The long sleeve dress is in ivory and features fabric flower appliques that frame the neckline. The sleeves are finished with slight gathering. The skirt of this dress is created with two layers in a chiffon fabric with different prints. Paired beneath are the matching leopard print leggings. The hem of the leggings is decorated with layers of alternating sheer fabrics. Polyester/Spandex. Hand wash inside out in cold water. Lay flat to dry. |,|$70.50$|,||,|BABY-SARA-CREME-RUFFLE-DRESS-LEOPARD-LEGGINGS|,|$URL$baby-sara-creme-ruffle-dress-leopard-leggings.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-creme-ruffle-dress-with-leopard-leggings-16.jpg||-||Baby Sara Flower Tunic with Ruffle and Pink Leggings|,|A warm look that is full of style, this fabulous Baby Sara outfit is a part of their new fall and winter line. The sweater knit bodice is made with a rich brown coloring while a handmade rose applique is found next to the neckline complimented with two coordinating leaves. The long sleeves have a button cuff accent while the sweater fabric is unlined on the sleeves for an elegant touch. The layered hemline features two chiffon ruffles, one in pink and one in sweet ivory. Solid light pink leggings are paired beneath with a small touch of lace found near the hem of both legs. 100% Polyester. Hand wash inside out in cold water. Lay flat to dry. |,|$66.75$|,||,|BABY-SARA-FLOWER-TUNIC-RUFFLE-PINK-LEGGINGS|,|$URL$baby-sara-flower-tunic-ruffle-pink-leggings.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-flower-tunic-with-ruffle-and-pink-leggings-6.jpg||-||Baby Sara Girls Black Dress with Stars|,|New from Baby Sara, this fabulous girls dress is a welcome arrival for the back to school season. The black bodice features a wide neckline and long sleeves. A group of dazzling stars decorate the front created with gems, sequins, and leopard fabric. The skirt is a larger leopard print featuring a wide black hemline and black tulle overlay. This dress is fastened with a hidden zipper that runs up the back. 100% Rayon. Hand Wash in Cold Water. Lay Flat to Dry. |,|$49.50$|,||,|BABY-SARA-GIRLS-BLACK-DRESS-STARS|,|$URL$baby-sara-girls-black-dress-stars.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-girls-black-dress-with-stars-11.jpg||-||Baby Sara Girls Dress in Chiffon (Size 6X)|,|^|From fabulous Baby Sara, this new girls dress is a gem for this coming Easter celebration! The bodice of the dress has two thin straps and five large, alternating flowers that sit upon the front of the neckline. The light weight fabric is perfect for the blouson fit that is introduced by the elastic gathered waistline. The skirt continues in the same silky chiffon fabric. The floral print is made mostly with shades of pink, inspired by the blooms of spring. If a slight chill is in the air, this dress looks fabulous with a light sweater! Polyester. Hand wash inside out, dry flat. ONE SIZE 6X LEFT. ^||,|$39.00$|,||,|BABY-SARA-GIRLS-EASTER-DRESS-CHIFFON|,|$URL$baby-sara-girls-easter-dress-chiffon.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-girls-dress-in-chiffon-1.jpg||-||Baby Sara Girls Faux Fur Vest with Rosettes|,|^|A great way to complete her favorite new Baby Sara outfits, this new designer vest for little girls will not last for long! The ivory faux fur is soft to the touch while lined with a pink and black polka dot. A ruffle wraps around the neck and hemlines. Fabric rosettes add accents and color to this new piece. ONE EACH SIZE 4 AND 6X ONLY LEFT.  ^||,|$48.00$|,||,|BABY-SARA-GIRLS-FAUX-FUR-VEST-ROSETTES|,|$URL$baby-sara-girls-faux-fur-vest-rosettes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-girls-faux-fur-vest-with-rosettes-24.jpg||-||Baby Sara Girls Faux Fur Vest with Wooden Buttons|,|^|Looking stylish with her new Baby Sara outfits, this faux fur vest is part of the ""Dancing Petals"" collection from fall and winter. The vest features a collar and a fun floral fabric in the lining. Two large wooden buttons with a lace ribbon fasten in the front. The shaggy style of the faux fur is colored with multiple natural shades and compliments the style of the brand. 100% Polyester. Hand Wash in Cold Water. Lay Flat to Dry. ^||,|$51.75$|,||,|BABY-SARA-GIRLS-FAUX-FUR-VEST-WOODEN-BUTTONS|,|$URL$baby-sara-girls-faux-fur-vest-wooden-buttons.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-girls-faux-fur-vest-with-wooden-buttons-23.jpg||-||Baby Sara Girls Lace Flower Top and Skirt|,|^|A darling creation, this new girls outfit is positively lovely! The long sleeve top is a light pink and is styled with a ""U"" shaped neckline. The front of the top is covered with a sheer ivory tulle overlay that is dressed with flowers. A grouping of sequins is found on the center of each flower. The back of the top is plain. The paired skirt has a fun tutu inspiration with the layers of ivory tulle ruffles. The metallic waistband stretches for an easy and comfortable fit! Rayon/Spandex Blend. Hand Wash in Cold Water. Lay Flat to Dry. ^||,|$78.00$|,||,|BABY-SARA-GIRLS-LACE-FLOWER-TOP-SKIRT|,|$URL$baby-sara-girls-lace-flower-top-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-girls-lace-flower-top-and-skirt-28.jpg||-||Baby Sara Girls Pink Party Dress|,|In popular pink, this new dress for little girls is a creation of Baby Sara. The empire bodice is wrapped with thin pink stripes. The straps are covered with flower appliques that fall down the sides of the bodice just past the waistline. The skirt has a small flower pattern and is broken into three tiers. The skirt boasts of a sheer overlay that is covered with fun, large polka dots. This dress is sure to make her feel carefree and fun during the spring and summer months! Hand wash cold, dry flat. |,|$48.00$|,||,|BABY-SARA-GIRLS-PINK-PARTY-DRESS|,|$URL$baby-sara-girls-pink-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-girls-pink-party-dress-17.jpg||-||Baby Sara Girls Puppy Top and Pink Skirt Set|,|A new little girls outfit from Baby Sara, this arrival is sure to be loved no matter where she is! The long sleeve top is a soft, solid white fabric. Upon the front of this shirt we find a cut puppy screen print accented with a crochet hat applique. The top is paired with a bubblegum pink tutu skirt created with layers of tulle. The metallic gold waistline is a comfortable stretch fit. |,|$66.00$|,||,|BABY-SARA-GIRLS-PUPPY-TOP-PINK-SKIRT-SET|,|$URL$baby-sara-girls-puppy-top-pink-skirt-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-girls-puppy-top-and-pink-skirt-set-28.jpg||-||Baby Sara Girls Tunic with Tulle and Matching Pants|,|Created by designer Baby Sara, this new little girls outfit is sure to be a welcome look for her back to school wardrobe. The Top features a wide neckline framed with the gold glitter short sleeves. Small flower accents are found upon the front of this grey top. The hemline is skirted with a sweet light pink tulle ruffle. Paired beneath the top we find a grey and white stripe legging completed with a ruched bottom. |,|$61.50$|,||,|BABY-SARA-GIRLS-TUNIC-TULLE-MATCHING-PANTS|,|$URL$baby-sara-girls-tunic-tulle-matching-pants.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-girls-tunic-with-tulle-and-matching-pants-33.jpg||-||Baby Sara Green Stripe Dress with Lace Trim|,||,|$43.00$|,||,|BABY-SARA-GREEN-STRIPE-DRESS-LACE-TRIM|,|$URL$baby-sara-green-stripe-dress-lace-trim.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-green-stripe-dress-with-lace-trim-1.jpg||-||Baby Sara Infant and Toddler Dress in Chevron|,|A wacky design filled with summer, this designer girls dress is designed by Baby Sara. The bodice offers two fabric flowers that rest upon both shoulder straps. The scoop neckline is edged with a thin lined pink fabric. The back of the bodice has a racer back fit. The skirt continues in the unique chevron print that is filled with hullabaloo. The tiers are divided with smocked ruffles. The fabric is light weight for the heat of the sun. 100% polyester. Hand wash cold, lay flat to dry. |,|$36.75$|,||,|BABY-SARA-INFANT-TODDLER-DRESS-CHEVRON|,|$URL$baby-sara-infant-toddler-dress-chevron.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-infant-and-toddler-dress-in-chevron-1.jpg||-||Baby Sara Little Girls Capri Outfit|,|By fabulous Baby Sara, this new designer girls outfit is positively darling! The top features a strappy scoop neckline. The back of the top has small cutout found in the center. Fabric layers in cute ruffles. The sheer ivory into grey polka dots, leading to the black sequin mesh all bring in a different texture. The top is lined for her comfort. Solid capris are paired beneath in midnight black. The stretch fit is comfortable for all day wear. Cotton/poly blend. Hand wash inside out, dry flat. |,|$49.00$|,||,|BABY-SARA-LITTLE-GIRLS-CAPRI-OUTFIT|,|$URL$baby-sara-little-girls-capri-outfit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-little-girls-capri-outfit-1.jpg||-||Baby Sara Little Girls Dress in Leopard|,|For the fashionista with a wild style, this new little girls dress is sure to spark her imagination. The bodice has a soft ribbed knit texture and is covered with the dark leopard spots. Short sleeves frame the wide neckline while a lacey bow becomes the bed for a wrapped rosette. The dress has a pull over fit which is assisted by the slight stretch found in the fabric. The skirt is right from a princess dream. The upper half is a sheer light pink with polka dots while a rose ruffle defines the end of one color into the next. The dark magenta pink has a crinkle texture but boasts of the same polka dots shining through. She will want to wear this dress for photos, birthdays, and every day fun! Hand wash cold, dry flat. |,|$49.00$|,||,|BABY-SARA-LITTLE-GIRLS-DRESS-LEOPARD|,|$URL$baby-sara-little-girls-dress-leopard.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-little-girls-dress-in-leopard-17.jpg||-||Baby Sara Little Girls Dress Pink Stripe|,|This new little girls dress from Baby Sara is sure to be a favorite! The scoop neck has a pink accented fabric, and thin pink and gray striped sleeves, perfect for layering. The heathered gray fabric of the a line dress shows natural white fibers to give it depth. Towards the bottom hem there are 3 ruffled fabric flowers which accent the sleeves nicely. Being quite a versatile piece, it can be worn alone or pair it with tights, boots and a jacket for fall. Made of a stretch cotton blend. Hand wash in cold water. Lay flat to dry. Cotton/Spandex. Hand wash inside out in cold water. Lay flat to dry. |,|$46.50$|,||,|BABY-SARA-LITTLE-GIRLS-DRESS-PINK-STRIPE|,|$URL$baby-sara-little-girls-dress-pink-stripe.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-little-girls-dress-pink-stripe-1.jpg||-||Baby Sara Little Girls Gray Jacket with Gold Sequins|,|A fun new design, this blazer was created by the Sara Sara sister brand, Baby Sara. The grey jacket has long sleeves to add warmth to her outfit. The fabric is colored in a light grey while the front is an open style, free from buttons or zippers. Shimmering sequins line the piece and add a dazzling touch upon a bed of tulle ruffles. This blazer matches perfectly to the Girls Tunic with Tulle and Matching Pants. |,|$43.50$|,||,|BABY-SARA-LITTLE-GIRLS-GRAY-JACKET-GOLD-SEQUINS|,|$URL$baby-sara-little-girls-gray-jacket-gold-sequins.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-little-girls-gray-jacket-with-gold-sequins-19.jpg||-||Baby Sara Little Girls Ruffled Dress|,|From Baby Sara, this girls dress will be one that she wears all the time. The light bodice is covered with a thin grey stripe while a cute lace applique is adorned by small roses and accents the shape of the neckline. Two pink straps that run across her back are styled to mimic darling bows. The skirt is layered with a soft floral pattern and a pink mesh overlay. The layers of ruffles continue from her uneven waist down to the straight hemline. Made with a polyester blend. Hand wash cold, lay flat to dry. |,|$44.00$|,||,|BABY-SARA-LITTLE-GIRLS-RUFFLED-DRESS|,|$URL$baby-sara-little-girls-ruffled-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-little-girls-ruffled-dress-1.jpg||-||Baby Sara Little Girls Sequin Heart Tunic with Pants|,|This new designer girls outfit comes from the Baby Sara brand and is sure to be loved at first sight! The long sleeve top is a stylish casual, perfect for days back at school! The soft fabric is finished with a shark bite hemline. A large heart accent is placed front and center, color blocked in shimmering sequins. The top is accompanied by black leggings with a gold snake skin accent that runs down both sides and covers the knees. |,|$55.50$|,||,|BABY-SARA-LITTLE-GIRLS-SEQUIN-HEART-TUNIC-PANTS|,|$URL$baby-sara-little-girls-sequin-heart-tunic-pants.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-little-girls-sequin-heart-tunic-with-pants-28.jpg||-||Baby Sara Pink and Gray Striped Tunic with Pants|,|New from Baby Sara, this little girls outfit is both comfortable and stylish. The long sleeve tunic is covered with thin grey and light pink stripes. Three wrap rosettes with beaded centers are placed upon the long sleeve bodice. The fit opens from the empire waistline while two tiers are defined by the quaint ruffles. A comfortable pair of leggings accompanies the top to be worn beneath. Matching fabric flowers are found on both legs. Cotton/Spandex Blend. Hand Wash in Cold Water. Lay Flat to Dry. |,|$61.50$|,||,|BABY-SARA-PINK-GRAY-STRIPED-TUNIC-PANTS|,|$URL$baby-sara-pink-gray-striped-tunic-pants.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-pink-and-gray-striped-tunic-with-pants-6.jpg||-||Baby Sara Pink Faux Fur Coat for Girls|,|Created by Baby Sara, this little girls winter coat is beautiful in pink! The coat is covered in a soft faux fur that is textured with sweet roses. The front of the coat is fastened with a row of large, hidden snaps from the hem to the collar. The coat is lined for both warmth and comfort! |,|$66.00$|,||,|BABY-SARA-PINK-FAUX-FUR-COAT-GIRLS|,|$URL$baby-sara-pink-faux-fur-coat-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-pink-faux-fur-coat-for-girls-18.jpg||-||Baby Sara Pink Tank and Flower Skirt Set for Girls|,|Baby Sara is now offering this pretty pink girls outfit as a part of their fall and winter collection. The pink tank top is cut for a more fitted look and features a classic neckline. The solid top is free from adornments to better compliment the fabulous skirt it is paired with. The skirt features a metallic stretch waistline with an easy pull on fit. The tulle overlay is decorated with sequin centered flowers and a double ruffle hem. The pink lining is seen through this sheer fabric. |,|$55.50$|,||,|BABY-SARA-PINK-TANK-FLOWER-SKIRT-SET-GIRLS|,|$URL$baby-sara-pink-tank-flower-skirt-set-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-pink-tank-and-flower-skirt-set-for-girls-7.jpg||-||Baby Sara Polka Dot Pink and Black Tunic and Pant|,|An adorable look for back to school, this new girls boutique outfit was designed by Baby Sara. The tunic top is striped in black and white and offers long sleeves for the cooler air of the fall and winter seasons. Two flowers decorate the neckline. A black polka dot skirt creates the hem of this top. The paired pant is a solid black fabric that allows stretch and has an elastic waistband. The hem of these pants are a sweet triple ruffle. |,|$64.50$|,||,|BABY-SARA-POLKA-DOT-PINK-BLACK-TUNIC-PANT|,|$URL$baby-sara-polka-dot-pink-black-tunic-pant.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-polka-dot-pink-and-black-tunic-and-pant-29.jpg||-||Baby Sara Pretty Dress with Dotted Sequins|,|^|Absolutely gorgeous! This new designer dress for girls comes from Baby Sara as a part of their ""Twinkle Toes"" collection for the fall and winter season. Whether she is at a wedding, birthday, or holiday celebration, this special occasion dress is sure to fit the event! The sleeveless bodice features a racerback with a single button keyhole while the neckline is trimmed with satin. The peachy pink bodice is covered with a tulle overlay on the front dressed with roses and sparkling sequins. The waistline is decorated with a large bow while the darker cocoa pink is layered in polka dot tulle ruffles. This dress looks fabulous in person and in photographs! 100% Polyester. Hand wash inside out in cold water. Lay flat to dry. ^||,|$58.50$|,||,|BABY-SARA-PINK-DRESS-DOTTED-SEQUINS|,|$URL$baby-sara-pink-dress-dotted-sequins.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-pink-dress-with-dotted-sequins-33.jpg||-||Baby Sara Silver Icing Dress for Little Girls (12 Mos, 2T & 5)|,|A dreamy new creation from the Baby Sara line by Sara Sara. The grey bodice features a sleevless neckling enhanced by a white tulle overlay dressed with sequins. The grey waist is garnished by sparkling gems in the center. The oh so gorgeous skirt is created by two tiers of sheery white tulle covered with a shimmering swiss dot print. Both tiers of the skirt are full circle in shape so the extra fabric dances with a free spirit as she moves. The lining of the skirt is a white blended fabric. Whether you pair it with a bolero cardigan or feminine tights and patent leather flats, this dress is sure to shine during the holiday season. Cotton and polyester blend. Hand wash in cold water and lay flat to dry. |,|$37.00$|,||,|BABY-SARA-SILVER-ICING-DRESS-LITTLE-GIRLS|,|$URL$baby-sara-silver-icing-dress-little-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-silver-icing-dress-for-little-girls-13.jpg||-||Baby Sara Sweater Knit Tunic with Pink Legging|,|^|With a multi patterned look, this little girls tunic from Baby Sara is part of their fall 2013 line. The long sleeve tunic features a slightly wider neckline and a loose fit. The colorful prints are made with a soft sweater knit that is delicate and comfortable on her skin. Two scoop pockets on the front are a bright light blue that pops out and is a great accent. The accompanying leggings are a bright rose pink that allows stretch in the fit. The bottom of both legs boast of a ruched or gathered look. Top: 100% cotton. Leggings: Made with cotton blend. Hand wash cold, flat dry. ONE EACH SIZE 4 AND 5 REMAINING.  ^||,|$29.00$|,||,|BABY-SARA-SWEATER-KNIT-TUNIC-PINK-LEGGING|,|$URL$baby-sara-sweater-knit-tunic-pink-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-sweater-knit-tunic-with-pink-legging-2.jpg||-||Bari Lynn Fuchsia Satin Bow Clip|,|^|A pop of color for any hairdo, this new Bari Lynn bow clip is made from a bright fuchsia pink satin. The bow sits upon a bend-to-snap clip and is adorned by two rows of pink crystals in the center. The perfect finishing piece! Roughly 3"" long. ^||,|$13.00$|,||,|BARI-LYNN-FUCHSIA-BOW-CLIP|,|$URL$bari-lynn-fuchsia-bow-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bari-lynn-fuchsia-satin-bow-clip-12.jpg||-||Bari Lynn Red Crystalized Flower Clip|,|^|Sitting upon a wrapped alligator clip, this new hair accessory from designer Bari Lynn is an adorable finishing touch. The red petal rosette features several jeweled petals while the clip itself also boasts of red gems. The flower is 1.5"" across and the clip measures 2"" in length. ^||,|$14.00$|,||,|BARI-LYNN-RED-CRYSTALIZED-CLIP|,|$URL$bari-lynn-red-crystalized-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bari-lynn-red-crystalized-flower-clip-12.jpg||-||Bari Lynn Red Satin Bow Clip|,|^|You can never go wrong with a red satin bow adorning her beautiful hair. Bari Lynn is now offering this 3"" long satin bow adorned with two rows of red crystals in the center. Sits upon a bend-to-snap clip covered with black felt and satin for easy use and a firm hold. ^||,|$13.00$|,||,|BARI-LYNN-RED-SATIN-BOW-CLIP|,|$URL$bari-lynn-red-satin-bow-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bari-lynn-red-satin-bow-clip-9.jpg||-||Bari Lynn Red Thin Party Headband with Bow|,|Wrapped with a classic red satin ribbon, this thin, hard headband will dress her head in elegant beauty. The headband boast simply of its structured, matching bow adorned with red crystals in the center. |,|$19.00$|,||,|BARI-LYNN-RED-THIN-PARTY-HEADBAND-BOW|,|$URL$bari-lynn-red-thin-party-headband-bow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bari-lynn-red-thin-party-headband-with-bow-13.jpg||-||Bari Lynn Two Tone Berry Flower Clip with Crystals|,|^|A vibrant mix of colors perfect for her summer outfits, this new Bari Lynn flower hair clip is an adorable accessory. The layered flower boasts of its berry pink and red colors, sparkling tulle additions, and cute crystals shimmering. The flower measures roughly 2.5"" across and is set upon a snap clip that slides into her hair easily and offers a great grip. ^||,|$15.00$|,||,|BARI-LYNN-BERRY-TWO-TONE-FLOWER-CLIP|,|$URL$bari-lynn-berry-two-tone-flower-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bari-lynn-two-tone-berry-flower-clip-with-crystals-13.jpg||-||Bari Lynn White Holiday Bow Hair Clip|,|From designer Bari Lynn, this new white satin bow clip is perfect for the upcoming holiday season. The structured bow catches the light beautifully as the center shines with its clear crystals. The pinch clip is easy to open and wrapped with ribbon. |,|$13.00$|,||,|BARI-LYNN-WHITE-HOLIDAY-BOW-HAIR-CLIP|,|$URL$bari-lynn-white-holiday-bow-hair-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bari-lynn-white-holiday-bow-hair-clip-13.jpg||-||Bebemonde Baby Girls White Socks with Ruffle|,|Sweet and adorable, these newborn socks from designer Bebemonde will beautifully adorn her tiny feet. The white cotton knit is classically comfortable while the roll down top of the sock is garnished by a mesh ruffle covered with sheer waves to add texture. Pair with your white newborn gowns for a finished look and added warmth! |,|$12.00$|,||,|BEBEMONDE-BABY-GIRLS-WHITE-SOCKS-RUFFLE|,|$URL$bebemonde-baby-girls-white-socks-ruffle.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bebemonde-baby-girls-white-socks-with-ruffle-3.jpg||-||Bebemonde Girls White Christening Gown and Headband|,|The rosette details will not go unnoticed. A sweet Christening gown for her special day, short puff sleeves with 3 tulle rosettes adorn the bodice. The tulle overlay fabric features tiny rosette detailing. Rear button closure with poly-cotton lining. The matching cotton knit headband is accented with a fabric bow and tulle rosette center. Hand or machine wash cold, line dry. Made in the USA. Please note the tag indicates size 3 Month, but fits like a 0-3 Month. |,|$89.00$|,||,|BEBEMONDE-GIRLS-WHITE-CHRISTENING-GOWN-HEADBAND|,|$URL$bebemonde-girls-white-christening-gown-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bebemonde-girls-white-christening-gown-and-headband-1.jpg||-||Bebemonde Pink Rose Garden Baby Blanket|,|She will look so sweet wrapped in this silky soft blanket from Bebemonde. The soft knit cotton has a pink tulle and rosette edging while the flip side is covered in pink satin. Adorned with a glimmering tulle rosette. 100% cotton. Made to match the Bebemonde Pink Rose Garden Newborn Take Home Gown. Machine washable, lay flat to dry. Made in the USA. |,|$39.00$|,||,|BEBEMONDE-PINK-ROSE-GARDEN-BABY-BLANKET|,|$URL$bebemonde-pink-rose-garden-baby-blanket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bebemonde-pink-rose-garden-baby-blanket-24.jpg||-||Bebemonde Pink Rose Garden Baby Socks|,|These new pink baby socks from Bebemonde are just what she needs to keep her toes warm. Adorned with a tulle and rosette ruffle and glimmering flower. Fits most newborns. These darling socks match the Bebemonde Pink Rose Garden Newborn Take Home Gown. 100% cotton. Machine washable, lay flat to dry. Made in the USA. |,|$12.00$|,||,|BEBEMONDE-PINK-ROSE-GARDEN-BABY-SOCKS|,|$URL$bebemonde-pink-rose-garden-baby-socks.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bebemonde-pink-rose-garden-baby-socks-13.jpg||-||Bebemonde Pink Rose Garden Newborn Take Home Gown|,|^|Accompanied by a darling matching bow headband, this new infant girls take home gown comes from designer Bebemonde. The light pink gown features a wrap neckline on the bodice adorned with a glitter tulle flower while the long sleeves end in a flip paw cuff. The ruffled elastic hem skirt is covered in soft tulle and tiny rosettes. Made with 100% cotton, machine washable. Made in the USA. ONE SIZE FITS MOST NEWBORNS UP TO 12 POUNDS. ^||,|$53.00$|,||,|BEBEMONDE-ROSE-GARDEN-NEWBORN-TAKE-HOME-GOWN|,|$URL$bebemonde-rose-garden-newborn-take-home-gown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bebemonde-pink-rose-garden-newborn-take-home-gown-18.jpg||-||Bebemonde Ribbon Sequins Pink Baby Girls Gown|,|^|An adorable wrapping for your newborn baby girl, this precious pink gown comes from boutique designer, Bebemonde. The wrap bodice is adorned with a satin ribbon and offers her long, flip paw sleeves to protect her from both chilly winds and scratches. The skirt is covered with a tulle overlay dressed in pink satin flowers and a ribbon of sequins twirling around. Finished with a classic elastic ruffle hem to help keep her bundled. Accompanied by a matching headband. Made with 100% cozy cotton and machine washable. One size fits most Newborns through 3 months.  ^||,|$56.00$|,||,|BEBEMONDE-RIBBON-SEQUINS-PINK-BABY-GIRLS-GOWN|,|$URL$bebemonde-ribbon-sequins-pink-baby-girls-gown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bebemonde-ribbon-sequins-pink-baby-girls-gown-12.jpg||-||Bebemonde Satin Pink Rosettes Infant Socks (NEWBORN)|,|^|Sized to fit newborns, these cute pink cotton socks have satiny ruffles with rosettes. By Bebemonde, these match the Bebemonde pink satin gown listed below. Machine wash. ONE NEWBORN ONLY REMAINING.  ^||,|$11.00$|,||,|BEBEMONDE-PINK-SATIN-INFANT-SOCKS|,|$URL$bebemonde-pink-satin-infant-socks.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bebemonde-satin-pink-rosettes-infant-socks-7.jpg||-||Bebemonde Sparkling Cream Newborn Gown for Girls|,|^|A shimmering beauty fit for a new princess, this baby girls infant gown is simply delightful. The wrap style bodice features a soft 100% cotton adorned with a satin bow while the flip paw sleeves protect her from scratching her face. The skirt has an overlay of satin cream flowers and ribbons of sequins that dance around the gown to add a little sparkle while the scalloped hem ends with elastic to keep her bundled up. Comes with a matching knit headband. Machine wash and hang to dry. One size fits most Newborns through 3 months.  ^||,|$56.00$|,||,|BEBEMONDE-CREAM-NEWBORN-GOWN-GIRL|,|$URL$bebemonde-cream-newborn-gown-girl.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bebemonde-sparkling-cream-newborn-gown-for-girls-28.jpg||-||Bebemonde White Baby Girls Gown with Headband|,|This darling white gown comes from designer Bebemonde. The cotton bodice is adorned with a lace and tulle flower that matches the headband bow while the gown is covered in tulle and soft white rosettes. Complete with elastic hemline and cuffed, long sleeves. Made with 100% cotton. Machine washable, hang to dry. Made in the USA. |,|$56.00$|,||,|BEBEMONDE-WHITE-BABY-GOWN|,|$URL$bebemonde-white-baby-gown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bebemonde-white-baby-girls-gown-with-headband-15.jpg||-||Bebemonde White Baby Specialty Blanket|,|^|This beautiful white blanket by Bebemonde makes a perfect gift. Soft terry is surrounded with a wide border of white tulle and rosettes with a single lace and tulle rosette accent in the corner. The reverse side has a satin center lining. 100% cotton. Machine washable, lay flat to dry. Made in the USA. (1) REMAINING.  ^||,|$39.00$|,||,|BEBEMONDE-WHITE-BABY-BLANKET|,|$URL$bebemonde-white-baby-blanket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bebemonde-white-baby-specialty-blanket-10.jpg||-||Bebemonde White Newborn Take Home Gown Pink Flowers|,|^|A darling newborn gown perfect for her ""take me home"" outfit, this new arrival comes from designer Bebemonde. The gown boasts of flip paw sleeves, a pink neckline adorned with a checked bow, and an elastic ruffle hem. The bottom of the skirt is adorned with matching pink flowers. Made with 100% cotton in the US, machine washable. One Size Fits Most Newborns 6-12 lbs. ^||,|$41.00$|,||,|BEBEMONDE-WHITE-NEWBORN-TAKE-HOME-GOWN-PINK-FLOWERS|,|$URL$bebemonde-white-newborn-take-home-gown-pink-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bebemonde-white-newborn-take-home-gown-pink-flowers-14.jpg||-||Bella Reese Fuchsia Braided Halo Headband|,|A bold pop of color to accessorize her hair, this fabulous designer headband comes from Bella Reese. The rich fabric is a fun fuchsia pink textured with its braided wrap and the raw edges. Created to be worn as a halo style, off to one side is a cute touch created with a knot. The back of the headband is a thin elastic band that stretches for a perfect fit. The front of the piece dazzles with its shimmering rhinestone adornment that is placed in a single row. |,|$32.00$|,||,|BELLA-REESE-FUCHSIA-BRAIDED-HALO-HEADBAND|,|$URL$bella-reese-fuchsia-braided-halo-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bella-reese-fuchsia-braided-halo-headband-1.jpg||-||Bella Reese Girls Braided Headband in Pink|,|A beautiful new accessory, this girls hair piece is new from designer Bella Reese. The light mauve pink is an endearing shade which compliments the braided texture. Off to the side is a cute knot with raw edge tails. The front of the braid is dressed with a row of sparkling rhinestone flowers. This halo stretches to fit her head with a thin elastic band that is found at the back. This hair accessory is available in other colors while supplies last, so take a peek at our Hair Bows page! |,|$32.00$|,||,|BELLA-REESE-GIRLS-BRAIDED-HEADBAND-PINK|,|$URL$bella-reese-girls-braided-headband-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bella-reese-girls-braided-headband-in-pink-1.jpg||-||Bella Reese Headband for Girls with Pink Flowers|,|So sweet in style, this new Bella Reese headband is gorgeous accessory for her favorite everyday outfits or flower girl dresses! The light pink ribbon is finished with quaint pom pom accents in the same light pink shade. The headband ties at the back of her head with a custom fit. The two pink flowers sit off to one side of her head and boast of their complimenting shades of pink. The center of both flowers will sparkle as it catches any light. Just beneath the flower we find elegant accents with the pink French netting and the wispy boa feathers. |,|$26.00$|,||,|BELLA-REESE-HEADBAND-GIRLS-PINK-FLOWERS|,|$URL$bella-reese-headband-girls-pink-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bella-reese-headband-for-girls-with-pink-flowers-1.jpg||-||Bella Reese Ivory Rhinestone Girls Headband|,|From Bella Reese, this new girls hair accessory is filled with charming elegance. The ivory fabric is braided and styled with raw edges. The halo headband stretches to fit around her head with the thin elastic band that is found at the back. Off to one side is a knotted accent while the front is dressed with shimmering rhinestones in a floral pattern. This piece is a perfect wedding hair accessory for the flower girl! |,|$32.00$|,||,|BELLA-REESE-IVORY-RHINESTONE-GIRLS-HEADBAND|,|$URL$bella-reese-ivory-rhinestone-girls-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bella-reese-ivory-rhinestone-girls-headband-1.jpg||-||Bella Reese Ivory Wrapped Headband with Blue Flower|,|A sweet accessory from Bella Reese, this piece adds the perfect amount of sugar to any outfit! The hard headband is covered with an ivory ribbon. A large blue tulle flower is layered with lace and boasts of a brilliant ivory satin rose that sits off to one side. A sparkling gem center adds a touch of shimmer to finish off the look. |,|$32.00$|,||,|BELLA-REESE-IVORY-WRAPPED-HEADBAND-BLUE-FLOWER|,|$URL$bella-reese-ivory-wrapped-headband-blue-flower.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bella-reese-ivory-wrapped-headband-with-blue-flower-1.jpg||-||Bella Reese Princess Pink Girls Headpiece|,|^|Bella Reese is now offering this fabulous take on a popular new trend in hair accessories. This halo headpiece boasts of a sparkling jewel front with shimmering pink gems found framed by smaller clear gems. Bright candy pink velvet ribbon coordinates beautifully and ties for a great fit! ONE REMAINING. ^||,|$32.00$|,||,|BELLA-REESE-PRINCESS-PINK-GIRLS-HEADPIECE|,|$URL$bella-reese-princess-pink-girls-headpiece.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bella-reese-princess-pink-girls-headpiece-1.jpg||-||Bella Reese Silver Girls Headband Braided|,|A charming new piece from designer Bella Reese, this halo headband is sure to be loved. The braid is textured with raw edges while colored in a cool silver. Off to one side a knot is finished with tails that boast of their raw edges. A row of pearl and rhinestone flowers add sparkle to the front of the piece. The halo headbands are traditionally styled to be worn on the forehead. This particular style is available in other colors while supplies last, see the Hair Bows page for a full selection! |,|$32.00$|,||,|BELLA-REESE-SILVER-GIRLS-HEADBAND-BRAIDED|,|$URL$bella-reese-silver-girls-headband-braided.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bella-reese-silver-girls-headband-braided-1.jpg||-||Biscotti Back to School Outfit with Flowers|,|^|New from designer Biscotti, this adorable girls outfit is a part of their ""School of Rock"" collection. The dress features an empire bodice in solid black with a row of buttons to run up the back and fasten closed. A color block look is introduced on the skirt as we see white, grey and red. Large flower cut out appliques are found sitting upon the bodice and sleeve. Paired beneath this dress we find a solid black pair of leggings with smaller versions of the flowers gracing both legs. Polyester/Rayon/Spandex Blend. Hand Wash in Cold Water. Hang to Dry. ^||,|$58.50$|,||,|BISCOTTI-BACK-TO-SCHOOL-OUTFIT-FLOWERS|,|$URL$biscotti-back-to-school-outfit-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-back-to-school-outfit-with-flowers-preorder-6.jpg||-||Biscotti Black and Ivory Toddler Dress|,|^|A unique design that she will certainly adore, this fabulous little girls dress comes from the beloved brand, Biscotti. The dress makes full use of the color blocking trend to bring back the mod prints with their alternating shapes. Three circles are found on the front, gradually gaining in size. The long sleeves are opposite colors while a hidden zipper runs up the back. This dress matches perfectly to an older style that is available for her sister while quantities last, ""Biscotti Long Sleeve Black Dress for Girls."" Polyester/Rayon/Spandex Blend. Dry Clean Recommended. ^||,|$49.50$|,||,|BISCOTTI-BLACK-IVORY-TODDLER-DRESS|,|$URL$biscotti-black-ivory-toddler-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-black-and-ivory-toddler-dress-preorder-6.jpg||-||Biscotti Coral Lace Dress for Girls |,|^|A delicate and dainty design, this tween dress is part of Biscotti's ""Meadow Roses"" collection. The strappy dress offers her a hidden zipper in the back and a sleeveless neckline. The dress is covered with layers of sweeping coral lace. The floral pattern is perfect for spring time while the tiers are defined by the scallop hems. This gorgeous lace is completely unique and sure to capture her love instantly! Wear this dress for Easter, birthdays, or almost any special occasion! 100% polyester. Machine wash cold, line dry. ^||,|$59.00$|,||,|BISCOTTI-CORAL-LACE-DRESS-TWEENS|,|$URL$biscotti-coral-lace-dress-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-coral-lace-dress-for-tweens-17.jpg||-||Biscotti Couture Dress for Tweens Silver Flapper|,|Available only in tween sizes, this party dress from Biscotti is sure to be the start of the night. The dress has a shapeless fit, comfortable and relaxed. The straight neckline and straps are framed by silver sequins. The fun skirt is perfect for twirling as ribbons of tulle and sequins fall from neck to hemline. This dress matches several other new arrivals for the season, making it easy to matcher her sister! |,|$73.50$|,||,|BISCOTTI-COUTURE-DRESS-TWEENS-SILVER-FLAPPER|,|$URL$biscotti-couture-dress-tweens-silver-flapper.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-couture-dress-for-tweens-silver-flapper-preorder-27.jpg||-||Biscotti Deck the Halls Girls Dress in Silver|,|^|Part of the festive ""Deck the Halls"" collection in Biscotti's fall and winter line, this new designer girls dress is drop dead gorgeous. Whether she is taking the yearly photos or socializing at parties, this dress will not fail to be the top style of the night. The sleeveless bodice has a fitted cut and a hidden zipper that runs up the back. Silver sequins cover the fabric and are safe guarded by the tulle overlay. The satin waistline is finished by the bow on her back. Layers of petals create the fun, flirty skirt in grey tulle. ^||,|$64.50$|,||,|BISCOTTI-GIRLS-DRESS-SILVER-SNOWFLAKE|,|$URL$biscotti-girls-dress-silver-snowflake.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-deck-the-halls-girls-dress-silver-1.jpg||-||Biscotti Deck the Halls Ivory Dress|,|A glamorous special occasion dress, this Biscotti design looks absolutely beautiful at any event. The drop waist bodice is dressed in shimmering sequins covered by a tulle overlay. The back fastens closed to provide the fitted look the bodice was cut for. The ivory satin waist introduces the petal skirt. Layers of tulle are filled with the snowy, free-spirit of the holiday season while a bow is tied at the back of the waist. |,|$64.50$|,||,|BISCOTTI-HOLIDAY-DRESS-GIRLS-WINTER-WONDERLAND|,|$URL$biscotti-holiday-dress-girls-winter-wonderland.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-deck-the-halls-dress-1.jpg||-||Biscotti Dress Navy and White Long Sleeve|,|With sailor stripes, this new designer little girls dress was created by Biscotti as a part of their spring and summer line. The bodice offers an empire waist and thin navy stripes that run horizontally. The waist is adorned by three quaint bows and a hidden zipper fastens in the back. The skirt opens in fit and boasts of bold stripes to the straight hem. zz08 |,|$49.50$|,||,|BISCOTTI-DRESS-NAVY-WHITE-LONG-SLEEVE|,|$URL$biscotti-dress-navy-white-long-sleeve.html|,|||-||Biscotti Easter Basket Girls Dress - Size 6X|,|^|Matching to a younger version, this girls dress from Biscotti was created for the light new life of spring. The dress features wide shoulder straps and a thin bow that ties on the back. A hidden zipper secures the fit while a garden of tulle rosettes cover the front of the empire waist bodice. The long skirt moves with her every step. This graceful effect is created from the layers of soft, sheer tulle in several different pastel colors. 100% polyester. Delicate hand wash cold, line dry. SIZE 6X REMAINING. ^||,|$59.00$|,||,|BISCOTTI-EASTER-BASKET-GIRLS-TWEEN-DRESS|,|$URL$biscotti-easter-basket-girls-tween-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-easter-basket-girls-dress-1.jpg||-||Biscotti Fan Club Pale Pink Girls Dress - Size 4|,|^|An elegant choice for all of her spring occasions, this pale pink girls dress is from designer Biscotti. The sleeveless neckline is done in the palest pink. A mesh overlay is filled with satin ribbons in pink and white and covers the entire dress. A keyhole opening at the back closes with a single button. The dress is fully lined. Made from 100% polyester. Dry cleaning recommended. SIZE 4 ONLY LEFT. ^||,|$42.33$|,||,|BISCOTTI-FAN-CLUB-PALE-PINK-GIRLS-DRESS|,|$URL$biscotti-fan-club-pale-pink-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-fan-club-pale-pink-girls-dress-16.jpg||-||Biscotti Fancy Girls Dress Holiday Petals|,|Uniquely beautiful, this new designer dress for girls is both lovely and elegant from Biscotti. The bodice is boasts of the traditional satin sheen decorated with sweet sequins. The sleeveless neckline is a wide shape while a zipper closes the back. The fanciful skirt is created with tiers of petal cutouts making full use of the ombre trend as they move from pale at the waist to a rich shade at the hem. 100% Polyester. Hand Wash in Cold Water. Line Dry. |,|$91.50$|,||,|BISCOTTI-FANCY-GIRLS-DRESS-HOLIDAY-PETALS|,|$URL$biscotti-fancy-girls-dress-holiday-petals.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-fancy-girls-dress-holiday-petals-preorder-10.jpg||-||Biscotti Fancy Girls Shrug|,|A sweet ivory that can be paired with several different dresses, this new bolero shrug comes from designer Biscotti. The classic bolero shape is a cropped fit that pairs well with empire waist and straight fit dresses. The long sleeves add warmth while the velvet texture is both soft and fitting for the holiday season. The front is dressed with sparkling sequins. A single button fastens at the center of the neckline. Polyester/Spandex. Hand wash in cold water. Hang to dry. |,|$28.50$|,||,|BISCOTTI-FANCY-GIRLS-SHRUG|,|$URL$biscotti-fancy-girls-shrug.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-fancy-girls-shrug-1.jpg||-||Biscotti Fancy Holiday Dress in Red|,|A Christmas dress that is fitting for the season, this new arrival from Biscotti looks fabulous in photos and will be the envy of all her friends. The long sleeve bodice is made with a comfortable fabric that is the color of the season, red. Two pointsetta inspired flowers sit just beneath the neckline decorated with sparkling accents. The wasitline is a matching satin that ties into a large bow on her back. The skirt falls in layers of dreamy tulle petals. These petals are sure to catch the wind as she moves about, bringing life to the dress. Polyester/Spandex/Rayon. Hand wash in cold water. Hang to dry. |,|$61.50$|,||,|BISCOTTI-FANCY-HOLIDAY-DRESS-RED|,|$URL$biscotti-fancy-holiday-dress-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-fancy-holiday-dress-in-red-1.jpg||-||Biscotti Faux Fur Shrug for Girls in Dusty Rose|,|A delicious new piece that she will want to wear all season long, this new faux fur shrug is part of Biscotti's outerwear essentials collection for fall and winter. The cocoa color easily compliments pinks, browns, and gold. A single fastener is placed on the front just under the collar. A coordinating satin lines the shrug, making it easy to layer with other fabrics. |,|$46.50$|,||,|BISCOTTI-FAUX-FUR-SHRUG-GIRLS-BROWN|,|$URL$biscotti-faux-fur-shrug-girls-brown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-faux-fur-shrug-for-girls-in-brown-preorder-14.jpg||-||Biscotti Flower Girls Dress|,|Ready to take part in the wedding ceremony, this new designer girls dress is from Biscotti. The bodice features a pleated neckline and a hidden zipper. The waist is accented with a wide sash accented with a single flower. The wide skirt falls to a handkerchief hemline. The cotton fabric is light enough to keep her comfortable on a warm day. A few flowers fall on the skirt in light pastel colors. The sash ties in the back to give a great shape. Made with cotton blend. Machine wash cold, tumble dry low. |,|$59.00$|,||,|BISCOTTI-FLOWER-GIRLS-DRESS|,|$URL$biscotti-flower-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-flower-girls-dress-1.jpg||-||Biscotti Girls Black and White Checker Dress (Size 12)|,|^|Pulling from retro inspiration, this new Biscotti dress is available in tween sizes. The straight dress has a subtle shape and is cut for a more fitted look. A hidden zipper closes the back of the dress and the sleeveless neckline has a wide trendy shape. The bottom of the dress is covered in a fun checker pattern. Every so often the checkers introduce a soft pastel color to remind us of the new blooms of springtime. Made with polyester blend. Hand wash cold, line dry. (1) SIZE 12 ONLY REMAINING.  ^||,|$48.33$|,||,|BISCOTTI-GIRLS-BLACK-WHITE-CHECKER-DRESS|,|$URL$biscotti-girls-black-white-checker-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-black-and-white-checker-dress-1.jpg||-||Biscotti Girls Black Dress Falling for Dots - Size 4 & 5|,|^|Created by Biscotti, this new girls holiday gown comes as part of their ""Falling for Dots"" collection designed for winter 2013. The sleeveless bodice is covered with round cutouts, most adorned with a shimmering center. The dots continue down the skirt, becoming fewer near the hemline. The shimmering sheer overlay catches the light as she walks around and a zipper runs up the back for a great fit. 100% polyester. Dry clean for best results. SIZE 4 AND 5 ONLY LEFT.  ^||,|$38.33$|,||,|BISCOTTI-GIRLS-BLACK-DRESS-FALLING-DOTS|,|$URL$biscotti-girls-black-dress-falling-dots.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-black-dress-falling-for-dots-3.jpg||-||Biscotti Girls Chic Holiday Dress|,|Bright as a star, this fabulous new girls dress is from Biscotti for the fall and winter holiday season. The dress is cut for a straight shape that looks fabulous with tights and shrugs. Bold silver stripes made with sequins wrap around the dress. A hidden zipper is found in the back to secure the sleeveless fit. The classic color palette of this dress is easy to match for family or sister photos! Rayon/Polyester/Spandex Blend. Dry Clean Only. |,|$51.00$|,||,|BISCOTTI-GIRLS-CHIC-HOLIDAY-DRESS|,|$URL$biscotti-girls-chic-holiday-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-chic-holiday-dress-preorder-18.jpg||-||Biscotti Girls Dress in White Once Upon A Princess|,|A fun off white dress that is sure to be seen wherever it goes, this new arrival is a creation by the fabulous and loved Biscotti brand. The shapeless dress falls gracefully and has a single button keyhole on the back. The wide boat neck hemline is covered with cute beads and dazzling gems. The off white tulle cascades down to the hemline. Each piece of layered tulle catches the wind and sways with her every step. 100% polyester. Delicate hand wash cold, line dry. |,|$49.00$|,||,|BISCOTTI-GIRLS-DRESS-WHITE-ONCE-UPON-PRINCESS|,|$URL$biscotti-girls-dress-white-once-upon-princess.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-dress-in-white-once-upon-a-princess-1.jpg||-||Biscotti Girls Faux Fur Shrug in Pink|,|A design that adds warmth and style to her outfit, this new Biscotti girls shrug is just what she needs to pair with her new holiday dresses! The cropped cut accents dresses with an empire waistline. The collar and short sleeves complete the style while a single fastener is found, slightly hidden, on the front. The light pink faux fur is soft to the touch and makes this piece true luxury. Acrylic/Polyester Blend. Dry Cleaning Recommended. |,|$46.50$|,||,|BISCOTTI-GIRLS-FAUX-FUR-SHRUG-PINK|,|$URL$biscotti-girls-faux-fur-shrug-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-faux-fur-shrug-in-pink-23.jpg||-||Biscotti Girls Holiday Cape in Navy|,|This new navy blue cape from designer Biscotti, compliments her new special occasion dress for the season. The capelet fastens in the front while a row of gems wrap around the neck. Sweet tulle ruffles are layered in three tiers to complete this piece and add a beautiful texture. 100% Polyester. Hand wash in cold water. Hang to dry. |,|$36.75$|,||,|BISCOTTI-GIRLS-HOLIDAY-CAPE-|,|$URL$biscotti-girls-holiday-cape-.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-holiday-cape-navy-1.jpg||-||Biscotti Girls Holiday Dress Falling Petals|,|^|Part of the ""Good as Gold"" collection, this new special occasion dress is perfect not only for holidays, but also birthdays and weddings! The dress is created with an A-line shape and a wide neckline. The cap sleeves add a cute touch while a zipper runs up the back. The entire dress is covered with matching sequins behind a tulle overlay. This overlay helps protect the sequins from snagging other fabrics. Raining petals fall down the front and wrap around the hemline. ^||,|$69.00$|,||,|BISCOTTI-GIRLS-HOLIDAY-DRESS-FALLING-PETALS|,|$URL$biscotti-girls-holiday-dress-falling-petals.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-holiday-dress-falling-petals-preorder-40.jpg||-||Biscotti Girls Holiday Party Dress in Fuchsia|,|A party dress she will adore, this new arrival was designed by Biscotti. The A line dress has a classic look while offering long sleeves to keep her arms safe from chilly air. The rich fuchsia shade is filled with contagious fun! Matching sequins accent the neckline and create the wide hem. Two front pockets are also trimmed in the shimmer. A hidden zipper runs up the back to fasten the fit. |,|$51.75$|,||,|BISCOTTI-GIRLS-HOLIDAY-PARTY-DRESS-FUCHSIA|,|$URL$biscotti-girls-holiday-party-dress-fuchsia.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-holiday-party-dress-in-fuchsia-preorder-6.jpg||-||Biscotti Girls Holiday Shrug|,|Designed by Biscotti, this new holiday shrug is delightfully fun. The piece offers a classic cropped cut that coordinates well with most any style of dress. The long sleeves add a touch of warmth to her outfit while the solid black fabric is soft to the skin and allows slight stretch. The neckline is wrapped with fun faux fur accented with touches of metallic silver. Acrylic/Nylon Blend. Hand Wash in Cold Water. Lay Flat to Dry. |,|$36.00$|,||,|BISCOTTI-GIRLS-HOLIDAY-SHRUG|,|$URL$biscotti-girls-holiday-shrug.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-holiday-shrug-preorder-6.jpg||-||Biscotti Girls Holiday Shrug Silver Snowflake|,|^|Coordinating perfectly with new arrivals for the holiday season, this Biscotti shrug is a part of the ""Deck the Halls"" collection. The warm velvet fabric is a luxurious look for the season. The long sleeves provide her with some warmth while the cropped cut looks fabulous with her holiday dresses. The front is decorated with sequins and closed by a single button at the neckline. Polyester/Spandex. Hand wash in cold water. Hang to dry. ^||,|$28.50$|,||,|BISCOTTI-GIRLS-HOLIDAY-SHRUG-SILVER-SNOWFLAKE|,|$URL$biscotti-girls-holiday-shrug-silver-snowflake.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-holiday-shrug-silver-snowflake-1.jpg||-||Biscotti Girls Luxurious Dress Tiered Princess|,|From designer Biscotti, this new couture girls dress is a luxurious style that she will love! The bodice features an angled neckline and a hidden zipper in the back. A cute bow is tied at the back of her waist while shimmering sequin accents are found on the front. The unique fabric is teeming with vintage inspiration. The layered skirt boasts of a shimmering iridescent overlay that catches the light perfectly! 100% Polyester. Hand Wash in Cold Water. Line Dry. |,|$81.75$|,||,|BISCOTTI-GIRLS-LUXURIOUS-DRESS-TIERED-PRINCESS|,|$URL$biscotti-girls-luxurious-dress-tiered-princess.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-luxurious-dress-tiered-princess-31.jpg||-||Biscotti Girls Party Dress Navy and White Stripes|,|A sophisticated style, this new Biscotti dress is just in time for spring! The bodice has a hidden zipper in the back. The wide neckline is sleeveless and easy to pair with a short bolero. A large bow has a red center and sits in the center of her waist. The skirt has a volume filled shape that is absolutely adorable and looks great with her fancy shoes. The dress is covered with an infections white and navy stripe. zMade with cotton blend. Machine wash cold, tumble dry low. |,|$49.00$|,||,|BISCOTTI-GIRLS-PARTY-DRESS-NAVY-WHITE-STRIPES|,|$URL$biscotti-girls-party-dress-navy-white-stripes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-party-dress-navy-and-white-stripes-1.jpg||-||Biscotti Girls Red Christmas Party Dress|,|^|Matching several new arrivals from their winter line, this designer girls dress comes from Biscotti's ""Deck the Halls"" collection. The sequin covered bodice boasts of a drop waist, fitted look and a tulle overlay that helps to protect these shimmering accents. The sleeveless neckline if easily paired with jewelery or shrugs. The waistline is defined by red satin that ties into a bow on her back. The full skirt is created with layers of red tulle petals. From family holiday parties to school recitals, this dress is a seasonal must have! It will also look fabulous for Valentine's day a few months later. Polyester/Spandex. Hand wash in cold water. Hang to dry. ^||,|$64.50$|,||,|BISCOTTI-GIRLS-RED-CHRISTMAS-PARTY-DRESS|,|$URL$biscotti-girls-red-christmas-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-red-christmas-party-dress-18.jpg||-||Biscotti Girls Red Sequin Shrug|,|^|Biscotti has created this girls shrug to match the new arrivals in their ""Deck the Halls"" collection. The red shrug is a soft velvet and provides long sleeves. The bolero, cropped cut has a single button that fastens on the front of the neckline. Sequins cover the front of the shrug and catch every ray of light as she moves about the room. Polyester/Spandex. Hand wash in cold water. Hang to dry. ^||,|$28.50$|,||,|BISCOTTI-GIRLS-RED-SEQUIN-SHRUG|,|$URL$biscotti-girls-red-sequin-shrug.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-red-sequin-shrug-1.jpg||-||Biscotti Girls Ruffle Dress Brown Iridescence (Size 5)|,|^|Flirty and fun, this creation from designer Biscotti will put a lasting smile on her face. The sleeveless dress falls down with a classic straight shape offering her a comfortable fit. The gown is covered with waves of iridescent brown ruffles cascading from her neckline down to the hem. Unique from all other dresses, this one is sure to stand out. 100% polyester. Hand wash cold, line dry. (1) SIZE 5 LEFT. ^||,|$66.75$|,||,|BISCOTTI-GIRLS-RUFFLE-DRESS-BROWN-IRIDESCENCE|,|$URL$biscotti-girls-ruffle-dress-brown-iridescence.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-ruffle-dress-brown-iridescence-2.jpg||-||Biscotti Girls Shrug Pink with Beading|,|Pairing with the new Biscotti dresses, this girls shrug is a must have for the season. The light pink shrug offers her long sleeves and a soft cotton fabric. The front is dressed with pearl beads and shimmering sequins. A single button closes the neckline and creates the unique shape. This layering piece can go with many of her spring and summer outfits. Made with polyester blend. Delicate hand wash cold, flat to dry. |,|$28.50$|,||,|BISCOTTI-GIRLS-SHRUG-PINK-BEADING|,|$URL$biscotti-girls-shrug-pink-beading.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-shrug-pink-with-beading-1.jpg||-||Biscotti Girls Special Occasion Dress|,|A sweet new gown, this special occasion dress was created by fabulous designer Biscotti. The long dress features a sleeveless neckline and hidden tucks that shape the top. Matching petal flowers fall down the dress. The shape opens slightly near the end of the skirt as ruffles and a fairy hemline finish this gorgeous piece. The soft colors of the sheer fabric say farewell to the winter snow and welcome in the new life that fills springtime. This dress is perfect for weddings, recitals, or Easter! 100% polyester. Machine wash cold, hang to dry. |,|$66.75$|,||,|BISCOTTI-GIRLS-SPECIAL-OCCASION-DRESS|,|$URL$biscotti-girls-special-occasion-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-special-occasion-dress-1.jpg||-||Biscotti Girls Winter Velvet Coat|,|A sophisticated look for your stylish daughter, this designer dress coat is from Biscotti. A soft light pink velvet, this glamorous fabric catches a slight sheen from the light which is complimented with the shimmering buttons that fasten in the front. The coat has an a-line cut for a comfortable fit. The collar is a ruffled satin with beautiful flower accents in coordinating shades. 100% Cotton. Dry Clean Only. |,|$66.75$|,||,|BISCOTTI-GIRLS-WINTER-VELVET-COAT|,|$URL$biscotti-girls-winter-velvet-coat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-winter-velvet-coat-1.jpg||-||Biscotti Glittering Infant Dress Pretty Princess Pink - 12 Mos|,|^|A shimmering delight from head to hem, this new Biscotti girls holiday dress is gorgeous. The cap sleeve bodice features a silver empire waist adorned with four gems in the front and a satin bow to tie in the back. Small silver sequins cover the entire dress and feature a tulle overlay with a slight gleam. Zipper closes the back. Hand wash garment with care and line dry. (1) 12 MOS ONLY LEFT.  ^||,|$29.00$|,||,|BISCOTTI-GLITTERING-INFANT-DRESS-PRETTY-PRINCESS-PINK|,|$URL$biscotti-glittering-infant-dress-pretty-princess-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-glittering-infant-dress-pretty-princess-pink-14.jpg||-||Biscotti Grey Faux Fur Shrug for Girls|,|Biscotti Dress is now offering this sweet faux fur shrug as a part of their fall and winter line. The grey holds a sweet sheen while it is beyond soft to the touch. The collar hides the single fastener slightly as it closes the front. Silver satin lining makes layering with other pieces a breeze by not catching other fabrics. Acrylic/Polyester Blend. Dry Cleaning Recommended. |,|$46.50$|,||,|BISCOTTI-GREY-FAUX-FUR-SHRUG-GIRLS|,|$URL$biscotti-grey-faux-fur-shrug-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-grey-faux-fur-shrug-for-girls-17.jpg||-||Biscotti Holiday Cape for Tweens in Black|,|Biscotti is now offering this fabulous black cape to pair with their new dresses for the fall and winter seasons. The cape features a neckline wrapped with sparkling gems. Layers of black tulle cover the entire piece and have beautiful movement with her every step. 100% Polyester. Hand wash in cold water. Hang to dry. |,|$40.50$|,||,|BISCOTTI-HOLIDAY-CAPE-TWEENS|,|$URL$biscotti-holiday-cape-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-holiday-cape-for-tweens-in-black-1.jpg||-||Biscotti Holiday Pleather Skirt Set for Girls|,|A dressy look for any occasion this fall and winter, this new girls outfit was designed by Biscotti. The fitted top is made in deep navy, a classic look. Flower and gem accents are attached to the top just below her left shoulder. Her long sleeves are an elegant, sheer fabric that creates the overlay on the entire piece and a sweet row of buttons close the back. The top is paired with a pleather skirt with a full circle shape. The navy pleather is complimented by a tulle ruffle that peaks out of the hemline. Cotton/Polyester/Spandex Blend. Hand Wash in Cold Water. Hang to Dry. |,|$66.75$|,||,|BISCOTTI-HOLIDAY-PLEATHER-SKIRT-SET-GIRLS|,|$URL$biscotti-holiday-pleather-skirt-set-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-holiday-pleather-skirt-set-for-girls-23.jpg||-||Biscotti Infant and Toddler Dress|,|Twin to several new arrivals from designer Biscotti, this little girls dress is available in infant and toddler sizes. The light pink straps are ruffled with elastic for a darling effect. The empire bodice is completely covered with pastel flowers upon the front. The matching skirt falls in layers of light colored tulle that is soft with a graceful movement. She is sure to adore this dress and it will look gorgeous in your family photos! 100% polyester. Delicate hand wash cold, line dry. |,|$55.50$|,||,|BISCOTTI-EASTER-INFANT-TODDLER-DRESS|,|$URL$biscotti-easter-infant-toddler-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-infant-and-toddler-dress-1.jpg||-||Biscotti Little Girls Ballerina Dress in Green|,|A romantic style for the coming holiday season, this new special occasion dress for little girls was designed by Biscotti. The empire bodice features cute cap sleeves and a unique vintage inspired texture to the fabric. A zipper runs up the back while two ties form a bow on the back of her empire waist. The front of the waist is dress in sparkling sequins. The full circle skirt is created with layers of dreamy tulle. 100% Polyester. Hand Wash in Cold Water. Line Dry. |,|$69.00$|,||,|BISCOTTI-LITTLE-GIRLS-BALLERINA-DRESS-GREEN|,|$URL$biscotti-little-girls-ballerina-dress-green.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-little-girls-ballerina-dress-in-green-23.jpg||-||Biscotti Little Girls Ballerina Dress with Flowers|,|From fabulous Biscotti, this new little girls dress is perfect for your upcoming special occasion. The empire bodice is a pale pink velvet, soft to the touch. The wide neckline is framed with puffy cap sleeves inspired by princess gowns. The several layers of tulle on the skirt are cut to a full circle shape, making the skirt full and fun! A row of flowers is found on the waist while a bow ties in the back. Cotton/Polyester. Dry Clean Only. |,|$64.50$|,||,|BISCOTTI-LITTLE-GIRLS-BALLERINA-DRESS-FLOWERS|,|$URL$biscotti-little-girls-ballerina-dress-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-little-girls-ballerina-dress-with-flowers-1.jpg||-||Biscotti Little Girls Dress Silver Snow Princess (12 Mos)|,|^|A darling and unique girls dress, this new creation comes from Biscotti as a piece of their ""Snow Princess"" collection. The empire waist bodice boasts of cute cap sleeves and a zipper running up the back. Beads and gems create a pattern on her waist while bodice is speckled with a subtle and soft snow leopard print. The skirt is draped with layers of a shimmering sheer fabric in light silver. Upper: Made with a polyester blend. Lower: 100% nylon. Hand wash cold, line dry. ONE SIZE 12 MOS ONLY LEFT. ^||,|$34.33$|,||,|BISCOTTI-LITTLE-GIRLS-DRESS-SILVER-SNOW-PRINCESS|,|$URL$biscotti-little-girls-dress-silver-snow-princess.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-little-girls-dress-silver-snow-princess-2.jpg||-||Biscotti Long Sleeve Black Dress for Girls|,|Boasting of their talent with trendy styles, this new designer dress for girls is by Biscotti. The dress is an A-line cut, offering her a classic and timeless fit. The black color block look is disrupted with circles that are filled with the alternate colors. Her long sleeves are a light ivory on the top and jet black on the top, accenting the coloring of the dress. A hidden zipper can be found in the back to fasten the dress. Polyester/Rayon/Spandex Blend. Dry Clean Recommended. |,|$54.00$|,||,|BISCOTTI-LONG-SLEEVE-BLACK-DRESS-GIRLS|,|$URL$biscotti-long-sleeve-black-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-long-sleeve-black-dress-for-girls-preorder-10.jpg||-||Biscotti Mod About You Girls Dress|,|A fun mod style, this new designer girls dress comes from Biscotti. The fun print blends yellow, orange, lime, and light pink. The retro inspiration is evident from first sight while cute colored gems are found on the front. The shapeless cut has a relaxed fit that is darling with leggings or a short bolero. A zipper closes up the back. The sleeveless neckline is wide and elegant in shape. Made with polyester blend. Hand wash cold, line dry. |,|$49.50$|,||,|BISCOTTI-MOD-ABOUT-YOU-GIRLS-DRESS|,|$URL$biscotti-mod-about-you-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-mod-about-you-girls-dress-1.jpg||-||Biscotti Off White Girls Dress Petal Parfait (Size 7 & 8)|,|^|Another stunning girls dress from designer Biscotti. This is the perfect dress for wedding or any elegant occasion. The sleeveless bodice is adorned with sequins, faux pearls and beadwork over a shimmery off white fabric. Just below the bodice, a parfait of off white petals in sheer and satin finish dance around the entire dress to the hemline. The dress is lined and has a full zipper at the back. Made from polyester, dry cleaning recommended. SIZE 7 AND 8 ONLY LEFT.  ^||,|$57.00$|,||,|BISCOTTI-OFF-WHITE-GIRLS-DRESS-PETAL-PARFAIT|,|$URL$biscotti-off-white-girls-dress-petal-parfait.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-off-white-girls-dress-petal-parfait-15.jpg||-||Biscotti Once Upon a Princess Dress with Beading|,|A dress meant for a princess, this new Biscotti dress is perfect for a spring wedding or Easter celebration. The off white dress features a beaded bodice with a hidden zipper in the back. A thin tie makes a bow on her back while the sleeveless neckline is accented with tulle. Layers of dreamy tulle fall from her waist in different angles to create a gorgeous uneven hemline. The dress is fully lined. Made with polyester blend. Delicate hand wash cold, line dry. |,|$89.00$|,||,|BISCOTTI-ONCE-UPON-PRINCESS-DRESS-BEADING|,|$URL$biscotti-once-upon-princess-dress-beading.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-once-upon-a-princess-dress-with-beading-17.jpg||-||Biscotti Orange Polka Dot Dress for Girls|,|Raining polka dots, this new girls dress from Biscotti is a fun new creation just in time for spring! A sleeveless boat neck is positively adorable while the front is accented with large sequins. The sheer white fabric is covered with orange dots. The soft dots become increasingly bold as we reach the hem. The light weight nature of the fabric gives it a waving look as it cascades down the dress and captures every slight breeze or movement she makes. 100% polyester. Machine wash cold, line dry. |,|$58.50$|,||,|BISCOTTI-ORANGE-POLKA-DOT-DRESS-GIRLS|,|$URL$biscotti-orange-polka-dot-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-orange-polka-dot-dress-for-girls-1.jpg||-||Biscotti Patriotic Navy Dress - 12 Mos|,|^|She'll set sail for summer in style in this fabulous girls dress from designer Biscotti. Navy stripes adorn the bodice along with mesh flowers. A bow in navy dot pattern also accents the bodice. Short sleeves and a keyhole opening with one button are other features. The navy skirt is created from a mesh overlay with oversized mesh flowers at the hem. Cotton, spandex and polyester. Machine wash cold, tumble dry low. SIZE 12 MONTH AVAILABLE. ^||,|$29.00$|,||,|BISCOTTI-PATRIOTIC-NAVY-DRESS|,|$URL$biscotti-patriotic-navy-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-patriotic-navy-dress-14.jpg||-||Biscotti Platinum Petals Girls Sleeveless Party Dress (Size 4 & 5)|,|^|Sophistication blended with sass, this new girls party dress comes from designer Biscotti. The empire waist bodice features a shimmering georgette overlay, large silver sequins accenting the waist, and a hidden zipper in the back. The skirt is covered with dancing satin and georgette petals all the way down to the hem. Adding to the textured interest, grey boa feathers adorn the bottom of the skirt. 100% polyester, dry clean recommended. SIZE 4 & 5 LEFT.  ^||,|$39.33$|,||,|BISCOTTI-PLATINUM-PETALS-GIRLS-SLEEVELSS-PARTY-DRESS|,|$URL$biscotti-platinum-petals-girls-sleevelss-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-platinum-petals-girls-sleeveless-party-dress-16.jpg||-||Biscotti Shes Got Stripes Girls Dress|,|^|Biscotti is now offering this adorable girls summer dress as a part of their ""She's Got Stripes"" collection. The long sleeve bodice is fastened closed in the back while a single bow accents the neckline. The thin stripes of navy are closer together on the top and continue down to the drop waist. The same small bow is off centered on her waistline. The skirt has navy and white stripes in a bold, wide style. Made with cotton blend. Machine wash cold, tumble dry low. ^||,|$55.50$|,||,|BISCOTTI-SHES-GOT-STRIPES-GIRLS-DRESS|,|$URL$biscotti-shes-got-stripes-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-shes-got-stripes-girls-dress-1.jpg||-||Biscotti Shrug for Girls in White|,|To go with all of the fabulous new creations from designer Biscotti, this girls shrug will add to her style. The front of the shrug features sprinkles of pearl beads and sequins that catch the light. A button found in the center of the neckline fastens the front closed. The soft cotton fabric is comfortable enough for all day wear and also creates the long sleeves. Made with polyester blend. Delicate hand wash cold, flat to dry. |,|$28.00$|,||,|BISCOTTI-SHRUG-GIRLS-WHITE|,|$URL$biscotti-shrug-girls-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-shrug-for-girls-in-white-1.jpg||-||Biscotti Toddler Holiday Dress Tiered Lace|,|^|Elegant and timeless, this new Biscotti dress is avalable in infant and toddler sizes and is from the ""Good as Gold"" collection. The dress features an empire bodice with a neckline framed by cap sleeves. The champagne color is rich and classic while touches of matching lace bring in a vintage feel. A bow ties at the back of her waist and a hidden zipper fastens in the back. The skirt is made with angled layers of alternating fabrics. The touches of shimmering sheer and lacey fabrics is truly unique to this piece. ^||,|$64.50$|,||,|BISCOTTI-TODDLER-HOLIDAY-DRESS-TIERED-LACE|,|$URL$biscotti-toddler-holiday-dress-tiered-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-toddler-holiday-dress-tiered-lace-preorder-35.jpg||-||Biscotti Trench Coat Polka Dot Navy and White (4 & 6)|,|^|The perfect spring time jacket, this new girls coat comes from Biscotti. The jacket has a traditional length and collar found on a trench coat. The buttons blend in to the navy polka dot fabric. A wide sash ties around her waist to give shape. The hemline is finished with three tiers of ruffles. Whether its from the chilly spring air or the droplets of rain, this cute girls jacket is sure to keep her comfortable. 100% polyester. Machine wash cold, tumble dry low. SIZE 4 AND 6 ONLY LEFT. ^||,|$66.00$|,||,|BISCOTTI-TRENCH-COAT-POLKA-DOT-NAVY-WHITE|,|$URL$biscotti-trench-coat-polka-dot-navy-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-trench-coat-polka-dot-navy-and-white-1.jpg||-||Biscotti Tween Dress in Navy and White Stripe|,|^|From Biscotti's new ""She's Got Stripes"" collection, this fabulous tween dress is perfect for almost any occasion. The wide neckline dresses the sleeveless bodice with an elegant style. A zipper runs up the back. The dress is cut for a fitted look. The skirt continues in the same fun nautical print that will take the summer by storm! This dress is easy to dress up for elegant occasions, but can also be worn to birthdays or recitals! The wide stripes match perfectly several of the new dresses. Made with cotton blend. Machine wash cold, tumble dry low. ^||,|$39.00$|,||,|BISCOTTI-TWEEN-DRESS-NAVY-WHITE-STRIPE|,|$URL$biscotti-tween-dress-navy-white-stripe.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-tween-dress-in-navy-and-white-stripe-1.jpg||-||Biscotti Tween Special Occasion Dress|,|A fabulous design for your tween, this new Biscotti dress is sure to fit almost any special occasion. The empire bodice is covered with flowers on the front while the wide neckline is created by the multiple, thin straps on each shoulder. A zipper closes the fit on her back. Waterfall cascades fall from the center of her waist and wrap around the dress down to the high-low hemline. The soft flower pattern is layered with sheer dotted mesh. This dress is the perfect match to a younger style, also a new arrival from Biscotti for spring and summer! 100% polyester. Machine wash cold, hang to dry. |,|$81.75$|,||,|BISCOTTI-TWEEN-SPECIAL-OCCASION-DRESS|,|$URL$biscotti-tween-special-occasion-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-tween-special-occasion-dress-1.jpg||-||Biscotti Velvet Winter Hat for Infant and Toddlers|,|^|A matching hat for the beautiful new Girls Winter Velvet Coat, this Biscotti accessory is a must have! The pink velvet is not only soft but also boasts of a crisp sheen as it catches the light. A touch of elastic in the brim allows stretch for the perfect fit while the shape of the hat is inspired by the French beret. Off to one side of the front we find a garden of fabric blooms in satin and tulles. 100% Cotton. Dry Clean Only.SIZE 2-4 ONLY LEFT. ^||,|$21.75$|,||,|BISCOTTI-VELVET-WINTER-HAT-TODDLERS|,|$URL$biscotti-velvet-winter-hat-toddlers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-velvet-winter-hat-for-infant-toddlers-1.jpg||-||Blossoms Girls White Baptism Hair Clip|,|Placed upon an alligator clip, this white crinkled satin rosette features a touch of green in the center joining the flower rosette. Perfect to accent her baptism outfit,this new clip comes from designer Blossoms. |,|$8.00$|,||,|BLOSSOMS-GIRLS-WHITE-BAPTISM-HAIR-CLIP|,|$URL$blossoms-girls-white-baptism-hair-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/blossoms-girls-white-baptism-hair-clip-11.jpg||-||Blossoms Grape Flower Hair Clip for Girls|,|A two tone delight, this girls hair clip comes from Blossoms by Kristin Boutin. The crinkled satin is finished with applied heat to the edges while a ribbon flowers sits in the center. Two green leaves stick out the side to finish this circle rosette. Attached to an alligator clip. |,|$8.00$|,||,|BLOSSOMS-GRAPE-FLOWER-HAIR-CLIP-GIRLS|,|$URL$blossoms-grape-flower-hair-clip-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/blossoms-grape-flower-hair-clip-for-girls-11.jpg||-||Bluebelle Little Girls Top and Panty Set Red Heart|,|New from Austrailian designer Bluebelle, this sweet red heart and stripes top and panty set will make the perfect gift! The first pair of panties is red with ivory hearts and is accented with a red stripe pattern on the sides. The second pair has a red stripe pattern on the front and back with the heart print down the sides. Each pair of panties has an ivory ruffle around the waisband and is adorned with a sweet red bow in the center. Includes a gorgeous gift box! Bamboo/Elastane blend. Machine wash. Tumble Dry. |,|$32.00$|,||,|BLUEBELLE-LITTLE-GIRLS-TOP-PANTY-SET-RED-HEART|,|$URL$bluebelle-little-girls-top-panty-set-red-heart.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bluebelle-little-girls-top-and-panty-set-red-heart-25.jpg||-||Bluebelle Panty Set for Girls in Berry Pink|,|This berry pink panty set from Austrailian designer Bluebelle is as sweet as she is! This soft set comes with a pink cami with contrasting pink striped detailing and straps and two pairs of coordinating panties with darling bow and ruffle accents. Comes in a beautiful gift box making it perfect for gift giving! Bamboo/Elastane blend. Machine wash. Tumble Dry. |,|$32.00$|,||,|BLUEBELLE-PANTY-SET-GIRLS-BERRY-PINK|,|$URL$bluebelle-panty-set-girls-berry-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bluebelle-panty-set-for-girls-in-berry-pink-22.jpg||-||Bluebelle Pink Floral Cami Set for Girls|,|New from Austrailian designer Bluebelle, this pink floral gift set is simply darling! This set comes with a matching floral cami and panting as well as a contrasting pink striped panty with matching floral backside. Beautiful gift box included. Bamboo/Elastane blend. Machine wash. Tumble Dry. |,|$32.00$|,||,|BLUEBELLE-PINK-FLORAL-CAMI-SET-GIRLS|,|$URL$bluebelle-pink-floral-cami-set-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bluebelle-pink-floral-cami-set-for-girls-22.jpg||-||Bluebelle Ruffled Pink Heart Cami and Panty Set|,|This darling new set from Austrailian designer Bluebelle is sure to be a new favorite! The soft heart-print cami has a stretchy ivory strap outlining the top and is finished off with a cute pink bow in the center. The ruffled panty alternates layers of heart and stripe ruffles and is finished off with a heart elastic waistband. Gift box included. Bamboo/Elastane blend. Machine wash. Tumble Dry. |,|$32.00$|,||,|BLUEBELLE-RUFFLED-PINK-HEART-CAMI-PANTY-SET|,|$URL$bluebelle-ruffled-pink-heart-cami-panty-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bluebelle-ruffled-pink-heart-cami-and-panty-set-17.jpg||-||Brown Crochet Girls Hat - Jumbo Peony Hat|,|^|Perfect for cooler temperatures, she'll love this sweet brown crochet hat with its flower attachment. Decorated by a large pink jewel in the center, this five and a half inch peony takes the stylish hat to the next level of fashion. Designed by PJ Boutique. INFANT ONLY LEFT.  ^||,|$9.00$|,||,|BROWN-CROCHET-GIRLS-HAT-JUMBO-PEONY-HAT|,|$URL$brown-crochet-girls-hat-jumbo-peony-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/brown-crochet-girls-hat-jumbo-peony-hat-11.jpg||-||Cach Cach Baby Blanket Cotton Candy Rose in Pink|,| |,|$44.25$|,||,|CACH-CACH-BABY-BLANKET-COTTON-CANDY-ROSE-PINK|,|$URL$cach-cach-baby-blanket-cotton-candy-rose-pink.html|,|||-||Cach Cach Baby Blanket with Leopard Trim|,|^|The perfect welcoming gift for the newborn princess in your life, this Cach Cach baby blanket is one mom will always have with her on the go and at home. The pink cotton is a light shade and delicate on her skin. A punch of pattern is added by the leopard print ruffle that races around the edges of this blanket. If you want to give a truly unforgettable gift, match this blanket with any of the outfits from the ""Pleather Dots"" collection along with a hair clip or headband! Measures 28 inches wide and 34 inches long. Cotton/Spandex Blend. Machine Wash in Cold Water. Tumble Dry Low. ^||,|$40.50$|,||,|CACH-CACH-BABY-BLANKET-LEOPARD-TRIM|,|$URL$cach-cach-baby-blanket-leopard-trim.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-baby-blanket-with-leopard-trim-1.jpg||-||Cach Cach Baby Clothes Pink Romper|,|Created by Cach Cach, this infant romper is absolutely adorable! The light pink shade is classic and well loved by all! The empire bodice of the romper features a large flower off centered at the waistline while waves of ribbons texture the dress by falling in lines with small rosettes mixed in. The bottom of the romper is finished with a bubble hemline and classic changing snaps are found on the inseam. Do not miss out on this great summer gem! |,|$39.75$|,||,|CACH-CACH-BABY-CLOTHES-PINK-ROMPER|,|$URL$cach-cach-baby-clothes-pink-romper.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-baby-clothes-pink-romper-1.jpg||-||Cach Cach Baby Coming Home Outfit - Ivory Gown|,|Designed by Cach Cach, this delicate infant gown is sure to look stunning at any occasion. The cotton bodice is soft on her skin and a single button is fastened on her back. The sleeveless shoulders are accented with a waving hemline. The waist is draped with the tails of a large tulle bow. A small ivory flower sits in the center of the bow. The skirt is covered with chiffon flower textures. The hemline is created in the bubble style. |,|$38.25$|,||,|CACH-CACH-BABY-COMING-HOME-OUTFIT-IVORY-GOWN|,|$URL$cach-cach-baby-coming-home-outfit-ivory-gown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-baby-coming-home-outfit-ivory-gown-17.jpg||-||Cach Cach Baby Girls Romper in Pink|,| |,|$36.75$|,||,|CACH-CACH-BABY-GIRLS-ROMPER-PINK|,|$URL$cach-cach-baby-girls-romper-pink.html|,|||-||Cach Cach Baby Gown in Pink|,|A sweet gift for an expecting mother, this fabulous gown comes from designer Cach Cach. The gown matches other items from the designer's fall and winter collection so she can match her older sisters. The bodice has long sleeves for the chilly air. The neckline is fastened in the back with a single button keyhole. The leopard print waistline is accented with a long tail bow and a tulle flower. A light pink tulle overlays the skirt while covered with pink pleather polka dots. The hemline is gathered with elastic to help keep her tiny feet bundled. Cotton/Spandex Blend. Machine Wash in Cold Water. Tumble Dry Low. |,|$36.75$|,||,|CACH-CACH-BABY-GOWN-PINK|,|$URL$cach-cach-baby-gown-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-baby-gown-in-pink-1.jpg||-||Cach Cach Blue Icy Blooms Baby Blanket|,|^|Sure to create a sweet baby show gift, this new infant girls blanket comes from Cach Cach. The soft light blue cotton is delicate on her skin and will help keep her from the chill of the wind. The edge of the entire blanket is decorated with flower cut outs in a matching blue. This blanket is the perfect match of the new arrival ""Cach Cach Newborn Baby Gown in Icy Blue."" Cotton/spandex. Machine wash cold gentle cycle. ^||,|$36.75$|,||,|CACH-CACH-BLUE-ICY-BLOOMS-BABY-BLANKET|,|$URL$cach-cach-blue-icy-blooms-baby-blanket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-blue-icy-blooms-baby-blanket-1.jpg||-||Cach Cach Cotton Candy Rose Baby Romper|,| |,|$42.00$|,||,|CACH-CACH-COTTON-CANDY-ROSE-BABY-ROMPER|,|$URL$cach-cach-cotton-candy-rose-baby-romper.html|,|||-||Cach Cach Cream Pie Capri Set for Girls in Ivory|,|Almost identical to a younger style, this girls top and pant set comes from Cach Cach. The neckline helps to create the graceful feel while the soft cotton has a fitted cut. The long skirt is dressed with a garden of flowers that introduce a brilliant texture. The sheer overlay of the skirt flairs as she twirls. Ivory cotton capris are worn beneath. The elastic waist has an easy fit and a matching ruffle hem finishes the pants. |,|$57.00$|,||,|CACH-CACH-CREAM-PIE-CAPRI-SET-GIRLS-IVORY|,|$URL$cach-cach-cream-pie-capri-set-girls-ivory.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-cream-pie-capri-set-for-girls-in-ivory-1.jpg||-||Cach Cach Cream Pie Ivory Baby Bubble|,|Perfect for a wedding, this new designer baby outfit was designed by CachCach. The sleeveless neckline is the perfect design that looks fabulous on its own and is easy to layer if needed. The ivory petal flower found on the waist is off centered. The bottom of the romper is covered with a sheer overlay that is textured with rosettes. The bubble hem almost disguises the romper shape. Changing snaps are found on the inseam. |,|$39.00$|,||,|CACH-CACH-CREAM-PIE-IVORY-BABY-BUBBLE|,|$URL$cach-cach-cream-pie-ivory-baby-bubble.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-cream-pie-ivory-baby-bubble-1.jpg||-||Cach Cach Cream Pie Ivory Purse for Little Girls|,|A light ivory that has a gorgeous elegance, this Cach Cach purse can hold her treasures or the petals she is to spread down the aisle. The thin shoulder strap is long. The rounded shape of the purse is accented by the slight gather at the mouth. The flower texture on the outside is adorned by a large sheer petal flower with a shimmering center. The inside of the purse is fully lined. |,|$9.00$|,||,|CACH-CACH-CREAM-PIE-IVORY-PURSE-LITTLE-GIRLS|,|$URL$cach-cach-cream-pie-ivory-purse-little-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-cream-pie-ivory-purse-for-little-girls-1.jpg||-||Cach Cach Delicate Daisies Baby Bloomer Set|,| |,|$48.00$|,||,|CACH-CACH-DELICATE-DAISIES-BABY-BLOOMER-SET|,|$URL$cach-cach-delicate-daisies-baby-bloomer-set.html|,|||-||Cach Cach Fancy Dress for Little Girls Sparkle Infusion|,|Looking fabulous on her birthday, this new birthday dress for girls was designed by Cach Cach. The pink bodice boasts of its great texture while small glitter shimmers with the light. The long sleeves help keep her warm in the fall and winter air. A large bow is found near the neckline with a circle clasp at the center, covered in rhinestones. The skirt is in the same warm shade of pink. White sparkling tulle falls over the skirt for a fun tutu look. Polyester/Spandex. Machine wash inside out in cold water. Hang to dry. |,|$46.50$|,||,|CACH-CACH-FANCY-DRESS-LITTLE-GIRLS-SPARKLE-INFUSION|,|$URL$cach-cach-fancy-dress-little-girls-sparkle-infusion.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-fancy-dress-for-little-girls-sparkle-infusion-17.jpg||-||Cach Cach Flower Headband for Baby|,|A cute new accessory from designer Cach Cach, this little girls headband is meant to match with her new pieces from their fall and winter collection. The black headband is lightweight with a great stretch. The comfortable fit is perfect for all day wear. A layered flower is off centered to one side of her head with a rich candy pink beneath the pale whisper pink. A large, single pink gem is placed in the center. |,|$12.00$|,||,|CACH-CACH-FLOWER-HEADBAND-BABY|,|$URL$cach-cach-flower-headband-baby.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-flower-headband-for-baby-1.jpg||-||Cach Cach Garden Party Hairclip for Girls|,| |,|$13.50$|,||,|CACH-CACH-GARDEN-PARTY-HAIRCLIP-GIRLS|,|$URL$cach-cach-garden-party-hairclip-girls.html|,|||-||Cach Cach Garden Party Two-Piece Bloomer Short Set for Baby|,| |,|$46.50$|,||,|CACH-CACH-GARDEN-PARTY-TWO-PIECE-BLOOMER-SHORT-SET-BABY|,|$URL$cach-cach-garden-party-two-piece-bloomer-short-set-baby.html|,|||-||Cach Cach Girls Flowers Girls Dress in Ivory Lace|,| |,|$49.50$|,||,|CACH-CACH-GIRLS-FLOWERS-GIRLS-DRESS-IVORY-LACE|,|$URL$cach-cach-girls-flowers-girls-dress-ivory-lace.html|,|||-||Cach Cach Girls Hair Clip Sugar Frosted Lace|,| |,|$12.00$|,||,|CACH-CACH-GIRLS-HAIR-CLIP-SUGAR-FROSTED-LACE|,|$URL$cach-cach-girls-hair-clip-sugar-frosted-lace.html|,|||-||Cach Cach Girls Party Dress in Blue Icy|,|New from CachCach, this girls party dress matches her younger sisters new outfit in icy blue. The bodice has a sleeveless neckline and a plain cotton fabric that is both soft and allows slight stretch in its pull over fit. The waist is adorned with three flowers placed in a row. The skirt drapes beautifully and the flower cut outs flutter with the wind. The soft light blue is perfect for the new life of spring or the fun of a summer wedding! Cotton/spandex. Machine wash cold gentle cycle. |,|$59.00$|,||,|CACH-CACH-GIRLS-PARTY-DRESS-BLUE|,|$URL$cach-cach-girls-party-dress-blue.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-girls-party-dress-in-blue-1.jpg||-||Cach Cach Girls Pink Flower Headband with Rosette|,|Matching the Baby Girl Gown Ruffled Rosettes from Cach Cach, this new headband finishes her outfit with grace. The light pink band stretches to fit around her head with a lightweight, customer fit. A large pale pink flower features layers of petals and a cute rose center. |,|$10.50$|,||,|CACH-CACH-GIRLS-PINK-FLOWER-HEADBAND-ROSETTE|,|$URL$cach-cach-girls-pink-flower-headband-rosette.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-girls-pink-flower-headband-with-rosette-1.jpg||-||Cach Cach Icy Blooms Headband in Blue|,|A darling hair accessory, this new Cach Cach headband is in a soft, icy blue. The aqua blue headband stretches to fit her head comfortably. The single flower has a tulle bow found underneath and a beaded center! |,|$11.25$|,||,|CACH-CACH-ICY-BLOOMS-HEADBAND-BLUE|,|$URL$cach-cach-icy-blooms-headband-blue.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-icy-blooms-headband-in-blue-1.jpg||-||Cach Cach Infant Girls Dress in Blue - 24 Mos|,|^|Matching several new CachCach arrivals, this icy blue infant dress is adorable! The skirt of the dress is covered with a ribbons of blue flower cut outs falling down from waist to hemline. A large flower sits off centered on her waistline and matches perfectly the one found on her bodice. The top of the dress is made with soft cotton and features a sleeveless neckline. Matching bloomers are worn beneath the dress. If you are looking to pair sisters together, be sure to look at the icy blue capri outfit! Cotton/spandex. Machine wash cold gentle cycle. SIZE 24 MOS ONLY LEFT.  ^||,|$44.33$|,||,|CACH-CACH-INFANT-GIRLS-DRESS-BLUE|,|$URL$cach-cach-infant-girls-dress-blue.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-infant-girls-dress-in-blue-17.jpg||-||Cach Cach Infant Gown Pretty in Pink|,|Dressing her in grace on her way home from the hospital, this newborn gown was created by CachCach. The empire bodice is accented with a cute fabric flower at the center of the waist. A button fastens to create the keyhole on her back. The skirt drapes with a sheer overlay textured with a floral design. Small touches of sequins add a touch of sparkle to the skirt. The elastic hemline keeps her feet bundled while a single ruffle dances beneath. Cotton/Spandex Blend. Machine wash in cold water. Tumble dry on low heat. |,|$36.75$|,||,|CACH-CACH-INFANT-GOWN-PRETTY-PINK|,|$URL$cach-cach-infant-gown-pretty-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-infant-gown-pretty-in-pink-1.jpg||-||Cach Cach Infant Romper in Sugar Frosted Lace|,| |,|$39.75$|,||,|CACH-CACH-INFANT-ROMPER-SUGAR-FROSTED-LACE|,|$URL$cach-cach-infant-romper-sugar-frosted-lace.html|,|||-||Cach Cach Ivory Flower Girl Dress with Bloomer|,|Created as a part of their spring and summer line, this new flower girls dress is sure to look darling as she spreads her petals. The sleeveless bodice has a wide neckline and a cute flower on the empire waist. The skirt has a perfect shape for twirling about. The sheer overlay falls with grace as the flower texture covers it. Matching solid bloomers are placed beneath the dress and have an elastic gathered hemline. |,|$49.00$|,||,|CACH-CACH-IVORY-FLOWER-GIRL-DRESS-BLOOMER|,|$URL$cach-cach-ivory-flower-girl-dress-bloomer.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-ivory-flower-girl-dress-with-bloomer-1.jpg||-||Cach Cach Leopard Print Hair Clip for Girls|,|^|Complimenting her new CachCach outfit, this fabulous hair accessory is a part of their ""Pleather Dots"" collection. This collection is filled with sweet pinks and leopard prints. This hair bow is accented with a tulle flower finished by a shimmering jewel center. Perfect for placing in her hair whether it is down or up! ^||,|$10.50$|,||,|CACH-CACH-LEOPARD-PRINT-HAIR-CLIP-GIRLS|,|$URL$cach-cach-leopard-print-hair-clip-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-leopard-print-hair-clip-for-girls-1.jpg||-||Cach Cach Little Girls Dress with Bloomers in Crochet Blue|,| |,|$36.75$|,||,|CACH-CACH-LITTLE-GIRLS-DRESS-BLOOMERS-CROCHET-BLUE|,|$URL$cach-cach-little-girls-dress-bloomers-crochet-blue.html|,|||-||Cach Cach Little Girls Faux Fur Blanket in White|,|A luxurious new arrival, this baby girls blanket from Cach Cach is a unique baby gift to take to the baby shower or hospital. The blanket is lined in a satin leopard print that also ruffles around the edges. The plush faux fur is perfect against her delicate skin and is sure to keep her warm throughout the fall and winter. Chiffon ribbon creates a flower design that also adds texture. Dimensions: 32 1/2 in X 26 1/2 in. Cotton/Spandex. Machine wash in cold water. Tumble dry on low. |,|$42.00$|,||,|CACH-CACH-LITTLE-GIRLS-FAUX-FUR-BLANKET-WHITE|,|$URL$cach-cach-little-girls-faux-fur-blanket-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-little-girls-faux-fur-blanket-in-white-1.jpg||-||Cach Cach Little Girls White Faux Fur Coat (2T, 3T & 4)|,|A dressy winter coat for your cute little girl, this design from Cach Cach will be loved all season long! The coat boasts of its swing fit: relaxed, comfortable, and stylish. The soft faux fur is covered with floral designs made from chiffon ribbons. The front is lined with sparkling gem buttons. A classic collar runs around the neckline and two pockets are found on the sides. The lining is a satin leopard print. Cotton/Spandex Blend. Machine Wash in Cold Water. Tumble Dry Low. |,|$58.50$|,||,|CACH-CACH-LITTLE-GIRLS-WHITE-FAUX-FUR-COAT|,|$URL$cach-cach-little-girls-white-faux-fur-coat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-little-girls-white-faux-fur-coat-1.jpg||-||Cach Cach Little Mermaid Baby Girls Romper|,| |,|$36.75$|,||,|CACH-CACH-LITTLE-MERMAID-BABY-GIRLS-ROMPER|,|$URL$cach-cach-little-mermaid-baby-girls-romper.html|,|||-||Cach Cach Long Sleeve Tunic and Pant for Little Girls|,|CachCach has newly created this fabulous little girls tunic set and she is sure to love it! The drop waist of the tunic has an A-line fit while finished with a short ruffle skirt. The long sleeves bring warmth from the chilly fall and winter air. A cute flower accent is found near her wide neckline. The petals are created with a light pink georgette fabric upon a bed of glitter tulle. Solid pink leggings are paired beneath to complete the outfit. 100% Polyester. Machine wash in cold water. Tumble dry on low heat. |,|$49.50$|,||,|CACH-CACH-LONG-SLEEVE-TUNIC-PANT-LITTLE-GIRLS|,|$URL$cach-cach-long-sleeve-tunic-pant-little-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-long-sleeve-tunic-and-pant-for-little-girls-1.jpg||-||Cach Cach Malibu Beach Stripes Baby Romper|,| |,|$36.75$|,||,|CACH-CACH-MALIBU-BEACH-STRIPES-BABY-ROMPER|,|$URL$cach-cach-malibu-beach-stripes-baby-romper.html|,|||-||Cach Cach Malibu Beach Stripes Girls Dress in Blue|,| |,|$40.50$|,||,|CACH-CACH-MALIBU-BEACH-STRIPES-GIRLS-DRESS-BLUE|,|$URL$cach-cach-malibu-beach-stripes-girls-dress-blue.html|,|||-||Cach Cach Newborn Baby Gown in Blue|,|An icy sweet new arrival from designer CachCach, this fabulous baby girls gown is sure to be loved this spring and summer. The light blue gown boasts of an empire bodice in a soft, fitted cotton. A large tulle bow drapes down the skirt from the center of her waist, accented with a single matching flower. A button closes the back of the neckline. The long skirt is covered with flower punch outs creating a fun texture that stands out in photos. The hemline is gathered with an elastic band. A matching blue headband is also offered from Cach Cach which completes the look of this gown, don't forget to find it on the Cach Cach page! Cotton/spandex. Machine wash cold gentle cycle. |,|$39.00$|,||,|CACH-CACH-NEWBORN-BABY-GOWN-BLUE|,|$URL$cach-cach-newborn-baby-gown-blue.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-newborn-baby-gown-in-blue-1.jpg||-||Cach Cach Newborn Girls Couture Gown and Hat|,|Designed by Cach Cach, this pink baby girls gown is perfect for her first trip home from the hospital! The gown is wrapped with quaint ruffles of sheer fabric from shoulder to hem. The small cap sleeves almost resemble a sleeveless style while a large pink flower grows on the front. The tiny ruffles are covered with a pink leopard print pattern that is both wild and sweet. The elastic hemline is accented with ruffles of pink mesh. A matching hat comes with the gown as the same large flower sits off to one side! |,|$49.00$|,||,|CACH-CACH-NEWBORN-GIRLS-COUTURE-GOWN-HAT|,|$URL$cach-cach-newborn-girls-couture-gown-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-newborn-girls-couture-gown-and-hat-1.jpg||-||Cach Cach Newborn Take Me Home Oufit for Girls (Size 0-3 Mos)|,|^|A fun spring and summer time arrival, this new designer newborn gown comes from CachCach. The popular pink shade flirts with life as its covered with blooms, leaves, and chipper birdies. The front of this take home gown is striped with diagonal ruffles with a single candy pink tulle flower accent. The center of the flower is decorated with a large faux gem. The hemline stretches with elastic to help keep her feet bundled while a ruffle of pink tulle completes the look. The longer sleeves and light weight of the fabric are perfect for the season! This item comes with a matching hat! This outfit makes a perfect baby shower gift! Made with 100% polyester in the USA. Machine wash on delicate and tumble dry on low. (2) REMAINING.  ^||,|$46.50$|,||,|CACH-CACH-NEWBORN-TAKE-ME-HOME-OUTFIT-GIRLS|,|$URL$cach-cach-newborn-take-me-home-outfit-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-newborn-take-me-home-oufit-for-girls-18.jpg||-||Cach Cach Pink Baby Blanket Tea Rose|,|A sweet new design from CachCach, this cute baby girls blanket will make a splendid baby gift. The pink is always a loved color to welcome in a new princess into the world! The unique accents and trimmings are what set the CachCach blankets apart from others. CachCach makes their designs with quality fabric and care! You will not be disappointed! |,|$36.75$|,||,|CACH-CACH-PINK-BABY-BLANKET-TEA-ROSE|,|$URL$cach-cach-pink-baby-blanket-tea-rose.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-pink-baby-blanket-tea-rose-1.jpg||-||Cach Cach Pink Dress for Girls in Houndstooth|,|Newly arriving from designer CachCach this little girls dress is a unique design that will coordinate perfectly with the sister outfits also found in their fall and winter line. The long sleeve bodice is a warm texture to fit the chilly air that fills the months past August. A shimmering houndstooth pattern covers the bodice. A sheer, full circle overlay creates a graceful skirt complete with a flower design. A single flower adornment is off centered on the waist with a pearl center. 100% Polyester. Machine wash in cold water. Tumble dry on low. |,|$49.50$|,||,|CACH-CACH-PINK-DRESS-GIRLS-HOUNDSTOOTH|,|$URL$cach-cach-pink-dress-girls-houndstooth.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-pink-dress-for-girls-in-houndstooth-1.jpg||-||Cach Cach Pink Infant Take Me Home Outfit|,|A wave of wild style, this new designer baby gown comes from Cach Cach. The sleeveless gown is created with a light pink. Small ruffles wave across the gown. A brown leopard print accents the gown with three ruffles and the trimming on the neckline. Matching flowers are found on the front of the gown. The hemline gathers with elastic creating the perfect shape. A matching hat accompanies the gown and completes the outfit. |,|$49.00$|,||,|CACH-CACH-PINK-INFANT-TAKE-ME-HOME-OUTFIT|,|$URL$cach-cach-pink-infant-take-me-home-outfit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-pink-infant-take-me-home-outfit-1.jpg||-||Cach Cach Pink Leopard Print Baby Gown|,|Cach Cach is now offering this adorable baby girls take home gown as a part of their fall and winter line. The empire bodice has a single button keyhole that fastens at the back of her neckline while the long sleeves keep her safe from chilly air. The long skirt of the sac is covered in the small leopard print. A fabric flower sits on the center of her waistline upon a bow with long tails. The elastic hemline is dressed with a tulle ruffle with large polka dots. Cotton/Spandex Blend. Machine Wash in Cold Water. Tumble Dry Low. |,|$36.00$|,||,|CACH-CACH-PINK-LEOPARD-PRINT-BABY-GOWN|,|$URL$cach-cach-pink-leopard-print-baby-gown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-pink-leopard-print-baby-gown-1.jpg||-||Cach Cach Rainforest Wonders Capri Outfit for Girls|,| |,|$51.75$|,||,|CACH-CACH-RAINFOREST-WONDERS-CAPRI-OUTFIT-GIRLS|,|$URL$cach-cach-rainforest-wonders-capri-outfit-girls.html|,|||-||Cach Cach Rockabye Baby Girls Tutu Dress (Size 3T)|,|^|Created by designer Cach Cach, this new toddler and girls dress comes from the sassy and sweet collection, ""Rockabye Baby."" The bodice boasts of the infectious leopard spots and the long sleeves that promises to help block chilly air. The waist is adorned by two fuchsia bows while the skirt is overlayed with draping folds of ivory tulle. An ivory flower with a shimmering center rests upon a matching bow just beneath the neckline. Made with a cotton blend. Machine wash cold, tumble dry low.SIZE 3T ONLY LEFT. ^||,|$24.33$|,||,|CACH-CACH-ROCKABYE-BABY-GIRLS-TUTU-DRESS|,|$URL$cach-cach-rockabye-baby-girls-tutu-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-rockabye-baby-girls-tutu-dress-3.jpg||-||Cach Cach Sugar Baby Girls Dress|,|^|Almost an exact match to the younger style, this new girls dress was designed by CachCach. The ""Sugar Baby"" collection is personified by a white and pink ombre created from this fabulous, dainty fabric. The scallop tiers are finished with small fringe. The neckline is gathered slightly and framed by fun short sleeves. The duo of flower accents really pulls out the pink that is found closer to the hem of the dress while a shining center is found in the larger one. ^||,|$44.25$|,||,|CACH-CACH-SUGAR-BABY-GIRLS-DRESS|,|$URL$cach-cach-sugar-baby-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-sugar-baby-girls-dress-1.jpg||-||Cach Cach Sugar Baby Gown with Hat in Pink|,|^|About as darling as can be, this new designer baby girls gown is from Cach Cach's ""Sugar Baby"" collection for the spring. The cute gown features vintage inspiration with the scallop tiers in a fun ombre fading from white into pink. Two cute flowers sit in the center of the bodice and quaint cap sleeves frame the neckline. The gathered hem is draped with the same fun sheer fabric. A matching hat comes with the gown and features the same crochet pink flowers sitting just above the edge off to one side. ^||,|$51.75$|,||,|CACH-CACH-SUGAR-BABY-GOWN-HAT-PINK|,|$URL$cach-cach-sugar-baby-gown-hat-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-sugar-baby-gown-with-hat-in-pink-1.jpg||-||Cach Cach Sugar Frosted Lace Baby Gown|,| |,|$42.00$|,||,|CACH-CACH-SUGAR-FROSTED-LACE-BABY-GOWN|,|$URL$cach-cach-sugar-frosted-lace-baby-gown.html|,|||-||Cach Cach Sugar Frosted Lace Blanket|,| |,|$44.25$|,||,|CACH-CACH-SUGAR-FROSTED-LACE-BLANKET|,|$URL$cach-cach-sugar-frosted-lace-blanket.html|,|||-||Cach Cach Sugar Frosted Lace Headband in Ivory|,| |,|$13.50$|,||,|CACH-CACH-SUGAR-FROSTED-LACE-HEADBAND-IVORY|,|$URL$cach-cach-sugar-frosted-lace-headband-ivory.html|,|||-||Cach Cach Sugar Frosted Lace Little Girls Outfit in Ivory|,| |,|$51.00$|,||,|CACH-CACH-SUGAR-FROSTED-LACE-LITTLE-GIRLS-OUTFIT-IVORY|,|$URL$cach-cach-sugar-frosted-lace-little-girls-outfit-ivory.html|,|||-||Cach Cach Summer Capri Outfit - Tropical Punch|,|Matching her younger sister's romper, Cach Cach is now offering this adorable tropical outfit. The sleeveless top has a smocked strap and a sweet bow found beneath the oversized flower. Ruffles run around the piece in the same blue and green storm. The hemline is ruffled with blue polka dot. The solid cotton leggings have an elastic waistline and a straight leg. Both legs are finished with the same sheer ruffle as the top. Polyester. Machine wash cold delicate. |,|$49.00$|,||,|CACH-CACH-SUMMER-CAPRI-OUTFIT-TROPICAL-PUNCH|,|$URL$cach-cach-summer-capri-outfit-tropical-punch.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-summer-capri-outfit-tropical-punch-1.jpg||-||Cach Cach Tropical Punch Baby Girls Romper (0-3 Mos)|,|^|A punch of color, this baby girls romper is a gem from Cach Cach. The shades of greens and blues are blended for a tropical swirl. The smocked straps are wide while a large flower with a gem center hides the neckline. Waving ruffles run around the piece. The inseam has a row of changing snaps. This romper is sure to be unlike anything else you have seen! Polyester. Machine wash cold delicate. SIZE 0-3MOS ONLY LEFT.  ^||,|$29.00$|,||,|CACH-CACH-TROPICAL-PUNCH-BABY-GIRLS-ROMPER|,|$URL$cach-cach-tropical-punch-baby-girls-romper.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-tropical-punch-baby-girls-romper-1.jpg||-||CachCach Baby Girl Gown Ruffled Rosettes|,|A fun new creation, this baby girls take home gown comes from designer Cach Cach. The bodice is a light ivory with a subtle texture and shimmering glitter. Long sleeves and a keyhole back. The skirt is made with a tulle overlay that drapes with rows of rosette accents. The elastic on the hemline gathers the fabric and accents the ruffle beneath. 100% Polyester. Machine Wash in Cold Water. Tumble Dry Low. |,|$36.75$|,||,|CACHCACH-BABY-GIRL-GOWN-RUFFLED-ROSETTES|,|$URL$cachcach-baby-girl-gown-ruffled-rosettes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cachcach-baby-girl-gown-ruffled-rosettes-1.jpg||-||CachCach Designer Infant Romper Girly Dots|,|^|Designer CachCach has created this adorable new baby girls romper as a part of their ""Pleather Dots"" collection for fall and winter. The romper is a perfect match the newborn gown so it makes a wonderful item to pair together in a baby shower gift. The light pink cotton allows slight stretch in its fit while a row of snaps line the inseam of her legs for easy changing. A touch of animal print fabric is found on the waistline along with a ribbon bow and tulle flower. The pleather polka dots dance upon the pink tulle overlay. Cotton/Spandex Blend. Machine Wash in Cold Water. Tumble Dry Low. ^||,|$40.50$|,||,|CACHCACH-DESIGNER-INFANT-ROMPER-GIRLY-DOTS|,|$URL$cachcach-designer-infant-romper-girly-dots.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cachcach-designer-infant-romper-girly-dots-1.jpg||-||CachCach Elegant Dress for Girls Lace Birthday|,|Pretty pink, this Cach Cach dress is available in sizes 2T through 6X. The empire waist bodice has a sleeveless neckline while the fabric allows slight stretch in its pull over fit. The flower accent is off centered on the front of her waist, completed by a pearl center. The sheer skirt falls down to a sharkbite hem, allowing the lining to peak through. An embroidered ribbon design creates a garden of flowers with sequin accents. Cotton/Spandex Blend. Machine Wash in Cold Water. Tumble Dry Low. |,|$48.00$|,||,|CACHCACH-ELEGANT-DRESS-GIRLS-LACE-BIRTHDAY|,|$URL$cachcach-elegant-dress-girls-lace-birthday.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cachcach-elegant-dress-for-girls-lace-birthday-1.jpg||-||CachCach Elegant Little Girls Handbag|,|An accessory made to match her new CachCach faux fur coat. The small purse is the perfect size to hold her treasures as she joins mom around town. The outside of the purse is covered with faux fur that is textured with chiffon ribbon. The thin shoulder strap is a satin leopard print. Cotton/Spandex Blend. Machine Wash in Cold Water. Tumble Dry Low. |,|$14.25$|,||,|CACHCACH-ELEGANT-LITTLE-GIRLS-HANDBAG|,|$URL$cachcach-elegant-little-girls-handbag.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cachcach-elegant-little-girls-handbag-1.jpg||-||CachCach Fancy Girls Top and Pants Outfit|,|From Cach Cach, this designer girls outfit is a sweet creation for the fall and winter season. The long sleeve top boasts of an empire waist dressed by a single fabric flower. This flower is finished with a pearl center and has great texture from the georgette and tulle that make the petals. The skirt has a sheer overlay covered with a ribbon flower design. The matching solid pink pants are worn beneath and finished with single bell hems. Cotton/Spandex Blend. Machine wash in cold water. Tumble dry on low heat. |,|$51.75$|,||,|CACHCACH-FANCY-GIRLS-TOP-PANTS-OUTFIT|,|$URL$cachcach-fancy-girls-top-pants-outfit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cachcach-fancy-girls-top-and-pants-outfit-1.jpg||-||CachCach Flower Headband for Girls with Pearl Center|,|A cute girls accessory, this designer headband from Cach Cach was made to match the fun new outfits arriving for the season. The easy stretch headband fits comfortably around her head. Designed to sit off to one side of her head, we find a darling fabric flower made with pink georgette and glitter tulle. A pearl center finishes the accessory perfectly. |,|$10.50$|,||,|CACHCACH-FLOWER-HEADBAND-GIRLS-PEARL-CENTER|,|$URL$cachcach-flower-headband-girls-pearl-center.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cachcach-flower-headband-for-girls-with-pearl-center-1.jpg||-||CachCach Frilly Girls Top and Pant|,|Created with love by Cach Cach, this new designer outfit for girls is just in time for the back to school season. The tunic has long sleeves and a traditional neckline. The black background is covered with white flower shapes. The skirt of the top is striped in black and white by the quaint ruffles. Two pink layered flowers are placed upon the top. The matching pants boasts of the same patterns as the ruffles define the fun hem. Polyester/Cotton/Spandex. Machine wash in cold water. Tumble dry on low. |,|$51.75$|,||,|CACHCACH-FRILLY-GIRLS-TOP-PANT|,|$URL$cachcach-frilly-girls-top-pant.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cachcach-frilly-girls-top-and-pant-1.jpg||-||CachCach Girls Baby Blanket with Ruffle Trim|,|From designer Cach Cach, this new blanket for baby girls keeps her warm in style. The light rose pink is a shade welcomed by all newborn girls. The fabric is soft on her delicate skin. A sheer, rose textured ruffle wraps around the sides to finishe with a black threaded outline. Dimensions: 27 1/2 X 34 1/2. Cotton/Spandex. Machine wash in cold water. Tumble dry on low. |,|$40.50$|,||,|CACHCACH-GIRLS-BABY-BLANKET-RUFFLE-TRIM|,|$URL$cachcach-girls-baby-blanket-ruffle-trim.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cachcach-girls-baby-blanket-with-ruffle-trim-1.jpg||-||CachCach Girls Houndstooth Coat|,|Sweet and in style, this new little girls jacket is from Cach Cach as a part of their fall and winter line. The jacket is lined in solid pink while the outer fabric is a fun texture. The sparkling houndstooth pattern is also found in several other pieces from Cach Cach. A trio of buttons close the front complete with a ruffle decoration that continues as it runs around the hemline. 100% Polyester. Machine wash in cold water. Tumble dry on low heat. |,|$36.00$|,||,|CACHCACH-GIRLS-HOUNDSTOOTH-COAT|,|$URL$cachcach-girls-houndstooth-coat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cachcach-girls-houndstooth-coat-1.jpg||-||CachCach Girls Pink Leopard Print Headband|,|Designed by Cach Cach this designer girls accessory is the final touch to a darling outfit. The headband has an easy stretch fit that is comfortable for her to wear all day long. Upon the headband we find a sweet pink leopard print bow. A sheer pink tulle flower sits in the center of the bow with a gem accent that catches the light. |,|$10.50$|,||,|CACHCACH-GIRLS-PINK-LEOPARD-PRINT-HEADBAND|,|$URL$cachcach-girls-pink-leopard-print-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cachcach-girls-pink-leopard-print-headband-1.jpg||-||CachCach Icy Blooms Girls Capri Outfit|,|A fun new piece, this infant and toddler girls dress was designed by Cach Cach. The swing top is sleeveless and can be layered easily beneath a light sweater if needed. A flower is found just beneath the neckline to match the one off centered on her waist. The skirt of the top is covered with those gorgeous flower cutouts that are irresistible. Matching cotton pants come with the top and are paired beneath. An elastic waist is a comfortable fit. The bell hem on both legs matches the top perfectly with the same cutouts! Cotton/spandex. Machine wash cold gentle cycle. |,|$59.00$|,||,|CACHCACH-ICY-BLOOMS-GIRLS-CAPRI-OUTFIT|,|$URL$cachcach-icy-blooms-girls-capri-outfit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cachcach-icy-blooms-girls-capri-outfit-1.jpg||-||CachCach Infant Girl Bubble in Pink and White|,|^|From Cach Cach, this new infant bubble dress is certain to gain many compliments and look splendid in photographs. The ombre piece fades from white into pink. Tiers of fabric are ended with a scallop fringe edge. The cute neckline is a ""U"" shape gathered with elastic. The fluttering cap sleeves are made with the same unique fabric. Two pink crochet flowers compliment the light pink found near the hemline. Hidden beneath the skirt are two bubbled legs complete with inseam snaps for changing. ^||,|$42.00$|,||,|CACHCACH-INFANT-GIRL-BUBBLE-PINK-WHITE|,|$URL$cachcach-infant-girl-bubble-pink-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cachcach-infant-girl-bubble-in-pink-and-white-1.jpg||-||CachCach Ivory Flower Girls Dress - Cream Pie|,|A gorgeous new girls dress, this fabulous arrival comes from Cach Cach. The empire bodice is a soft cotton boasting of a wide neckline. A pair of flowers is found just beneath the neck and the sleeveless shoulders are easy to pair with a light sweater. The long skirt is covered with the same sheer overlay seen on so many of the brilliant new pieces. The flower texture is completely unforgettable while a matching ivory lining is found underneath. Machine wash cold gentle cycle. Cotton/spandex. Machine wash cold gentle cycle. |,|$49.00$|,||,|CACHCACH-IVORY-FLOWER-GIRLS-DRESS-CREAM-PIE|,|$URL$cachcach-ivory-flower-girls-dress-cream-pie.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cachcach-ivory-flower-girls-dress-cream-pie-34.jpg||-||CachCach Ivory Hair Bow - Cream Pie|,|A hair accessory to go with her new CachCach dress, this fabulous accessory has undeniable charm. The flower has a trio of gems accenting in the center of the flower. A single tulle bow is found beneath the flower. All of the new ivory spring and summer pieces from designer Cach Cach are a glorious choice for any wedding. |,|$9.50$|,||,|CACHCACH-IVORY-HAIR-BOW-CREAM-PIE|,|$URL$cachcach-ivory-hair-bow-cream-pie.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cachcach-ivory-hair-bow-cream-pie-1.jpg||-||CachCach Ivory Headband - Cream Pie|,|Pairing with several new arrivals from Cach Cach, this little girls headband is elegant and sweet. The stretch headband has a comfortable fit around her head. The large ivory flower is accented with a shining center. A tulle bow creates the bed for the flower, off centered to one side of her head. This headband is made with a neutral color that can match with so many of her dresses and outfits! |,|$12.00$|,||,|CACHCACH-IVORY-HEADBAND-CREAM-PIE|,|$URL$cachcach-ivory-headband-cream-pie.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cachcach-ivory-headband-cream-pie-1.jpg||-||CachCach Little Girls Dress Leopard Dot|,|^|Joining several matching pieces for her younger sister, this new little girls dress from Cach Cach is part of the ""Pleather Dots"" collection. The dress has a relaxed fit that drapes gracefully from her sleeveless boat neckline. A single leopard bow is off centered on the neck and accented with a tulle flower and sparkling center. A small keyhole slit found on the back is closed with a single button. A trendy bubble hem finishes this dress perfectly. The tulle overlay is covered with large polka dots. Cotton/Spandex Blend. Machine Wash in Cold Water. Tumble Dry Low. ^||,|$51.00$|,||,|CACHCACH-LITTLE-GIRLS-DRESS-LEOPARD-DOT|,|$URL$cachcach-little-girls-dress-leopard-dot.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cachcach-little-girls-dress-leopard-dot-17.jpg||-||CachCach Little Girls Top and Pant (18 Mos, 3T)|,|^|A new designer outfit for your little girl, this arrival comes from Cach Cach, a beloved brand. The tunic top has an empire bodice with long sleeves. The waistline is defined in leopard spots while a cute bow and tulle flower sits off to one side with a glittering center. The skirt of the tunic features a sheer overlay that is covered in large polka dot accents. Matching animal print leggings are paired beneath. The cotton fabric allows slight stretch in their fit. Cotton/Spandex Blend. Machine Wash in Cold Water. Tumble Dry Low. SIZE 18 MOS & 3T ONLY LEFT.  ^||,|$51.00$|,||,|CACHCACH-LITTLE-GIRLS-TOP-PANT|,|$URL$cachcach-little-girls-top-pant.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cachcach-little-girls-top-and-pant-1.jpg||-||CachCach Pink Baby Gown with Hat|,|Cach Cach is now offering this pink baby girls gown for the spring season. The light pink gown has a solid cotton fabric bodice that is both delicate on her skin and has a single button keyhole on the back. The sleeveless neckline is accented with a waving trim. The empire waistline has a large rosette placed in the center upon a tulle bow. The long skirt features waves of pink ribbon falling down, speckled with textures of rosettes. The hemline finishes with a cute bubble shape! |,|$48.75$|,||,|CACHCACH-PINK-BABY-GOWN-HAT|,|$URL$cachcach-pink-baby-gown-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cachcach-pink-baby-gown-with-hat-1.jpg||-||CachCach Pink with Leopard Girls Outfit|,|A cute little swing set, this new arrival was designed by Cach Cach. The sleeveless neckline has a pull on fit. A ruffle of waves wrap around the top and the waistline is accented with leopard spots. The skirting of the top matches the top perfectly. A solid pair of cotton pants are worn beneath. The bell hems are dressed with two sweet bows. Polyester. Machine wash cold delicate. |,|$39.00$|,||,|CACHCACH-PINK-LEOPARD-GIRLS-OUTFIT|,|$URL$cachcach-pink-leopard-girls-outfit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cachcach-pink-with-leopard-girls-outfit-1.jpg||-||CachCach White Flower Baby Gown|,|From designer CachCach, this baby girls gown is a welcomed arrival for fall and winter. The solid black gown is covered with fun white flower shapes in different sizes. The wide ruffle hem is gathered slightly by elastic and is draped with layers in white and black. The long sleeves are perfect for the chillier months. A single large pink flower is centered on the gown with a shimmering gem center. Polyester/Cotton/Spandex. Machine wash in cold water. Tumble dry on low. |,|$34.50$|,||,|CACHCACH-WHITE-FLOWER-BABY-GOWN|,|$URL$cachcach-white-flower-baby-gown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cachcach-white-flower-baby-gown-1.jpg||-||Chichanella Bella Beachside Beauty Girls Tankini (3T)|,|^|Your little beauty will adore this two piece swimsuit from Chichanella Bella. She'll be stylin' beachside in this pink and white tankini style suit. The pink top is adorned with ruffled straps that cross over at the back. A ruffled yoke adorns the front. The bottom is beautifully garnished with apron style panels on each side in pink dot with ruffled edges. The pink legs are banded with the same pink dot. An adorable matching bonnet is sold separately. Made in the USA. Made from polyester/spandex. Hand wash cold, hang or lay flat to dry. SIZE 3T ONLY AVAILABLE.  ^||,|$54.00$|,||,|CHICHANELLA-BELLA-BEACHSIDE-BEAUTY-GIRLS-TANKINI|,|$URL$chichanella-bella-beachside-beauty-girls-tankini.html|,|http://ep.yimg.com/ay/yhst-17102259411242/chichanella-bella-beachside-beauty-girls-tankini-16.jpg||-||Chichanella Bella Diving Daisy Two Piece Swimsuit (12 Mos)|,|^|This delightful swimsuit is from designer Chichanella Bella and will make her the star of the beach or pool. The yellow top boasts of its squared neckline, puffy sleeves and large pink patterned rosette in the center. Pink and white gingham ruffles adorn all of the edges. The bottom features decorative panels on the sides with ruffles of pink gingham. The pink gingham is repeated at the waist with a small rosette on each hip. A matching bonnet is sold separately. Made in the USA. Made from polyester/spandex. Hand wash cold, hang or lay flat to dry. ONE 12 MOS ONLY LEFT. ^||,|$54.00$|,||,|CHICHANELLA-BELLA-DIVING-DAISY-TWO-PIECE-SWIMSUIT|,|$URL$chichanella-bella-diving-daisy-two-piece-swimsuit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/chichanella-bella-diving-daisy-two-piece-swimsuit-20.jpg||-||Chichanella Bella Girls Pixy Stix Swimsuit (2T)|,|^|A sweet and sassy vintage look just for her from Chichanella Bella. The ruffled off the shoulder style bodice of this green suit features spaghetti straps and a double ruffle trimmed in deep pink. The leg openings are adorned with ruffles trimmed in deep pink as well. A bonnet made to match is sold as a separate. Made in the USA. SIZE 2T ONLY REMAINING.  ^||,|$51.00$|,||,|CHICHANELLA-BELLA-GIRLS-PIXY-STIX-SWIMSUIT|,|$URL$chichanella-bella-girls-pixy-stix-swimsuit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/chichanella-bella-girls-pixy-stix-swimsuit-15.jpg||-||Classy Baby Amber Infant Flower Headband in White|,|Perfection from Classy Baby, this infant girls headband is pure white and stunning. The nylon stretch headband of white plays host to a white flower. The curling petals are accented with shimmery tulle petals. A circle of jewel accents shine from the center of the flower. ALL SOLD OUT 6/14/13.  |,|$17.00$|,||,|CLASSY-BABY-AMBER-INFANT-FLOWER-HEADBAND-WHITE|,|$URL$classy-baby-amber-infant-flower-headband-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-amber-infant-flower-headband-in-white-11.jpg||-||Classy Baby Angelica Aqua Flower Clip|,|From Classy Baby, this girls hair clip is just the right touch for her spring outfits. The blue petals get smaller towards the center. Wispy petals of aqua tulle are tucked between the satin petals. Faux pearl beads are nestled between the smaller petals at the center. Attaches to her hair with an alligator style clip. |,|$16.00$|,||,|CLASSY-BABY-ANGELICA-AQUA-FLOWER-CLIP|,|$URL$classy-baby-angelica-aqua-flower-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-angelica-aqua-flower-clip-13.jpg||-||Classy Baby Angelica Bubblegum Pink Flower Clip|,|^|With its fun color this new girls hair clip was designed by Classy Baby. The satin petals curl from the edges while the beaded center compliments the bubblegum pink. Measures 3"" and placed upon a pinch clip. ^||,|$16.00$|,||,|CLASSY-BABY-ANGELICA-BUBBLEGUM-PINK-FLOWER-CLIP|,|$URL$classy-baby-angelica-bubblegum-pink-flower-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-angelica-bubblegum-pink-flower-clip-12.jpg||-||Classy Baby Angelica Coral Flower Hair Clip|,|Beautiful with any kind of outfit, this girls flower clip comes from Classy Baby. The deep coral satin sheen and is complimented by the pearl center. Each petal curls at the edge from the heat seal while a bit of tulle hides between layers. The pinch alligator clip is easy to use. |,|$16.00$|,||,|CLASSY-BABY-ANGELICA-CORAL-FLOWER-HAIR-CLIP|,|$URL$classy-baby-angelica-coral-flower-hair-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-angelica-coral-flower-hair-clip-12.jpg||-||Classy Baby Angelica Flower Clip Light Yellow|,|A sunny selection, this girls hair clip is fresh for the season from Classy Baby. Sunny light yellow petals with curling edges surround a pearl like center for a stunning look. Wispy petals of tulle are tucked in amongst the satin petals. The flower is attached to an alligator style clip. |,|$16.00$|,||,|CLASSY-BABY-ANGELICA-FLOWER-CLIP-LIGHT-YELLOW|,|$URL$classy-baby-angelica-flower-clip-light-yellow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-angelica-flower-clip-light-yellow-10.jpg||-||Classy Baby Angelica Flower Hair Clip Champagne|,|^|Just in time for the holiday photos, this new girls hair clip comes from Classy Baby. The satin champagne flower features curling petals, a touch of tulle and a beaded center. The flower is placed upon a pinch alligator clip and measures roughly 3"". ^||,|$16.00$|,||,|CLASSY-BABY-ANGELICA-FLOWER-HAIR-CLIP-CHAMPAGNE|,|$URL$classy-baby-angelica-flower-hair-clip-champagne.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-angelica-flower-hair-clip-champagne-11.jpg||-||Classy Baby Angelica Flower Hair Clip Light Pink|,|In a sweet, classic shade of pink, this girls flower hair clip comes from Classy Baby. The pearl bead center compliments the soft pink satin petals. Slight curling from the edges and a touch of tulle add a few detailed touches. On a pinch alligator hair clip. |,|$16.00$|,||,|CLASSY-BABY-ANGELICA-FLOWER-HAIR-CLIP-LIGHT-PINK|,|$URL$classy-baby-angelica-flower-hair-clip-light-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-angelica-flower-hair-clip-light-pink-12.jpg||-||Classy Baby Angelica Flower Headband Bubblegum Pink|,|In an infectious shade of pink, this new baby girls headband is perfect all year round. The satin flower boasts of each curled petal having heat sealed edges while a small bit of tulle helps to accented the layered look. Gleaming pearl beads adorn the center and the soft stretch headband won't dig into her head. |,|$18.00$|,||,|CLASSY-BABY-ANGELICA-FLOWER-HEADBAND-BUBBLEGUM-PINK|,|$URL$classy-baby-angelica-flower-headband-bubblegum-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-angelica-flower-headband-bubblegum-pink-13.jpg||-||Classy Baby Angelica Flower Headband for Infants in Silver|,|Placed upon a soft headband, this new accessory for little girls comes from designer Classy Baby. The silver flower features curled petals and matching tulle dividing the top and bottom layers. A finishing touch is found with the pearl center. Pair with casual or dressy outfits! |,|$18.00$|,||,|CLASSY-BABY-ANGELICA-FLOWER-HEADBAND-FOR-INFANTS-SILVER|,|$URL$classy-baby-angelica-flower-headband-for-infants-silver.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-angelica-flower-headband-for-infants-in-silver-13.jpg||-||Classy Baby Angelica Flower Headband in Red|,|An adorable new arrival from designer Classy Baby, this little girls headband is truly a delight! The stretchy headband is soft on her head and boasts of its rich red shade. The satin flower is made with petals that whisically twist from their heat-applied edges. The center is adorned with a garden of pearl beads. |,|$18.00$|,||,|CLASSY-BABY-ANGELICA-FLOWER-HEADBAND-RED|,|$URL$classy-baby-angelica-flower-headband-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-angelica-flower-headband-in-red-12.jpg||-||Classy Baby Angelica Flower Little Girls Headband in Leopard|,|^|Fitting a wide range of ages, this new arrival in our accessory department comes from the loved Classy Baby. The single flower is one of their most popular styles named ""Angelica."" This design boasts of curled satin petals with heat treated edges and a small touch of matching tulle. At the center we find pearl pollen to really set it apart. The elastic band is decorated by a sheer leopard print ribbon that ruffles slightly. Sure to look great with any of your new fall outfits! ^||,|$18.00$|,||,|CLASSY-BABY-FLOWER-LITTLE-GIRLS-HEADBAND-LEOPARD|,|$URL$classy-baby-flower-little-girls-headband-leopard.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-angelica-flower-little-girls-headband-in-leopard-2.jpg||-||Classy Baby Black Satin Angelica Flower Clip|,|^|Elegant at night and playful during the day, this new Classy Baby flower clip is also available in many fun colors. The flower boasts of its curled satin petals and a pearl beaded center.. On a pinch alligator clip, 3"" in diameter. ^||,|$16.00$|,||,|CLASSY-BABY-BLACK-SATIN-ANGELICA-FLOWER-CLIP|,|$URL$classy-baby-black-satin-angelica-flower-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-black-satin-angelica-flower-clip-11.jpg||-||Classy Baby Bubblegum Pink Infant Headband|,|For your new baby girl, this adorable hair band was designed by Classy Baby. The light pink satin shines in the light while folded layers create a fabulous texture for each petal. The edges are heat treated for a lasting effect. The thin band stretches around her head to take its place as a crown upon her head. A group of ivory beads is found at the center of the flower. |,|$12.00$|,||,|CLASSY-BABY-BUBBLEGUM-PINK-INFANT-HEADBAND|,|$URL$classy-baby-bubblegum-pink-infant-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-bubblegum-pink-infant-headband-1.jpg||-||Classy Baby Champagne Girls Handmade Headband|,|Filled with love by Classy Baby, this design is a rich example of an accessory that is filled with elegance. Satin petals are in a gorgeous champagne shade. The center is completed with a sparkling gem and pearl bead design. The large flower sits off to one side of her head upon the headband with a great elastic stretch. This piece will look beautiful with her new outfits! |,|$19.00$|,||,|CLASSY-BABY-CHAMPAGNE-GIRLS-HANDMADE-HEADBAND|,|$URL$classy-baby-champagne-girls-handmade-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-champagne-girls-handmade-headband-1.jpg||-||Classy Baby Dusty Rose Handmade Hairbow|,|A unique hair accessory unlike the rest, this new piece was designed by Classy Baby. The handmade hair bow features fun petals that are layered with matching sheer fabric. The center of the flower is decorated with a few pearlized beads. The bloom is placed upon the thin band that stretches for an easy fit. This flower hair band is sure to complete the style of her look! |,|$16.00$|,||,|CLASSY-BABY-DUSTY-ROSE-HANDMADE-HAIRBOW|,|$URL$classy-baby-dusty-rose-handmade-hairbow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-dusty-rose-handmade-hairbow-1.jpg||-||Classy Baby Fuchsia Angelica Headband|,|^|An adorable hair accessory available in multiple colors, this new baby girls accessory comes from Classy Baby. The soft, stretch headband is adorned with a satin flower boasting of a pearl center. The individual petals features applied heat-sealed edges producing a slight curl and a small touch of tulle. The flower measures roughly 3"". ^||,|$18.00$|,||,|CLASSY-BABY-FUCHSIA-ANGELICA-FLOWER-HEADBAND|,|$URL$classy-baby-fuchsia-angelica-flower-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-fuchsia-angelica-headband-12.jpg||-||Classy Baby Fuchsia Satin Angelica Flower Clip|,|From designer Classy Baby, this girls flower hair clip is rich and color and sure to gain compliments. The deep fuchsia flower boasts of curling petals and that satin shine. The bead center features a pearl look, placed upon an alligator clip. |,|$16.00$|,||,|CLASSY-BABY-FUCHSIA-SATIN-ANGELICA-FLOWER-CLIP|,|$URL$classy-baby-fuchsia-satin-angelica-flower-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-fuchsia-satin-angelica-flower-clip-12.jpg||-||Classy Baby Girls Double Bow Headband in Black|,|^|Adorned with a large double bow, this new little girls headband from Classy Baby is a cozy fit. The soft band stretches to fit around her head. The bow measures roughly 3"" across. Fits most infants and toddlers. ^||,|$13.00$|,||,|CLASSY-BABY-GIRLS-BOW-HEADBAND-BLACK|,|$URL$classy-baby-girls-bow-headband-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-girls-double-bow-headband-in-black-10.jpg||-||Classy Baby Girls Double Bow Headband in Fuchsia|,|^|Like a bow wrapping up a very precious gift, this new little girls headband stretches to wrap around her head. The soft band is adorned by a large fuchsia ribbon bow measuring roughly 3"" in length. Fits most infants and toddlers. ^||,|$13.00$|,||,|CLASSY-BABY-GIRLS-BOW-HEADBAND-FUCHSIA|,|$URL$classy-baby-girls-bow-headband-fuchsia.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-girls-double-bow-headband-in-fuchsia-11.jpg||-||Classy Baby Girls Hairbow in Lilac|,|Classy Baby has created this gorgeous new girls hair bow. The thin headband is an easy stretch fit. The lilac satin petals have a cute curl given by their heat sealed edges. A touch of sheer fabric is layered into the piece, adding texture. The flower is placed upon the thin band and is meant to be worn off to one side. |,|$16.00$|,||,|CLASSY-BABY-GIRLS-HAIRBOW-LILAC|,|$URL$classy-baby-girls-hairbow-lilac.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-girls-hairbow-in-lilac-1.jpg||-||Classy Baby Girls Headband in Bubblegum Pink|,|A gorgeous new accessory, this flower headband comes from Classy Baby. The flower is a whimsical design with bubblegum pink satin petals and edges sealed with heat. The flower is sure to look fabulous with her favorite outfits this season! The bloom is placed upon a headband that stretches for a great fit. |,|$19.00$|,||,|CLASSY-BABY-GIRLS-HEADBAND-BUBBLEGUM-PINK|,|$URL$classy-baby-girls-headband-bubblegum-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-girls-headband-in-bubblegum-pink-1.jpg||-||Classy Baby Girls Peach Hair Clip Angelica Flower|,|A beautiful, delicate finish that is sure to look darling amongst her locks, this new hair clip comes from Classy Baby. The soft peach tone compliments the popular colors for this fall while a bit of tulle texture is found inbetween petals. The curl of the petals is a natural result of the heat trimmed edges. Attached to an alligator clip and finished with a cute pearl center, this flower really is a gem. |,|$15.00$|,||,|CLASSY-BABY-GIRLS-PEACH-HAIR-CLIP-ANGELICA-FLOWER|,|$URL$classy-baby-girls-peach-hair-clip-angelica-flower.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-girls-peach-hair-clip-angelica-flower-10.jpg||-||Classy Baby Girls Satin Bow Headband in Fuchsia|,|^|Princess pink, this new little girls headband is the perfect accessory to add color to any outfit. The sheer ruffled band stretches around her head and boasts of its candy pink satin bow sitting on top measuring roughly 2.5"" Fits most infants and toddlers. ^||,|$9.00$|,||,|CLASSY-BABY-GIRLS-SATIN-BOW-HEADBAND-FUCHSIA|,|$URL$classy-baby-girls-satin-bow-headband-fuchsia.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-girls-satin-bow-headband-in-fuchsia-13.jpg||-||Classy Baby Girls Satin Bow Headband in White|,|^|Classy Baby is now offering this white satin girls headband. Sitting atop an elastic band accented with sheer white ribbon ruffle is a shiny sating bow measuring roughly over 2"" long. Fits most infants and toddlers. ^||,|$9.00$|,||,|CLASSY-BABY-GIRLS-SATIN-BOW-HEADBAND-WHITE|,|$URL$classy-baby-girls-satin-bow-headband-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-girls-satin-bow-headband-in-white-10.jpg||-||Classy Baby Gray Rosette Headband|,|Designed with love by Classy Baby, this new designer girls headband is a wonderful addition to her outfit. The fabulous petals on this bloom is created with silver satin completed with heat finished edges. A group of pearl beads is placed in the center of the flower to finish the look beautifully. This adorable design is placed upon a headband that stretches for custom fit. |,|$19.00$|,||,|CLASSY-BABY-GRAY-ROSETTE-HEADBAND|,|$URL$classy-baby-gray-rosette-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-gray-rosette-headband-1.jpg||-||Classy Baby Handmade White Headband|,|An oversized beauty, this new designer hair accessory comes from Classy Baby. The flower is created with white satin petals finished with a heat sealed edges. The stretch headband is a comfortable fit. To finish off this look with their classic signature, a group of pearl beads are found in the center. |,|$19.00$|,||,|CLASSY-BABY-HANDMADE-WHITE-HEADBAND|,|$URL$classy-baby-handmade-white-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-handmade-white-headband-1.jpg||-||Classy Baby Hot Pink Angelica Flower Clip|,|She'll be precious in this hot pink girls hair clip from Classy Baby. Pink petals curl at the edges and reduce in size towards the center. A large pearl like bead is surrounded by smaller beads to create a beautiful center. Tulle petals are tucked in for added effect. The flower is placed on an alligator style clip. |,|$16.00$|,||,|CLASSY-BABY-HOT-PINK-ANGELICA-FLOWER-CLIP|,|$URL$classy-baby-hot-pink-angelica-flower-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-hot-pink-angelica-flower-clip-10.jpg||-||Classy Baby Hot Pink Rosette Headband|,|The large flower is a bright hot pink for this fabulous new accessory from Classy Baby. Also available in other colors, this designer accessory sets off to one side and had a truly glamorous look. The center is accented with a group of beading. The comfortable headband stretches for fit while it is in a coordinating shade of pink. |,|$19.00$|,||,|CLASSY-BABY-HOT-PINK-ROSETTE-HEADBAND|,|$URL$classy-baby-hot-pink-rosette-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-hot-pink-rosette-headband-1.jpg||-||Classy Baby Ivory Angelica Flower Infant Headband|,|Elegant in ivory, this infant girls headband is from designer Classy Baby. The stretchy nylon headband is garnished with an ivory flower. Satiny ivory petals have curled edges and tulle accents. The small petals in the center nestle faux pearl beads for a stunning look. |,|$18.00$|,||,|CLASSY-BABY-IVORY-ANGELICA-FLOWER-INFANT-HEADBAND|,|$URL$classy-baby-ivory-angelica-flower-infant-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-ivory-angelica-flower-infant-headband-11.jpg||-||Classy Baby Ivory Angelica Satin Flower Clip|,|Placed upon a pinch alligator clips, this new hair accessory comes from Classy Baby. The ivory satin petals have a characteristically rich curl and bring attention to the pearl bead center. Whether she is dressing up for the coming holidays or complimenting a cute, casual outfit, this flower hair clip will do the trick! |,|$16.00$|,||,|CLASSY-BABY-IVORY-ANGELICA-SATIN-FLOWER-CLIP|,|$URL$classy-baby-ivory-angelica-satin-flower-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-ivory-angelica-satin-flower-clip-13.jpg||-||Classy Baby Ivory Newborn Headband|,|Sure to be the crown of her fabulous outfits, this infant headband comes from Classy Baby. The smooth ivory petals are created by folds while the flower is attached to the thin, stretch band. The raw edges are sealed with heat giving a playful waves. Check out all of the other fabulous Classy Baby headbands to have an accessory for every outfit! |,|$12.00$|,||,|CLASSY-BABY-IVORY-NEWBORN-HEADBAND|,|$URL$classy-baby-ivory-newborn-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-ivory-newborn-headband-1.jpg||-||Classy Baby Light Pink Infant Girls Headband|,|Created by Classy Baby, this new infant headband is certainly darling. The stretch band is thin and dainty creating a feminine quality. The flower is designed through layers of classic fabric. The pearl, ivory beads that decorate the center are the perfect finish to this design. The light shade of pink is sure to look great with many of her new outfits! The headband is available in other colors as well! |,|$12.00$|,||,|CLASSY-BABY-LIGHT-PINK-INFANT-GIRLS-HEADBAND|,|$URL$classy-baby-light-pink-infant-girls-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-light-pink-infant-girls-headband-1.jpg||-||Classy Baby Lime Angelica Satin Flower Clip|,|A unique new hair accessory, this girls flower clip comes from designer Classy Baby. The lime satin petals shorten towards the center and curl at their edges. Detailed touches like a bit of tulle and a pearl bead center are what make this piece so great. Attached to a pinch clip. |,|$16.00$|,||,|CLASSY-BABY-LIME-ANGELICA-SATIN-FLOWER-CLIP|,|$URL$classy-baby-lime-angelica-satin-flower-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-lime-angelica-satin-flower-clip-12.jpg||-||Classy Baby Lime Green Angelica Flower Infant Headband|,|This beautiful creation in lime is from Classy Baby. The infant girls headband is done in trendy lime green nylon. The attached flower is of a lighter shade of green. Satiny petals curl at the edges and are smaller towards the center. Faux pearl beads are used to create a circular center. Tulle petals are tucked amongst the petals. |,|$18.00$|,||,|CLASSY-BABY-LIME-GREEN-ANGELICA-FLOWER-INFANT-HEADBAND|,|$URL$classy-baby-lime-green-angelica-flower-infant-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-lime-green-angelica-flower-infant-headband-13.jpg||-||Classy Baby Mint Handmade Headband|,|A cool mint green, Classy Baby is now offering this wonderful flower headband. The gorgeous flower is layered with curled petals finished with a heat seal. The center is adorned with gems and pearl beads. The bloom is placed upon a great band with an elastic stretch.. This color is hot for the season. |,|$19.00$|,||,|CLASSY-BABY-MINT-HANDMADE-HEADBAND|,|$URL$classy-baby-mint-handmade-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-mint-handmade-headband-1.jpg||-||Classy Baby Navy Angelica Flower Clip|,|^|In a deep navy blue, this new girls flower clip comes from Classy Baby. The satin petals curl at the edge and sheen in the light. A grouping of pearl beads adorn the center. The flower measures about 3"" and is on a pinch hair clip. ^||,|$16.00$|,||,|CLASSY-BABY-NAVY-ANGELICA-FLOWER-CLIP|,|$URL$classy-baby-navy-angelica-flower-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-navy-angelica-flower-clip-13.jpg||-||Classy Baby Navy Angelica Flower Headband|,|^|Welcoming fall with cute accessories, this new Classy Baby headband is also available as a clip or in other colors. The soft stretch headband is designed to comfortably fit her head while the satin flower is the real star of the show. The curled satin petals and layer of tulle are complimented with an ivory pearl center. (1) ONLY LEFT.  ^||,|$18.00$|,||,|CLASSY-BABY-NAVY-ANGELICA-FLOWER-HEADBAND|,|$URL$classy-baby-navy-angelica-flower-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-navy-angelica-flower-headband-13.jpg||-||Classy Baby Newborn Headband in Gray|,|In charcoal, this new girls accessory is a real gem from Classy Baby. The headband is a comfortable stretch fit with its thin band. The gray flower is layered with the same shade all the way through while the edges are finished with a touch of heat. The center is a gorgeous cap to the piece with its cluster of pearl beads. Pair this peace with almost any outfit in her wardrobe! |,|$12.00$|,||,|CLASSY-BABY-NEWBORN-HEADBAND-GRAY|,|$URL$classy-baby-newborn-headband-gray.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-newborn-headband-in-gray-1.jpg||-||Classy Baby Newborn Headband in Mint|,|A hot color for the season, this fabulous mint headband is a highlight of the new arrivals from Classy Baby. The dainty, thin stretch band has a comfortable fit on her head. Attached to this band is a lovely and beautiful flower. The crisp color is cool as can bee while the petals are created in layers completed by the heat treated edges. The center of the flower is graced with small, pearlized beads that are grouped together carefully. Everyone is sure to fall in love with this accessory. |,|$12.00$|,||,|CLASSY-BABY-NEWBORN-HEADBAND-MINT|,|$URL$classy-baby-newborn-headband-mint.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-newborn-headband-in-mint-1.jpg||-||Classy Baby Pink Tones Girls Headband|,|In fabulous, pretty pink, this new designer hair accessory comes from Classy Baby. This flower is constructed with multiple layers which alternate between the rich fuchsia and the soft, light pink. The flower is created to sit off centered to one side while the fit is assisted with a stretch band. Pearl beads are accenting the center of the flower. |,|$19.00$|,||,|CLASSY-BABY-PINK-TONES-GIRLS-HEADBAND|,|$URL$classy-baby-pink-tones-girls-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-pink-tones-girls-headband-1.jpg||-||Classy Baby Purple Girls Hairbow with Pearl Accents|,|The color of royalty, this girls headband from Classy Baby is one she can wear again and again! The rich purple satin creates the whimsical flower petals while completed with heat treated edges. The decorated center is filled with pearl beads. Whether she is an every day glamorous or dressing to the nines, this fabulous hair accessory will suit her well! |,|$16.00$|,||,|CLASSY-BABY-PURPLE-GIRLS-HAIRBOW-PEARL-ACCENTS|,|$URL$classy-baby-purple-girls-hairbow-pearl-accents.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-purple-girls-hairbow-with-pearl-accents-1.jpg||-||Classy Baby Red Infant Headband|,|Accessorizing her fabulous new wardrobe, this designer infant headband comes from Classy Baby. The thin headband stretches to fit comfortably in a neutral white. The flower is designed with layers of folded red satin to create the petals. The edges are heat treated for a finished look while small pearl beads are gathered at the center to complete the look. |,|$12.00$|,||,|CLASSY-BABY-RED-INFANT-HEADBAND|,|$URL$classy-baby-red-infant-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-red-infant-headband-1.jpg||-||Classy Baby Shades of Pink Infant Headband|,|Hitting upon the ombre trend, this new infant headband comes from Classy Baby. The flower is created with layers of shiny pink material formed into four petals. The lower layers begin at a rich fuchsia while the middle is the perfect transition into the light pink top. The center of the flower is adorned with ivory beads. |,|$12.00$|,||,|CLASSY-BABY-SHADES-OF-PINK-INFANT-HEADBAND|,|$URL$classy-baby-shades-of-pink-infant-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-shades-of-pink-infant-headband-1.jpg||-||Classy Baby Sky Blue Angelica Flower Clip|,|^|Whether meant to draw out the blue from her outfit or her eyes, this new Classy Baby hair clip is darling! The light sky blue satin creates curling petals while a ring of beads adorn the center. Set upon an alligator clip, measures roughly 3"". ^||,|$16.00$|,||,|CLASSY-BABY-SKY-BLUE-ANGELICA-FLOWER-CLIP|,|$URL$classy-baby-sky-blue-angelica-flower-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-sky-blue-angelica-flower-clip-13.jpg||-||Classy Baby White Angelica Flower Hair Clip|,|Sure to become a staple in her accessorizing, this new girls flower clip from from Classy Baby. The white satin petals curl from their heat sealed edges while the shorter center petals draw attention to the bead center. The pinch alligator clip is easy to use. |,|$16.00$|,||,|CLASSY-BABY-WHITE-ANGELICA-FLOWER-HAIR-CLIP|,|$URL$classy-baby-white-angelica-flower-hair-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-white-angelica-flower-hair-clip-12.jpg||-||Classy Baby White Angelica Headband with Flower|,|^|Matching with virtually any outfit, this new little girls flower headband comes from Classy Baby. The white satin flower features cute curled petals and pearl center. The headband is a soft stretchy material that is made to be comfortable. Flower measures roughly 3"". ^||,|$18.00$|,||,|CLASSY-BABY-WHITE-ANGELICA-HEADBAND-FLOWER|,|$URL$classy-baby-white-angelica-headband-flower.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-white-angelica-headband-with-flower-10.jpg||-||Classy Baby White Infant Headband|,|From designer Classy Baby, this darling hair accessory is sure to be loved. The white satin flower is shiny and pristine while all of the raw edges have been treated with heat to seal and protect from fraying. The thin headband stretches around her head with a dainty look. The small, ivory beads are clustered together at the center of this sweet flower. |,|$12.00$|,||,|CLASSY-BABY-WHITE-INFANT-HEADBAND|,|$URL$classy-baby-white-infant-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-white-infant-headband-1.jpg||-||Classy Baby White Rosette Bow Headband for Girls|,|A perfect unique accessory for the holidays, this new girls headband comes from designer Classy Baby. The hard headband is wrapped with satin ribbon while the oversized bow sits off to one side. Cute little rosettes make up the bow while the crystal center is an elegant finish. |,|$19.00$|,||,|CLASSY-BABY-WHITE-ROSETTE-BOW-HEADBAND-GIRLS|,|$URL$classy-baby-white-rosette-bow-headband-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-white-rosette-bow-headband-for-girls-10.jpg||-||Coastal Projections Black Holiday Shoes for Girls with Bows|,|The lovely black holiday shoes by Coastal Projections are just what she needs this holiday season! The gorgeous little girls ballet flat is covered with sparkling black and silver sequins with an elastic strap that runs across the top of her foot. She will love the fun small silver beads that wrap around her foot and are shaped into a bow on the toes. One large gem adorns the center of these beaded bows. A black rubber sole lines the bottom of the shoe to ensure she has a safe grip on the ground. |,|$52.00$|,||,|COASTAL-PROJECTIONS-BLACK-HOLIDAY-SHOES-GIRLS-BOWS|,|$URL$coastal-projections-black-holiday-shoes-girls-bows.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-black-holiday-shoes-for-girls-with-bows-2.jpg||-||Coastal Projections Black Lace Flats - Sequin Shoes with Beaded Rosettes|,|Lovely in lace, these quaint flats from Coastal Projections are full of small details. The black lace is adorned with silver sequins while the top of the toe features a flower outlined in black sequins and beading. Handmade with a rubber outersole. |,|$49.00$|,||,|COASTAL-PROJECTIONS-BLACK-LACE-FLATS-SEQUIN-SHOES-BLACK-ROSETTE|,|$URL$coastal-projections-black-lace-flats-sequin-shoes-black-rosette.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-black-lace-flats-sequin-shoes-with-beaded-rosettes-12.jpg||-||Coastal Projections Black Sequin Girls Shoes|,|Coastal Projections is now offering these sparkling black flats fit for a princess. These handmade shoes feature beaded sequin detailing covering the black satin. The elastic strap is embellished with three black satin rosettes and provides a tight fit. Rubber sole for a nonslip grip. |,|$42.00$|,||,|COASTAL-PROJECTIONS-BLACK-SEQUIN-FLATS-GIRLS-SHOES-BEADING-BLACK-ROSETTES|,|$URL$coastal-projections-black-sequin-flats-girls-shoes-beading-black-rosettes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-black-sequin-girls-shoes-25.jpg||-||Coastal Projections Girls Black Sequin Shoes Vibrant Flowers|,|A pop of style for her feet, these new little girls black sequin flats are unlike any others. The satin shoes are completely covered in hand beaded and sequin designs boasting of a vibrant flower at the toe and on the back heel. A textured rubber outsole and an elastic band across her foot keeps the fit and grip secure. |,|$52.00$|,||,|COASTAL-PROJECTIONS-BLACK-SEQUIN-SHOES|,|$URL$coastal-projections-black-sequin-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-girls-black-sequin-shoes-vibrant-flowers-23.jpg||-||Coastal Projections Girls Ivory Sequin Shoes with Bow|,|Perfect for her holiday outfits, these sparkling ivory shoes are beyond adorable. The flats are covered in iridescent sequins and feature an ivory rosette band running across the top of her foot. A large satin bow adorned with jewels sits on her toe. |,|$59.00$|,||,|COASTAL-PROJECTIONS-GIRLS-IVORY-SEQUIN-SHOES-BOW|,|$URL$coastal-projections-girls-ivory-sequin-shoes-bow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-girls-ivory-sequin-shoes-with-bow-25.jpg||-||Coastal Projections Girls Pink Sequin Flats with Flower|,|Pretty in pink, these new little girls flats are covered with iridescent sequins. The elastic band is adorned by a fun pinwheel tulle rosette on the side. Pretty in pink shoes that are sure to get her noticed. |,|$49.00$|,||,|COASTAL-PROJECTIONS-GIRLS-PINK-SEQUIN-FLATS-FLOWER|,|$URL$coastal-projections-girls-pink-sequin-flats-flower.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-girls-pink-sequin-flats-with-flower-13.jpg||-||Coastal Projections Girls Silver Glitter T Strap Shoes (Size 13, Youth 1 & 2)|,|Every little girl loves to sparkle and that's just what she'll do in these silver glitter girls shoes from Coastal Projections. Silver glitter covers the entire shoe. A t-strap runs up the center to the ankle strap and plays host to a large grey sequined bow with a rhinestone accent at the center. The sole is of a firm rubber for grip. |,|$39.00$|,||,|COASTAL-PROJECTIONS-GIRLS-SILVER-GLITTER-T-STRAP-SHOES|,|$URL$coastal-projections-girls-silver-glitter-t-strap-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-girls-silver-glitter-t-strap-shoes-25.jpg||-||Coastal Projections Girls Zebra Sequin Shoes|,|Hand designed, these beautiful black and white zebra sequin shoes will be the talk of the town. The flats feature a textured outsole and elastic band across the top of her foot to secure both fit and grip while a sheer zebra ribbon forms a bow at her town, adorned with a single gem. To perfect to pass up! |,|$49.00$|,||,|COASTAL-PROJECTIONS-GIRLS-ZEBRA-SEQUIN-SHOES|,|$URL$coastal-projections-girls-zebra-sequin-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-girls-zebra-sequin-shoes-23.jpg||-||Coastal Projections Hot Pink Girls Sequin Shoes with Bow|,|A sparkling find in hot pink, she's sure to love these girls shoes from Coastal Projections. An abundance of sequins in hot pink cover the entire shoe. A hot pink strap travels across her foot and an oversized pink bow with jewel accents adorns her toes. The shoe has a rubber sole for firm grip. |,|$52.00$|,||,|COASTAL-PROJECTIONS-HOT-PINK-GIRLS-SEQUIN-SHOES-BOW|,|$URL$coastal-projections-hot-pink-girls-sequin-shoes-bow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-hot-pink-girls-sequin-shoes-with-bow-23.jpg||-||Coastal Projections Little Girls Brown Flats Glittering Bow|,|^|Matching her big sisters shoes, these little darlings come from designer Coastal Projections. The brown glitter shoes offer a rosette band running across the top of her foot to keep it secure while a large satin bow adorned with gems sits on her toe. SIZE 6 ONLY LEFT.  ^||,|$59.00$|,||,|COASTAL-PROJECTIONS-LITTLE-GIRLS-BROWN-FLATS-GLITTERING-BOW|,|$URL$coastal-projections-little-girls-brown-flats-glittering-bow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-little-girls-brown-flats-glittering-bow-13.jpg||-||Coastal Projections Little Girls Sequin Shoes Lilac Flowers|,|^|Gorgeous as always, these new Coastal Projection shoes are gorgeous spring time flats for any special occasion. The lilac satin shoes are covered in a hand sequined and beaded garden in mostly pink and greens. A sure grip is offered by the textured rubber outsole as an elastic purple strap over the top of her fit gives a secure fit. SIZES 5 AND 6 LEFT ^||,|$52.00$|,||,|COASTAL-PROJECTIONS-LILAC-FLOWERS-SEQUIN-SHOES|,|$URL$coastal-projections-lilac-flowers-sequin-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-little-girls-sequin-shoes-lilac-flowers-23.jpg||-||Coastal Projections Little Girls Sequin Shoes Pink Flowers (Infant 0, 1, 2, & 3) |,|^|Just in time for any of her spring time special occasions, these little girls sequin shoes are such a delight. These beauties boast of their secure fit with a pink elastic band across her foot and a textured rubber sole to give her a great grip. The outside of the shoe is all hand beaded and features a fun floral design in aqua, purple, fuchsia, green and yellow. Match these with her favorite spring dress for fun photos, wedding attire, or show stopping Easter outfits. INFANT SIZES 0 TO 3 ONLY LEFT.  ^||,|$39.00$|,||,|COASTAL-PROJECTIONS-PINK-FLOWER-SEQUIN-SHOES|,|$URL$coastal-projections-pink-flower-sequin-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-little-girls-sequin-shoes-pink-flowers-12.jpg||-||Coastal Projections Little Girls Sequin Shoes Pink Garden|,|^|A new design from designer Coastal Projections, these hand beaded special occasion flats are great paired with that spring time dress. The shoes are covered in a bright floral design with many fun spring time colors and feature a crystal center to the large flower on the toe. Sure to stay on her feet with the pink elastic band across the top of her foot, these little girls sequin shoes offer a great grip with its textured outsole. Perfect for weddings, photos, or an Easter celebration! SIZE 6 ONLY LEFT.  ^||,|$52.00$|,||,|COASTAL-PROJECTIONS-PINK-GARDEN-SEQUIN-SHOES|,|$URL$coastal-projections-pink-garden-sequin-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-little-girls-sequin-shoes-pink-garden-23.jpg||-||Coastal Projections Pink Girls Pastel Sequin Shoes with Flower|,|^|Beautiful shoes for your beautiful darling, these lovely girls shoes are fresh from Coastal Projections. All dressed up in a generous amount of sequins in pastel colors, they are just too cute. A pink flower sits on the outside and a pink stretchy strap travels across her foot. A rubber sole gives a firm grip. SIZE 0 INFANT ONLY REMAINING. ^||,|$49.00$|,||,|COASTAL-PROJECTIONS-PINK-GIRLS-PASTEL-SEQUIN-SHOES-FLOWER|,|$URL$coastal-projections-pink-girls-pastel-sequin-shoes-flower.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-pink-girls-pastel-sequin-shoes-with-flower-13.jpg||-||Coastal Projections Pink Sequin Flats Strappy Rosette|,|A sparkling addition to her new designer dresses, this shimmering shoe for girls comes from Coastal Projections. The flats are covered with pink sequins that catch the lights. The sole is a rubber that grips with her every step. A strap runs across the top of her foot to keep it secure and is decorated with three quaint rosettes. |,|$53.00$|,||,|COASTAL-PROJECTIONS-PINK-SEQUIN-FLATS-STRAPPY-ROSETTE|,|$URL$coastal-projections-pink-sequin-flats-strappy-rosette.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-pink-sequin-flats-strappy-rosette-1.jpg||-||Coastal Projections Pink Sequin Flats- Satin Tie Bow (Size 0, 1, & 2 Infant)|,|^|Sparkling in style, these adorable little girl flats are the perfect finishing touch. Handstitched beaded sequins cover the outside of the shoe in a petal pink and also create three petite flowers found on the top of the toe. Finished off with a satin tie bow at the back. Rubber outer sole for sound grip. infant sizes 0, 1, & 2available only. ^||,|$29.00$|,||,|COASTAL-PROJECTIONS-PINK-SEQUIN-FLATS-LITTLE-GIRL-SHOES-SATIN-TIE-BOW|,|$URL$coastal-projections-pink-sequin-flats-little-girl-shoes-satin-tie-bow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-pink-sequin-flats-satin-tie-bow-11.jpg||-||Coastal Projections Purple Girls Sequin Shoes with Flower|,|Coastal Projections has done it again in these perfectly purple girls sequin shoes. Purple hued iridescent sequins cover the entire shoe. A flower of purple mesh blooms on the outside of the shoe, while a stretchy strap of purple travels over her foot. The rubber sole provides her a firm support and grip. |,|$49.00$|,||,|COASTAL-PROJECTIONS-PURPLE-GIRLS-SEQUIN-SHOES-FLOWER|,|$URL$coastal-projections-purple-girls-sequin-shoes-flower.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-purple-girls-sequin-shoes-with-flower-39.jpg||-||Coastal Projections Red Rosette Sequin Shoes (Size 0 Infant & Girls 2)|,|^|Quality handmade by Coastal Projections, these little girls shoes are covered with beaded red sequins. Three rosettes embellish the toes. Elastic strap for fit. Her own ruby slippers! INFANT 0 & GIRLS 2 REMAINING.  ^||,|$44.00$|,||,|COASTAL-PROJECTIONS-RED-SEQUINED-SHOES|,|$URL$coastal-projections-red-sequined-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-red-rosette-sequin-shoes-23.jpg||-||Coastal Projections Red Velvet Flats - Little Girl Shoes with Beading (Size 0, 1 & 2 Infant)|,|Elegant in a rich red, these new velvet flats now offered by Coastal Projections are the perfect pair of shoes for fall and winter. A touch of sparkle is added through hand beaded detailing. These shoes also feature a small red satin rosette on the outer side of each shoe and a comfortable elastic strap to keep them in place. Rubber sole, handmade. |,|$29.00$|,||,|COASTAL-PROJECTIONS-RED-VELVET-FLATS-LITTLE-GIRL-SHOES-BEADING|,|$URL$coastal-projections-red-velvet-flats-little-girl-shoes-beading.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-red-velvet-flats-little-girl-shoes-with-beading-13.jpg||-||Coastal Projections Sequin Party Shoes in Hot Pink|,|Coastal Projections can always be counted upon to create brilliant shoes that compliment her designer outfits, and this pair is no different. This flats are completed covered in hot pink sequins that are bold in color and shimmer as they catch the light. Upon the toe of both feet we find a sweet beaded flower design. A single strap runs across the top of her foot to keep it in place as she moves about. The outer sole is rubber to provide grip. |,|$54.00$|,||,|COASTAL-PROJECTIONS-SEQUIN-PARTY-SHOES-HOT-PINK|,|$URL$coastal-projections-sequin-party-shoes-hot-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-sequin-party-shoes-in-hot-pink-12.jpg||-||Coastal Projections Silver Sequin Flats Rosettes|,|Precious in glitz, these little shoes are perfect to match with that special outfit. These flats are covered in hand stitched, beaded sequins. They also feature an elastic strap to ensure a nice fit detailed by quaint silver satin rosettes. Rubber sole by Coastal Projections. |,|$48.00$|,||,|COASTAL-PROJECTIONS-SILVER-SEQUIN-FLATS-BEADED-SHOES-ROSETTES|,|$URL$coastal-projections-silver-sequin-flats-beaded-shoes-rosettes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-silver-sequin-flats-rosettes-25.jpg||-||Coastal Projections Tween Girls Brown Glitter Flats|,|^|Contagiously beautiful, these new tween flats will bring joy to her smile. The flats are covered in shimmering brown glitter and boast of the cute satin bow adorning her toe. Crystal beads add the final touch to this delightful creation. SIZE 1 AND 2 LEFT.  ^||,|$59.00$|,||,|COASTAL-PROJECTIONS-TWEEN-GIRLS-BROWN-GLITTER-FLATS|,|$URL$coastal-projections-tween-girls-brown-glitter-flats.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-tween-girls-brown-glitter-flats-13.jpg||-||Couture Girl Headband Mocha Medley (Size MD 2T-4T)|,|^|Made to match any of her designer fall styles, this hand crafted headband is a LaBella Flora exclusive. This headband is made from a soft ivory lace that will sit comfortably on her head. Two mocha brown rosettes sit to the side of a large sheer taupe bow. Adorning the other side of the bow, a large darker brown flower with mesh accents and a large pearl center to finish the look. Proudly crafted in the USA. SIZE MEDIUM (2T-4T) LEFT.  ^||,|$29.00$|,||,|COUTURE-GIRL-HEADBAND-MOCHA-MEDLEY|,|$URL$couture-girl-headband-mocha-medley.html|,|http://ep.yimg.com/ay/yhst-17102259411242/couture-girl-headband-mocha-medley-1.jpg||-||Couture Girls Headband in Pink (MD 2T-4T, LG 4-10)|,|^|A LaBella Flora exclusive, this beautifully handmade headband was proudly crafted in the USA. The headband is an oh so soft ivory lace that will keep her comfortable with no itching. This style boasts 3 lovely flowers in different shades of subdued pink in different fabrics. The color combination of this vintage chic style will match many new arrivals we've received this fall. Little wisps of thread on the edges of the flowers finish the look with a raw edge. ONE EACH MD 2T-4T & LG 4-10 ONLY LEFT. ^||,|$29.00$|,||,|COUTURE-GIRLS-HEADBAND-PINK|,|$URL$couture-girls-headband-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/couture-girls-headband-in-pink-1.jpg||-||Daisy Jane Girls Boutique Dresses in Crochet Lace|,|An adorable creation from Daisy Jane, this new girls dress has arrived just in time to wow all her friends at school. The dress is cut for a more fitted look and offers a square neckline. The sleeves are sheer and finished with sweet bell ruffles. The lining peaks out through the soft crochet lace that creates the unique look to this piece. 100% Polyester. Machine Wash in Cold Water. Line Dry. |,|$36.75$|,||,|DAISY-JANE-GIRLS-BOUTIQUE-DRESSES-CROCHET-LACE|,|$URL$daisy-jane-girls-boutique-dresses-crochet-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/daisy-jane-girls-boutique-dresses-in-crochet-lace-1.jpg||-||Derhy Kids Candice Dress for Tweens|,|A dreamy new creation for your fabulous tween, this designer dress was created by Derhy Kids. The bodice boasts of metallic gold trimming that outlines the sleeveless neckline and the front center panel. The sheer fabric is covered with a unique, colorful print accented with clear, square sequins. The fitted bodice has a metal zipper that fastens up the back. Pleating falls from the waistline to open up the shape. The fabric sways with her movement and the slight breeze. The subtle stripes are covered with pinks, tans, and yellows with a slight touch of blue. The dress is fully lined. Viscose blend with nylon and metallic fiber. Lining: 100% polyester. Hand wash with care and hang or dry flat. |,|$87.00$|,||,|DERHY-KIDS-CANDICE-DRESS-TWEENS|,|$URL$derhy-kids-candice-dress-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/derhy-kids-candice-dress-for-tweens-1.jpg||-||Derhy Kids Girls Chiffon White Dress in Tropical Print|,|New from French designer Dehry Kids comes this romantic white chiffon dress for your tween. This sleeveless style featuring a sheer tropical print has sequin embellishments on the front and a keyhole button closure at back. The gathered elastic waistline allows for the flowy look that is trending this summer. Complete with soft ruffle detailing at the hemline. 100% polyester. Hand wash with care and hang to dry. |,|$69.00$|,||,|DERHY-KIDS-GIRLS-CHIFFON-WHITE-DRESS-TROPICAL-PRINT|,|$URL$derhy-kids-girls-chiffon-white-dress-tropical-print.html|,|http://ep.yimg.com/ay/yhst-17102259411242/derhy-kids-girls-chiffon-white-dress-in-tropical-print-1.jpg||-||Derhy Kids Summer Dress in Sandrine White|,|A fabulous dress perfect for any summer wedding or event, this new tween dress comes from high end designer Derhy Kids. The dress boasts of a fitted bodice covered with sweet petal flowers. A hidden zipper runs up the back. An illusion neckline is created with mesh and closed with a single button keyhole on her back. The skirt is created with a sheer fabric that is slightly more coarse than the typical silky chiffon. This allows for a chic look from the unique texture. The dress is fully lined while a touch of tulle ruffles beneath the hemline. This dress is perfect for a flower girl! 100% polyester. Hand wash with care and hang to dry. |,|$72.00$|,||,|DERHY-KIDS-SUMMER-DRESS-SANDRINE-WHITE|,|$URL$derhy-kids-summer-dress-sandrine-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/derhy-kids-summer-dress-in-sandrine-white-1.jpg||-||Derhy Kids Tween White Dress Cecile|,|A sweet summer dress for tweens, this new arrival comes from Derhy Kids. This dress features a sleeveless bodice with a hidden zipper found in the back. The wide neckline is dressed with neon pink sequins and small gems. The sheer georgette fabric has a sophisticated drape to the way it lays. A jungle print adds rich blues and greens while accented with small beads and sequins. The waist adds a pop of neon color. The fit opens through the skirt to allow the fabric to dance around her legs. This dress is fully lined in white polyester. Georgette fabric: polyester blend. Hand wash only, hang to dry. |,|$87.00$|,||,|DERHY-KIDS-TWEEN-WHITE-DRESS-CECILE|,|$URL$derhy-kids-tween-white-dress-cecile.html|,|http://ep.yimg.com/ay/yhst-17102259411242/derhy-kids-tween-white-dress-cecile-17.jpg||-||Desigual Black and White Stripe Girls Dress (Size 9/10)|,|^|Desigual is now offering this casual tween dress for summer. The dress boasts of a relaxed, blouson fit bodice with a sweet bow placed upon the center of the waistline. The front is covered with colorful circles that contrast the black and white jailbird stripe. 100% cotton. Wash separately. SIZE 9/10 ONLY LEFT.  ^||,|$36.75$|,||,|DESIGUAL-BLACK-WHITE-STRIPE-GIRLS-DRESS|,|$URL$desigual-black-white-stripe-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-black-and-white-stripe-girls-dress-1.jpg||-||Desigual Butterfly Denim Skirt for Girls (4 & 9/10)|,|^|A cute casual skirt perfect for school, this new arrival comes from the creative designers at Desigual. The dark blue denim skirt boasts of fading on the front and slight whiskering to give a slightly distressed look. Sparkling sequins and colored fabrics wrap around her waist while the bright circle print is found not only on the hemline but also inside one of the front pockets. The left skirt is accented with two butterflies. Made with a cotton blend. Machine wash cold, tumble dry low. SIZE 4 AND 9/10 ONLY REMAINING.  ^||,|$34.50$|,||,|DESIGUAL-BUTTERFLY-DENIM-SKIRT-GIRLS|,|$URL$desigual-butterfly-denim-skirt-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-butterfly-denim-skirt-for-girls-2.jpg||-||Desigual Chiffon Red Dress for Girls|,|Easy to wear as a casual outfit or to dress up, this new girls dress comes from Desigual for girls. The empire waist is defined with a touch of elastic while the bodice boasts of a sheer overlay that creates an illusion neckline. The thin shoulder straps are adjustable. The chiffon is covered with a small polka dot print and touches of colorful flowers. Polyester. Wash separately. |,|$46.50$|,||,|DESIGUAL-CHIFFON-RED-DRESS-GIRLS|,|$URL$desigual-chiffon-red-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-chiffon-red-dress-for-girls-1.jpg||-||Desigual Designer Girls Skirt in Green |,|^|From European designer, Desigual, this new girls skirt is sure to be a staple in her school wardrobe. The skirt features a fold over waist that stretches for a comfortable fit. The waist is striped in greens and a touch of pink. The skirt opens to a full circle shape that is a loved look by many. The colorful design off to the right side of the skirt pops out against the black background. Cotton/Elastane. Machine wash cold, inside out. Hang to dry. SIZE 7/8 REMAINING.  ^||,|$40.50$|,||,|DESIGUAL-DESIGNER-GIRLS-SKIRT-GREEN|,|$URL$desigual-designer-girls-skirt-green.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-designer-girls-skirt-in-green-1.jpg||-||Desigual Girls Back to School Dress in Blue (4)|,|^|Created by Desigual, this new girls dress is sure to be envied by her friend. The blue dress features a front covered with circles. A touch of satin fabric appliques adds a new twist to the look. The long sleeves are created in a coordinating circle print fabric in blue. The dress is cut for a straight fit that is relaxed, comfortable, and sure to look fabulous with leggings paired beneath. 100% Cotton. Hand wash cold, inside out. SIZE 4 ONLY REMAINING.  ^||,|$36.75$|,||,|DESIGUAL-GIRLS-BACK-TO-SCHOOL-DRESS-BLUE|,|$URL$desigual-girls-back-to-school-dress-blue.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-girls-back-to-school-dress-in-blue-1.jpg||-||Desigual Girls Boat Neck Dress in Grey Bloom|,|A casual dress that she can wear any day of the week, this new arrival comes from Desigual Kids. The soft grey fabric allows for a cozy fit and offers long sleeves. The boat neck is a trendy choice to style this top. The front of the dress is covered with a unique print that is made from rich red tones. A thin tie is finished in a bow on the waist. 100% Cotton. Hand wash cold, inside out. |,|$61.50$|,||,|DESIGUAL-GIRLS-BOAT-NECK-DRESS-GREY-BLOOM|,|$URL$desigual-girls-boat-neck-dress-grey-bloom.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-girls-boat-neck-dress-in-grey-bloom-1.jpg||-||Desigual Girls Minnie Mouse Shirt in Red|,|^|A popular design from the new fall and winter line by Desigual Kids, this fabulous shirt is loved by all. The red top offers her long sleeves to help keep her warm in the chillier months. The front is graced with a large print while her right sleeve boasts of Disney polka dots. A large Minnie mouse head sits upon the front lined with black sequins to catch the light. Her red hair bow is also made from sequins. 100% Cotton. Machine wash cold, inside out. (1) SIZE 4 REMAINING. ^||,|$36.75$|,||,|DESIGUAL-GIRLS-MINNIE-MOUSE-SHIRT-RED|,|$URL$desigual-girls-minnie-mouse-shirt-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-girls-minnie-mouse-shirt-in-red-1.jpg||-||Desigual Girls Romper in Bright Print (Size 4 & 13/14)|,|A trendy style for the warmer months, this romper is covered with an exotic print. The romper features a belt that ties around her waist and spaghetti straps. The top of the bodice is a smocked stretch fit. The belt at the waist allows for a flowing blouse fit on the top while the wide legs are hemmed with an elastic ruffle. 100% polyester. Hand wash only. |,|$29.00$|,||,|DESIGUAL-GIRLS-ROMPER-BRIGHT-PRINT|,|$URL$desigual-girls-romper-bright-print.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-girls-romper-in-bright-print-1.jpg||-||Desigual Girls Skinny Pant in Black|,|Looking fabulous with her new Desigual tops, these girls skinny pants are a wardrobe classic. The pants offer slight stretch in their fit and have a sweet ribbon that ties into a bow around her waist. Near the hem of both legs we find a faint fly trap design. This design stands out from the subtle damask print to the fabric. 99% Cotton. Machine wash cold with like colors. Hang to dry. |,|$28.50$|,||,|DESIGUAL-GIRLS-SKINNY-PANT-BLACK|,|$URL$desigual-girls-skinny-pant-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-girls-skinny-pant-in-black-1.jpg||-||Desigual Girls Striped Desigual Tee - Size 5/6|,|^|The perfect way to show off her individual style, this new Desigual tee is unforgettable. The bright stripes are blends of beautiful colors that are unique for a fall pallet. The Desigual name that is printed on the front is filled with different patterns and fonts. One long sleeve sides with the striped front while the other wears the fun geometric pattern that covers the back. 100% cotton. Hand wash cold, hang to dry. SIZE 5/6 ONLY LEFT.  ^||,|$24.50$|,||,|DESIGUAL-GIRLS-STRIPED-DESIGUAL-TEE|,|$URL$desigual-girls-striped-desigual-tee.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-girls-striped-desigual-tee-2.jpg||-||Desigual Girls Top with Face Graphic|,|Created for the fashion forward, this new designer girls top comes from the beloved Desigual brand. The top is as cute as can be boasting of its sharkbite hemline and quaint short sleeves. The light weight fabric is covered with a color block stripe that travels from pink to white to orange. Near the wide hemline we find a large screen print of a face with red lips and short hair. Poly/cotton. Hand wash cold water inside out. |,|$36.75$|,||,|DESIGUAL-GIRLS-TOP-FACE-GRAPHIC|,|$URL$desigual-girls-top-face-graphic.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-girls-top-with-face-graphic-16.jpg||-||Desigual Glitter Champagne Tween Skinny Jeans (Size 11/12 & 13/14)|,|^|Quickly becoming the talked about piece in many of her outfits, these new jeans come from Europe based designer, Desigual. The denim pants feature a skinny shape finished with slight gathers on each ankle and a shimmering champagne color. Fun designs and words accent both back pockets. Cotton blend, machine washable. 11/12 AND 13/14 ONLY AVAILABLE.  ^||,|$19.00$|,||,|DESIGUAL-GLITTER-CHAMPAGNE-TWEEN-SKINNY-JEANS|,|$URL$desigual-glitter-champagne-tween-skinny-jeans.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-glitter-champagne-tween-skinny-jeans-14.jpg||-||Desigual Green Fringe Scarf for Girls|,|Created by Desigual to finish her new fall and winter outfits off right, this new scarf is so cute! The grass green scarf is covered a subtle print, just a shade darker while bright blooming flowers pop out in color. A thin line of sequins runs around the edge that is finished with cute, trendy fringe. 100% polyester. Hand wash cold, hang to dry. |,|$17.00$|,||,|DESIGUAL-GREEN-FRINGE-SCARF-GIRLS|,|$URL$desigual-green-fringe-scarf-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-green-fringe-scarf-for-girls-2.jpg||-||Desigual Kids Shorts Fleece Lined Denim (4, 7/8, 9/10)|,|Warming up a traditionally cooler style, this new design from Desigual is adorable. The denim shorts feature a soft ivory lambswool the edges both the hem and her pockets while two pink buttons close the waist. A vibrant printed fabric wraps around one side of her waist while stripes of purple and pink sequins run around the other. One of the back pockets is detailed by a pink feather print. Pair with leggings or tights in the cooler months. |,|$34.33$|,||,|DESIGUAL-KIDS-SHORTS-FLEECE-LINED-DENIM|,|$URL$desigual-kids-shorts-fleece-lined-denim.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-kids-shorts-fleece-lined-denim-2.jpg||-||Desigual Long Sleeve Dress in Purple - Size 4|,|^|Ready for whatever the day throws at her, this new girls dress from designer Desigual is stylish and comfortable, perfect for any errand or plan. The long sleeve dress boasts of a rich pallet of purple shade and a dreamy print. The waist is defined only by the ribbon that ties in a bow around it. The skirt opens in shape from the waist to the hem and features a second layer that peaks out beneath and finishes with a dainty scallop hemline. 100% cotton. Machine wash cold, tumble dry low. (1) 4 ONLY.  ^||,|$31.00$|,||,|DESIGUAL-LONG-SLEEVE-DRESS-PURPLE|,|$URL$desigual-long-sleeve-dress-purple.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-long-sleeve-dress-in-purple-2.jpg||-||Desigual Long Sleeve Top for Girls in Multi Print|,|^|Designer Desigual is a well known and loved European brand. They have created this fun new top for girls as a part of their new line for fall and winter. This top is a beyond comfortable feel with its casual fit. The neck is wrapped in black trim to match the background while bold colors pop out. The unique kaleidoscope print is created with fabric appliques and traditional screen prints. The long sleeves finish with a sweater knit cuff in pink. 100% Cotton. Hand wash cold, inside out. (1) SIZE 4 REMAINING.  ^||,|$58.00$|,||,|DESIGUAL-LONG-SLEEVE-TOP-GIRLS-MULTI-PRINT|,|$URL$desigual-long-sleeve-top-girls-multi-print.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-long-sleeve-top-for-girls-in-multi-print-1.jpg||-||Desigual Minnie Mouse Sequin Heart Dress (4, 9/10, & 11/12)|,|With an older version of the beloved Minnie Mouse, this new girls dress is a design by Desigual for kids. The rich stripes run horizontally across the dress. The bodice features short sleeves and a wide neckline. A touch of elastic defines her waistline while the skirt falls to a classic, straight hemline. The large character screen print has touches of pink and silver while a sequin heart is found in the conversation bubble. 100% Cotton. Hand wash inside out cold water. |,|$39.00$|,||,|DESIGUAL-MINI-MOUSE-SEQUIN-HEART-DRESS|,|$URL$desigual-mini-mouse-sequin-heart-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-minnie-mouse-sequin-heart-dress-1.jpg||-||Desigual Minnie Mouse Tank Top for Girls (9/10 & 13/14)|,|^|Filled with the love of Disney, this new designer top comes from Desigual for kids. The white and red ombre top boasts of thin shoulder straps that frame the neckline. Minnie Mouse profile is posed on the front. The wide cut of the top allows for a comfortable, casual fit. 100% cotton. Hand wash cold, lay flat to dry. SIZE 9/10 AND 13/14 ONLY LEFT.  ^||,|$31.50$|,||,|DESIGUAL-MINI-MOUSE-DRESS-PINK-GRAY|,|$URL$desigual-mini-mouse-dress-pink-gray.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-minnie-mouse-tank-top-girls-1.jpg||-||Desigual Polka Dot Girls Skirt|,|From designer Desigual, this new fabulous skirt is sure to create many wonderful summer outfits. The white skirt boasts of a short, fitted cut. Large black polka dots cover the skirt completely. Pair this piece with any of her favorite new Desigual creations. 100% cotton. Hand wash cold. |,|$28.50$|,||,|DESIGUAL-POLKA-DOT-GIRLS-SKIRT|,|$URL$desigual-polka-dot-girls-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-polka-dot-girls-skirt-1.jpg||-||Desigual Summer Dress for Tweens (Size 13/14)|,|^|Filled with the Desigual style, this new girls dress is sure to take pride in its bold colors underneath the warm sunlight. The empire bodice has a crossover, V neckline. The sleeveless dress features touches of green, pink, and blue in its patterns. The skirt is paneled in different fabrics upon the front. 100% cotton. Wash separately. Lay flat to dry. (1) SIZE 13/14 ONLY LEFT.  ^||,|$39.00$|,||,|DESIGUAL-SUMMER-DRESS-TWEENS|,|$URL$desigual-summer-dress-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-summer-dress-for-tweens-1.jpg||-||Desigual Top for Girls in Blue|,|^|A trendy new top for your fabulous daughter, this design was created by European designer, Desigual. The top features the fun dolman fit. The neckline is a wide boat neck cut. The left side of the front is covered with a scrolling blue print creating flowers and leaves. The right side is a large applique covered with a green kaleidoscope print and finished with a gold stitched edge. 100% Viscose. Hand wash cold, inside out.SIZE 4 & 7/8 LEFT.  ^||,|$31.50$|,||,|DESIGUAL-TOP-GIRLS-BLUE-BLACK|,|$URL$desigual-top-girls-blue-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-top-for-girls-in-blue-1.jpg||-||Desigual Tween Denim Skirt Short Bubble (Size 13/14)|,|^|Perfect to pair with her favorite summer top, this new tween denim skirt from designer Desigual gives an abundance of possibilities. The skirt features a medium wash with slight fading, a large teal snap button, and two pockets on the front and back. The left waist boasts of a lace applique whiles three scalloped lace ribbons wrap from the center around her right side, ending in the back. The uniqueness of this piece comes with its wide hem, slightly taken in, to give it a shape that bubbles out slightly. Made with cotton blend. ONE SIZE 13/14.  ^||,|$19.00$|,||,|DESIGUAL-TWEEN-DENIM-SKIRT-SHORT-BUBBLE|,|$URL$desigual-tween-denim-skirt-short-bubble.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-tween-denim-skirt-short-bubble-13.jpg||-||Desigual Tween Girls Summer Skirt (4, 5/6, 9/10 & 13/14)|,|A classic design from Desigual girls, this new summer skirt is a fresh breeze. The skirt features a stretch waist that sits comfortably for all day wear. The white cotton is paneled with different, bold prints. The blends of greens, yellow, pinks, and blues are sure to make this skirt match almost all of her tops! A second layer peeks out from beneath the hemline. 100% cotton. Wash seperately. |,|$46.50$|,||,|DESIGUAL-TWEEN-GIRLS-SUMMER-SKIRT|,|$URL$desigual-tween-girls-summer-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-tween-girls-summer-skirt-1.jpg||-||Desigual Tween Tank Top Circle Print (Size 13/14)|,|^|A brilliant design, European brand Desigual is now offering this adorable piece. The tween tank top boasts of a grey and white stripe and a scoop neckline. The racer back is a casual cut and allows for a relaxed fit. The front is covered with a bold, colorful bull's-eye in blue, green, and pink. 100% cotton. Hand wash only. 13/14 ONLY AVAILABLE.  ^||,|$25.50$|,||,|DESIGUAL-TWEEN-TANK-TOP-CIRCLE-PRINT|,|$URL$desigual-tween-tank-top-circle-print.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-tween-tank-top-circle-print-1.jpg||-||Deux Par Deux Girl Sundress Orange Swiss Dot|,|Complimenting so many different outfits that have arrived from designer Deux Par Deux, this fabulous girls sundress is a trendy coral orange. The elastic straps are ruffled on the shoulders and frame the wide, straight neckline. The fabric is textured with a swiss dot while the hemline is layered in ruffles. |,|$44.25$|,||,|DEUX-PAR-DEUX-GIRL-SUNDRESS-CORAL-SWISS-DOT|,|$URL$deux-par-deux-girl-sundress-coral-swiss-dot.html|,|http://ep.yimg.com/ay/yhst-17102259411242/deux-par-deux-girl-sundress-coral-swiss-dot-1.jpg||-||Deux Par Deux Girls Bow Dress Black|,|Sophisticated and cute, this girls dress comes from designer Deux Par Deux. The drop waist bodice is a solid black fabric featuring a classic neckline secured by a single button keyhole in the back. The front of her waist is covered with a row of large bows. The skirt finishes with a layered hemline that introduces the same two prints that create the bows. Made with cotton blend. Machine wash cold, tumble dry low. |,|$39.00$|,||,|DEUX-PAR-DEUX-GIRLS-BOW-DRESS-BLACK|,|$URL$deux-par-deux-girls-bow-dress-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/deux-par-deux-girls-bow-dress-black-32.jpg||-||Deux Par Deux Girls Red Summer Top|,|This new darling summer top from designer Deux Par Deux is part of their spring and summer collection. The bold red top has a wide neckline framed with thin gingham ruffled straps. The front features stitching details and small flower accents and has a single button keyhole closure. |,|$27.00$|,||,|DEUX-PAR-DEUX-GIRLS-RED-SUMMER-TOP|,|$URL$deux-par-deux-girls-red-summer-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/deux-par-deux-girls-red-summer-top-1.jpg||-||Deux Par Deux Girls Top and Short in Orange|,|Also available in navy, this new designer girls top and short set comes from Deux Par Deux. The veil top has a polka dot overlay that dresses the solid white tank. A quaint ruffle accents the shape of the neckline while the wide shoulder straps are gathered with a piece of fabric. Cute coral shorts are worn beneath. These bottoms feature a bubble cut with a button/zipper fly. The shorts are covered with a small swiss dot texture. |,|$59.00$|,||,|DEUX-PAR-DEUX-GIRLS-TOP-SHORT-CORAL|,|$URL$deux-par-deux-girls-top-short-coral.html|,|http://ep.yimg.com/ay/yhst-17102259411242/deux-par-deux-girls-top-and-short-in-orange-1.jpg||-||Deux Par Deux Little Girls Heart Dress|,|Deux Par Deux is now offering this fabulous little girls outfit for spring and summer. The top boasts of cap sleeves and a single button keyhole at the back of the neckline. A small heart is found on the front while the rich pink polka dots cover the entire piece. Two pleats open up the shape of the top while the double layer hemline is dressed with ruffles. Paired beneath the top are matching pink leggings. The hemline is dressed with a ruffle on the outer side of both legs. Top: 100% cotton. Leggings: Made with cotton blend. Machine wash cold, tumble dry low. |,|$49.00$|,||,|DEUX-PAR-DEUX-LITTLE-GIRLS-HEART-DRESS|,|$URL$deux-par-deux-little-girls-heart-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/deux-par-deux-little-girls-heart-dress-11.jpg||-||Deux Par Deux Navy Chevron Top and Short|,|Created with love for the spring and summer seasons, this new Deux Par Deux is easy to fall in love with! The top features a veil overlay in a fun, navy chevron stripe. The neckline is dressed in polka dots and wide stripes. The bold pink shorts paired beneath are covered with a swiss dot texture. The bubble style is characterized by the wide hem and the fitted waist. |,|$59.00$|,||,|DEUX-PAR-DEUX-NAVY-CHEVRON-TOP-SHORT|,|$URL$deux-par-deux-navy-chevron-top-short.html|,|http://ep.yimg.com/ay/yhst-17102259411242/deux-par-deux-navy-chevron-top-and-short-1.jpg||-||Deux Par Deux Navy Stripe Dress for Girls|,|A retro chic, this fabulous girls dress was designed by loved Deux Par Deux. The white and navy stripes run own the entire dress while her wide neckline is created by the unique shape of the straps. The left side is printed with a water color flower design. The dress finishes with a full circle hem that ruffles around her legs as she walks and twirls. Made with cotton blend. Machine wash cold, tumble dry low. |,|$42.00$|,||,|DEUX-PAR-DEUX-BLACK-STRIPE-DRESS-GIRLS|,|$URL$deux-par-deux-black-stripe-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/deux-par-deux-black-stripe-dress-for-girls-11.jpg||-||Deux Par Deux Pink Plaid Dress for Girls|,|The perfect summer dress, this new arrival comes from Deux Par Deux. The fitted bodice boasts of coral and pink shoulder straps that cross and wrap around her empire waistline. The scoop neckline welcomes the warm sunshine. The rich shades of pink and coral are a top pick for summer and are blended into a large plaid print. The hemline dances in its ruffles. 100% cotton. Machine wash cold, do not tumble dry. |,|$48.00$|,||,|DEUX-PAR-DEUX-PINK-PLAID-DRESS-GIRLS|,|$URL$deux-par-deux-pink-plaid-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/deux-par-deux-pink-plaid-dress-for-girls-32.jpg||-||Deux Par Deux Plaid Tunic with Leggings|,|Refreshing like a cool breeze, this new Deux Par Deux outfit is adorable. The bodice features keyhole back and two bows found on the shoulders. The pleating found at the neckline opens up the tunic's shape while a row of buttons sit in the center. Coordinating leggings are paired beneath with accents found just above the hemline on both legs. |,|$39.00$|,||,|DEUX-PAR-DEUX-PLAID-TUNIC-LEGGINGS|,|$URL$deux-par-deux-plaid-tunic-leggings.html|,|http://ep.yimg.com/ay/yhst-17102259411242/deux-par-deux-plaid-tunic-with-leggings-1.jpg||-||Deux Par Deux Rainbow Summer Dress for Girls|,|Rival the bright warmth of the sun, this new girls sun dress comes from designer Deux Par Deux. The bold pink bodice is framed with tiny black dots found at the neckline and empire waist. Striped ruffles decorate the shoulders and a single button fastens on the back. Small bows are also found on the top. The skirt is tiered in a color block fashion with a wide ruffle hem. |,|$39.00$|,||,|DEUX-PAR-DEUX-RAINBOW-SUMMER-DRESS-GIRLS|,|$URL$deux-par-deux-rainbow-summer-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/deux-par-deux-rainbow-summer-dress-for-girls-1.jpg||-||Deux Par Deux Red Eyelet Shorts for Girls|,|New from Deux Par Deux, these sweet eyelet lace shorts are sure to be a favorite this summer. These shorts are finished with a button tab hemline and offer her comfortable pockets and a zipper/button fly. |,|$19.00$|,||,|DEUX-PAR-DEUX-RED-LACE-SHORTS-GIRLS|,|$URL$deux-par-deux-red-lace-shorts-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/deux-par-deux-red-lace-shorts-for-girls-1.jpg||-||Deux Par Deux Striped Girls Dress with Legging|,|From designer Deux Par Deux, this new girls outfit is sure to be one both mom and daughter adore. The flounced dress features a bow bodice accented with four buttons and thin stripes. The hemline is covered with a chevron stripe print while the back has a coordinating polka dot design. Matching thin stripe leggings are paired beneath. Top: 100% cotton. Leggings: Made with cotton blend. Machine wash cold, tumble dry low. |,|$49.00$|,||,|DEUX-PAR-DEUX-STRIPED-GIRLS-DRESS-LEGGING|,|$URL$deux-par-deux-striped-girls-dress-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/deux-par-deux-striped-girls-dress-with-legging-33.jpg||-||Dolls and Divas Girls Party Dress in Black Pleather (Size 14)|,|^|Stylish and trendy, this new girls dress is beyond any other piece in her closet. The fitted dress boasts of its black pleather fabric that allows a slight stretch and a wide sleeveless neckline. The peplum skirt ruffles around at the waist and brings shape and interest to the short skirt. Metallic silver trimmings finish off this adorable fashion forward look. Made in the USA. Hand wash with care in cold water and lay flat to dry. Dolls and Divas tends to run small. Please consider ordering up a size. SIZE 14 ONLY LEFT.  ^||,|$19.00$|,||,|DOLLS-DIVAS-GIRLS-PARTY-DRESS-BLACK-PLEATHER|,|$URL$dolls-divas-girls-party-dress-black-pleather.html|,|http://ep.yimg.com/ay/yhst-17102259411242/dolls-and-divas-girls-party-dress-in-black-pleather-32.jpg||-||DreamSpun Aqua Little Girls Necklace|,|A light blue dream accessory, this little girls necklace comes from designer DreamSpun. The necklace is made with beads of all kinds. The clear prisms and small gems catch the light while the shimmering satin finish contrasts with other beads nearby. The center of the necklace is adorned by a large diamond. |,|$19.50$|,||,|DREAMSPUN-AQUA-LITTLE-GIRLS-NECKLACE|,|$URL$dreamspun-aqua-little-girls-necklace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/dreamspun-aqua-little-girls-necklace-1.jpg||-||DreamSpun Aqua Top with Mustard Shorties for Girls (2, 8)|,|^|An easy outfit with great charm, this new top and short set comes from designer DreamSpun. The unique top is covered with a paisley print upon the light blue background. An oversized rosette is found near the ruffled, elastic neckline. Mustard yellow shoulder straps are covered with sweet polka dots and tie in the back. The matching shorties are great paired with almost every top! The two tone stripe races around her legs. The hem of both legs is a double ruffle that adds a finishing touch of grace. 100% cotton. Made in the USA. Machine wash cold, tumble dry. SIZE 2 & 8 ONLY REMAINING.  ^||,|$59.00$|,||,|DREAMSPUN-AQUA-TOP-MUSTARD-SHORTIES-GIRLS|,|$URL$dreamspun-aqua-top-mustard-shorties-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/dreamspun-aqua-top-with-mustard-shorties-for-girls-17.jpg||-||DreamSpun Girls Hair Clip with Feather Detail|,|Finishing the cute new summer outfit with a gorgeous accessory, this new arrival comes from DreamSpun. The darling hair clip is created from a trio of flowers. The blooms blend blue, yellow and pink in a delicious new way! A blue feather accents the accessory and it clips in her hair easily! |,|$19.50$|,||,|DREAMSPUN-GIRLS-HAIR-CLIP-FEATHER-DETAIL|,|$URL$dreamspun-girls-hair-clip-feather-detail.html|,|http://ep.yimg.com/ay/yhst-17102259411242/dreamspun-girls-hair-clip-with-feather-detail-1.jpg||-||DreamSpun Green Floral Dress with Lace Hem - 4T & 8|,|^|A great summer dress for any young girl, this new design comes from DreamSpun. The yellow empire bodice features a comfortable tank fit. The small ruffle cap sleeves are made in a rich green pattern. The skirt is created with the same large floral print on the rich grass green. The hemline is dressed with a fancy lace ruffle hem. Every bright warm day deserves a fabulous dress! 100% cotton. Made in the USA. Machine wash cold, tumble dry. SIZE 4T AND 8 ONLY LEFT.  ^||,|$29.00$|,||,|DREAMSPUN-GREEN-FLORAL-DRESS-LACE-HEM|,|$URL$dreamspun-green-floral-dress-lace-hem.html|,|http://ep.yimg.com/ay/yhst-17102259411242/dreamspun-green-floral-dress-with-lace-hem-1.jpg||-||DreamSpun Little Girls Necklace in Pastel Rose|,|Designed by DreamSpun, this new little girls necklace is filled with fun. The necklace is made with large, chunky beads. The beads boast of different textures while placed in rainbow order. The clear prism beads reflect the light around her while a few add a touch of sparkle. Pair this fabulous necklace with her favorite new spring and summer outfits! |,|$19.50$|,||,|DREAMSPUN-LITTLE-GIRLS-NECKLACE-PASTEL-ROSE|,|$URL$dreamspun-little-girls-necklace-pastel-rose.html|,|http://ep.yimg.com/ay/yhst-17102259411242/dreamspun-little-girls-necklace-in-pastel-rose-1.jpg||-||DreamSpun Love Letter Halter with Aqua Capri|,|^|DreamSpun is now offering this fabulous summer outfit. The unique halter top boasts of thin shoulder straps and a straight neckline. The empire bodice is a red floral print with a chevron yoke framed with blue rickrack ribbon. The skirt of the top is a warm red boasting of the ""love"" that is scripted near the blue floral hemline. Paired beneath we find light blue leggings. Their classic stretch fit as comfortable as can be while the outer side of both legs is hemmed with a tied knot. 100% Cotton. Machine wash cold. Tumble Dry. Made in the USA. ^||,|$79.00$|,||,|DREAMSPUN-LOVE-LETTER-HALTER-AQUA-CAPRI|,|$URL$dreamspun-love-letter-halter-aqua-capri.html|,|http://ep.yimg.com/ay/yhst-17102259411242/dreamspun-love-letter-halter-with-aqua-capri-17.jpg||-||DreamSpun Rosie Top with Bloomer in Mustard (Size 6)|,|^|New from designer DreamSpun, this fabulous little girls outfit is a true delight. The top boasts of an elastic top hemline that ruffles the neckline and allows a comfortable stretch fit. The sky blue fabric is covered with a pink rose pattern. The dark burgundy spiral rosette is attached off to the right side. The matching rich shoulder straps are thin and tie for a custom fit on her back. The top is paired with bloomer shorts. The golden rod yellow is rich and coordinates with the blue in a unique way. The vintage inspired print covers both legs as they finish with a double ruffle hem with a touch of scallop lace. 100% cotton. Made in the USA. Machine wash cold, tumble dry. SIZE 6 ONLY LEFT.  ^||,|$64.50$|,||,|DREAMSPUN-ROSIE-TOP-BLOOMER-MUSTARD|,|$URL$dreamspun-rosie-top-bloomer-mustard.html|,|http://ep.yimg.com/ay/yhst-17102259411242/dreamspun-rosie-top-with-bloomer-in-mustard-1.jpg||-||DreamSpun Yellow Blossom Hair Clip|,|Fitting with the warm sunshine, this new girls hair accessory from DreamSpun is sure to compliment several of their new arrivals. The rich yellow fabric is layered with elegant tulle. The flower clips into her hair with ease. |,|$10.50$|,||,|DREAMSPUN-YELLOW-BLOSSOM-HAIR-CLIP|,|$URL$dreamspun-yellow-blossom-hair-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/dreamspun-yellow-blossom-hair-clip-1.jpg||-||Elisa B Black Dress with Neon Stripes (Size 7)|,|^|From designer Elisa B, this tween special occasion dress is perfect for most any event. The girls black dress features a sleeveless bodice covered with a sweet blouson overlay that parts slightly on her back. The short skirt is a fitted look which is accented by the trio of neon stripes that wrap the front. Made with a polyblend fabric that allows stretch in its fit. A hidden zipper is found on her left side. Hand wash and line dry. ONLY SIZE 7 LEFT. ^||,|$34.33$|,||,|ELISA-B-BLACK-DRESS-NEON-STRIPES|,|$URL$elisa-b-black-dress-neon-stripes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-black-dress-with-neon-stripes-20.jpg||-||Elisa B Black Tween Dress Lovely Lace (Size 7 & 8)|,|^|Newly arrived from designer Elisa B, this lace tween dress is certain to make her feel beautiful. The dress features a white tank dress lining that is attached at the shoulders.The bodice features a wide neckline and short sleeves made with the dreamy black lace overlay. The waist line is decorated with peachy pink and ivory flowers made from layers of tulle and chiffon. The center of each flower is adorned with sweet pearl beads and sparkling gems. The fabric allows slight stretch in its fit. A hidden zipper runs down the back of the dress a few inches past her waistline.The hemline is wrapped with a wide ribbed ribbon in white. All fabric is 100% polyester, hand wash separately and hang to dry. SIZE 7, 8 & 12 LEFT.  ^||,|$49.00$|,||,|ELISA-B-BLACK-TWEEN-DRESS-LOVELY-LACE|,|$URL$elisa-b-black-tween-dress-lovely-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-black-tween-dress-lovely-lace-22.jpg||-||Elisa B Blue Tween Dress (Size 7 & 8)|,|^|Elisa B has created this fabulous girls dress to accompany her to any special occasion. The wide neckline is framed with gems decorating the straps in alternating white and black sparkle. The straight shape of the dress is accented by the single drape of fabric on the front. A hidden zipper runs up the back. Polyester blend fabric. Hand wash. Hang to dry.SIZE 7 & 8 REMAINING. ^||,|$46.50$|,||,|ELISA-B-BLUE-TWEEN-DRESS|,|$URL$elisa-b-blue-tween-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-blue-tween-dress-20.jpg||-||Elisa B Class Act Dress for Tweens in Black|,|Elisa B brings us this boutique dress for tween girls as a new arrival from their spring line. The little black dress is cut for a more fitted look that is fabulous with leggings or tights paired beneath. The bodice is defined with small mesh cut outs around the straps and at her natural waist. A zipper runs up the back of the dress. The skater style gives it a flowing skirt to complete the look. Polyester/Spandex Blend. Machine wash inside out in cold water. Hand to dry. |,|$79.00$|,||,|ELISA-B-CLASS-ACT-DRESS-TWEENS-BLACK|,|$URL$elisa-b-class-act-dress-tweens-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-class-act-dress-for-tweens-in-black-1.jpg||-||Elisa B Color Block Tween Dress with Animal Print (7)|,|^|A truly wild design, this new tween girls dress comes from the trendy Elisa B line. The black color block shoulders boast of a wide neckline that is flattering while a bright pink runs down the center of the dress. Her sides are dressed with black and white animal print while the knit fabric is comfortable for all day wear. Pairs great with leggings and shrugs! Poly Blend fabric, hand wash only and hang to dry. (1) 7 ONLY LEFT.  ^||,|$24.33$|,||,|ELISA-B-COLOR-BLOCK-TWEEN-DRESS-ANIMAL-PRINT|,|$URL$elisa-b-color-block-tween-dress-animal-print.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-color-block-tween-dress-with-animal-print-38.jpg||-||Elisa B Designer Tween Dress in Magenta|,|^|Elisa B is now offering this fun tween dress as a part of their fall and winter line. The dress features a warm magenta shade with a lighter contrast found on the shoulders. A draping overlay has a hi-low cut and flows with her every movement. The fitted dress beneath is finished in a classic straight hemline. Wear this dress to any party or celebration, it is sure to be envied. Polyester, spandex blend. Machine wash in cold water, inside out. Line Dry. SIZE 7 AND 8 ONLY LEFT.  ^||,|$42.00$|,||,|ELISA-B-DESIGNER-TWEEN-DRESS-MAGENTA|,|$URL$elisa-b-designer-tween-dress-magenta.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-designer-tween-dress-in-magenta-17.jpg||-||Elisa B Fitted Tween Dress Color Block Red (Size 7)|,|^|A fun design by trendy Elisa B, this new fitted tween dress is a beautiful design that will look wonderful on your daughter. The stylish colorblock look covers this dress in red and black while it is cut for a shorter look. A zipper runs up the back of the dress to secure the fit while the sleeveless neckline is framed with round and square studs. Two slits are found where the black shoulder straps meet with the red bodice. 95% Polyester, 5% Spandex. Cold Water. Hand wash, inside out. Line Dry.SIZE 7 ONLY LEFT. ^||,|$48.00$|,||,|ELISA-B-FITTED-TWEEN-DRESS-COLOR-BLOCK-RED|,|$URL$elisa-b-fitted-tween-dress-color-block-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-fitted-tween-dress-color-block-red-1.jpg||-||Elisa B Fitted Tween Dress with Sequins ( 7, 8 & 10 )|,|Whether she is celebrating a holiday or performing in a recital, this new tween dress from Elisa B is both classy and elegant. The dress is covered with a fun geometric print that entices the eye with its never ending lines. Each shape is filled with sequins from white to silver to black. The bodice is sleeveless and the whole dress is cut for that trendy fitted look. Slight shape is cut into the dress at the waist. Pair leggings or tights beneath for a warmer look! 100% polyester. Hand wash cold, line dry. |,|$59.00$|,||,|ELISA-B-FITTED-TWEEN-DRESS-SEQUINS|,|$URL$elisa-b-fitted-tween-dress-sequins.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-fitted-tween-dress-with-sequins-18.jpg||-||Elisa B Floral Dream Girls Dress ( 7, 8 & 10)|,|^|Designed by Elisa B, this tween girls dress will be the talk of the season! The sweet dress features a soft floral print that is placed upon the sheer chiffon overlay. A ""u"" shaped neckline is accented with darling beads and gems. The flowing fit is filled with a free spirit that is evident as she moves and the dress follows gracefully. Pleating on the neckline helps open up the fit as you flow down to the straight hemline. The dress is lined and is closed with a hidden zipper found on the back ^||,|$39.00$|,||,|ELISA-B-FLORAL-DREAM-GIRLS-DRESS|,|$URL$elisa-b-floral-dream-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-floral-dream-girls-dress-15.jpg||-||Elisa B Fluttering Chiffon Tween Party Dress (7 & 8)|,|^|New from the Elisa B collection, this tween dress is sure make a great impression at any party. The dress boasts of a single button keyhole back, double ruffled neckline, and a matching chiffon bow that ties around her waist. From her shoulders down the hem, fluttering ruffles add to the already beautiful movement of this creation. Delicate 100% polyester, hand wash and line dry. SIZE 7 AND 8 LEFT. ^||,|$39.00$|,||,|ELISA-B-FLUTTERING-CHIFFON-TWEEN-PARTY-DRESS|,|$URL$elisa-b-fluttering-chiffon-tween-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-fluttering-chiffon-tween-party-dress-32.jpg||-||Elisa B Girls Dotted Knit Halter Dress (Size 5, 6, 14)|,|Every girl needs a little black dress and this one comes with dots! This girls halter dress comes from Elisa B and it is sure to become a fast favorite. The halter style bodice sits above a full skirt. A zipper is hidden on the left side. A red leather belt with an adorable bow adorns the waist. The dress is lined in black and has a layer of tulle under the skirt to give it a fuller shape. Made from polyester/spandex. Machine wash cold, line dry. |,|$24.33$|,||,|ELISA-B-GIRLS-DOTTED-KNIT-HALTER-DRESS|,|$URL$elisa-b-girls-dotted-knit-halter-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-girls-dotted-knit-halter-dress-48.jpg||-||Elisa B Glo In The Dark Tween Dress (Size 10 & 14)|,|^|A vibrant dress from the tween designer, Elisa B, this party dress is sure to be loved by any young girl. This dress begins with a sleeveless neckline that has a wide, boat neck shape. A neon lace overlay covers the dress with flowers. The hemline drapes with two tiers of ruffles in a sheer tiny dot print. The fit is secured with a hidden zipper that runs up the back. SIZE 10 AND 14 REMAINING.  ^||,|$48.00$|,||,|ELISA-B-GLO-THE--DARK-TWEEN-DRESS|,|$URL$elisa-b-glo-the--dark-tween-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-glo-in-the-dark-tween-dress-16.jpg||-||Elisa B Gold Dust Party Dress for Tweens|,|Designer Elisa B brings us this glittering design that stands out from all other special occasion dresses for tweens. The dress is cut for a fitted look that is accented with the horizontal chevron pattern. The dress is colored with rows and rows of shimmering sequins in white and gold. The neckline is framed with solid white bands near the straps. A straight hemline finishes the look while a hidden zipper finishes the fit. 100% Polyester. Hand wash in cold water. Hang to dry. |,|$76.00$|,||,|ELISA-B-GOLD-DUST-TWEEN-PARTY-DRESS|,|$URL$elisa-b-gold-dust-tween-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-gold-dust-party-dress-for-tweens-1.jpg||-||Elisa B Lace Brights Pink Neon Dress (7, 10 & 14)|,|Competing with the sun's rays, this bright Elisa B dress is available only in tween sizes. The dress boasts of its bold neon orange fabric complimented with a neon pink overlay. The pink fabric is sheer and lacey, with the orange peaking through. The bodice is cut for a more fitted look while the skirt boasts of its flowing fit, dancing around her legs. Close the hidden zipper in the back and she's ready for a fun-filled summer day! 100% polyester. Hand wash only. Line dry. |,|$48.00$|,||,|ELISA-B-LACE-BRIGHTS-PINK-NEON-DRESS|,|$URL$elisa-b-lace-brights-pink-neon-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-lace-brights-pink-neon-dress-20.jpg||-||Elisa B Magenta Checkered Tween Dress|,|^|Unlike any other dress she owns, this new Elisa B dress is in its own class. The fitted shape of the dress is trendy and chic while long sleeves add warmth. The shorter fit of the dress is perfect to pair with leggings for even more warmth. A hidden zipper runs up the back while the soft suede feel of the polyester fabric adds texture. The front is decorated by magenta pleather squares alternating down the front. 100% polyester. Machine washable, hang to dry. ALL SOLD OUT 11/1/14. ^||,|$39.00$|,||,|ELISA-B-MAGENTA-CHECKERED-TWEEN-DRESS|,|$URL$elisa-b-magenta-checkered-tween-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-magenta-checkered-tween-dress-20.jpg||-||Elisa B Miss Sixty Black and White Dress ( 8 & 10 )|,|Bursting with retro inspiration, this new girls dress from Elisa B is one she will love at first sight! The entire piece is covered with a black and white geometric print reminiscent of the sixties. The style is cut for a more fitted look which is created with pin tucks that run down both sides to give shape. The layered hemline ruffles in a sheer black fabric. The classic color combination makes this dress an easy fit for almost any occasion! |,|$34.33$|,||,|ELISA-B-MISS-SIXTY-BLACK-WHITE-DRESS|,|$URL$elisa-b-miss-sixty-black-white-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-miss-sixty-black-and-white-dress-16.jpg||-||Elisa B Neon Pink Girls Lace Dress (Size 12)|,|^|Elisa B has created this new spring dress for tweens just in time for the blooming flowers. The dress is covered with a fun flower texture that is created with the lace overlay. The light pink is one that is easy to accessorize while the sleeveless bodice has a wide neckline and a hidden sipper that closes the back. The hemline is layered with sheer mesh that is covered with tiny dots. (1) SIZE 12 ONLY REMAINING.  ^||,|$48.00$|,||,|ELISA-B-NEON-PINK-GIRLS-LACE-DRESS|,|$URL$elisa-b-neon-pink-girls-lace-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-neon-pink-girls-lace-dress-33.jpg||-||Elisa B Neon Stripe Girls Tween Dress|,|Matching another new creation from Elisa B, this wonderful tween dress is sure to please every fashionista. The sleeveless bodice has a higher neckline made with a bright neon green fabric. The fun stripes blend beautifully down to the sharkbite hemline. The striped fabric is sheer and elegant in drape. Tights or leggings can easily be paired beneath for a warmer outfit. The dress is lined in black. |,|$42.00$|,||,|ELISA-B-NEON-STRIPE-GIRLS-TWEEN-DRESS|,|$URL$elisa-b-neon-stripe-girls-tween-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-neon-stripe-girls-tween-dress-23.jpg||-||Elisa B One Shoulder Tween Party Dress (Size 10)|,|^|Matching a few of the new tween dresses that have arrived for this fall and winter from Elisa B, this special occasion dress is perfect for her unique style. The fitted black dress has a short length and a solid colored fabric. The bodice's sophisticated look comes from the overlay that is completely covered with sequins placed into a geometric print. This overlay falls from the neckline to her waist. One shoulder features a single strap would the other is draped for a flutter look. 100% polyester. Hand wash cold, line dry. SIZE 10 ONLY LEFT.  ^||,|$44.33$|,||,|ELISA-B-ONE-SHOULDER-TWEEN-PARTY-DRESS|,|$URL$elisa-b-one-shoulder-tween-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-one-shoulder-tween-party-dress-20.jpg||-||Elisa B Polka Dot Girls Dress|,|Staying true to her trendy style is what this dotted knit girls dress from Elisa B will do. The bodice is done in a black knit with white dots and boasts of cap sleeves and rouching throughout. The skirt is made from white tulle with an accordion effect. Underneath is a layer of shimmering tulle that gives the skirt a bit of sparkle over the white lining. The dress is belted at the waist with a wide black belt. Made from polyester/spandex. Hand wash cold, line dry. |,|$24.33$|,||,|ELISA-B-POLKA-DOT-GIRLS-DRESS|,|$URL$elisa-b-polka-dot-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-polka-dot-girls-dress-5.jpg||-||Elisa B Royal Cold Shoulder Party Dress|,|Stylish and ready to party, this new tween dress from designer Elisa B is everything she has dreamed of. The fitted blue knit dress features a matching thin belt to wrap around her waist and long sleeves. The bodice boasts of the cold shoulder cutout and a sparkling blue overlay that is more relaxed in fit. 100% polyester, hand wash and hang to dry. |,|$49.00$|,||,|ELISA-B-ROYAL-COLD-SHOULDER-PARTY-DRESS|,|$URL$elisa-b-royal-cold-shoulder-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-royal-cold-shoulder-party-dress-18.jpg||-||Elisa B Sequin Party Dress in Black (Size 7 & 8)|,|^|Hot in trend, this special occasion tween dress comes from designer Elisa B. The dress features a sleeveless bodice and a waist defined only by the fitted shape. A zipper runs up the back to ensure a close fit. The center of the front is striped with silver and chrome sequins. The shorter style of the dress looks great alone but also with tights or leggings. 100% polyester. Hand wash cold, line dry. SIZE 7 AND 8 ONLY LEFT.  ^||,|$39.00$|,||,|ELISA-B-SEQUIN-PARTY-DRESS-BLACK|,|$URL$elisa-b-sequin-party-dress-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-sequin-party-dress-in-black-20.jpg||-||Elisa B Sequin Sunshine Pink Girls Dress (Size 8) |,|^|Sophisticated and in pretty pink, this dress was created from Elisa B straight from her dreams. The bodice has a relaxed blouson fit that gathers at her waist. The sleeveless neckline is dressed in large gems. A hidden zipper is found on the back of the bodice. The skirt has a short cut and is dressed in sparkling pink sequins. (1) SIZE 8 ONLY LEFT.  ^||,|$44.25$|,||,|ELISA-B-SEQUIN-SUNSHINE-PINK-GIRLS-DRESS|,|$URL$elisa-b-sequin-sunshine-pink-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-sequin-sunshine-pink-girls-dress-17.jpg||-||Elisa B Sparkle Stripes Girls Dress (Size 8)|,|^|By designer Elisa B, this cute tween dress is a real firework! The fitted dress accents her waist and features a hidden zipper that closes the back. The wide, sleeveless neckline is a unique style with its thin, wide keyhole. The sides of the dress are a solid blue while the center of the front and the back are striped in white and royal blue sequins. Created with a polyester blend. Hand wash and hang to dry. TWO SIZE 8 REMAINING. ^||,|$49.00$|,||,|ELISA-B-SPARKLE-STRIPES-GIRLS-DRESS|,|$URL$elisa-b-sparkle-stripes-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-sparkle-stripes-girls-dress-36.jpg||-||Elisa B Spring Green Sequin Tween Dress (8, 12 & 14)|,|^|Unique in every way, this new designer girls dress is part of Elisa B's ""Peral Sequins"" collection for the spring. The unique coloration of the dress is earthy and rich. The sparkling sequins rain down slowly fading to a new shade creating a unique stripe. The back of the dress is closed with a zipper. Two chiffon ruffles run around the hemline with a fun frenzy. The shaping tucks that run down the front assist with a more fitted cut. ^||,|$48.00$|,||,|ELISA-B-SPRING-GREEN-SEQUIN-TWEEN-DRESS|,|$URL$elisa-b-spring-green-sequin-tween-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-spring-green-sequin-tween-dress-15.jpg||-||Elisa B Super Stripes Tween Maxi Dress (Size 7 & 8)|,|^|This long summer dress was designed by trendy tween designer Elisa B. The bold stripes are filled with rays of color that create a bright blend. The bodice offers a sleeveless neckline and blouson fit. The matching skirt falls with a vertical accordion texture. The hemline is high and low to compliment her legs and is right on trend. SIZE 7 AND 8 AVAILABLE ONLY. ^||,|$48.00$|,||,|ELISA-B-SUPER-STRIPES-TWEEN-MAXI-DRESS|,|$URL$elisa-b-super-stripes-tween-maxi-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-super-stripes-tween-maxi-dress-15.jpg||-||Elisa B Turquoise Tween Party Dress (Size 8)|,|^|Becoming the instant envy of all her friends, this new Elisa B dress is available selectively in tween sizes. The cool turquoise green shines out amongst all of the other dresses this fall and speaks to her individual style. The shape of the dress is created for a fitted and trendy look but also works well for her fall layers. The long black sleeves shimmer in the light as she moves because of their fun sequins. The pull over fit is easy and quick. Hand wash dress with care, polyester blend. SIZE 8 ONLY LEFT.  ^||,|$24.33$|,||,|ELISA-B-TURQUOISE-TWEEN-PARTY-DRESS|,|$URL$elisa-b-turquoise-tween-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-turquoise-tween-party-dress-30.jpg||-||Elisa B Tween Casual Dress Black and White (7, 8 & 14)|,|A modern dress for your fashionable tween, this new arrival comes from designer Elisa B. The bodice is made with a light weight fabric that is cut for a fitted look and allows slight stretch. The front is covered with a pinwheel design in black and white. The skirt opens in shape and twirls around her legs as she flutters about the party. The V shaped neckline is framed by the wide straps. |,|$49.00$|,||,|ELISA-B-TWEEN-CASUAL-DRESS-BLACK-WHITE|,|$URL$elisa-b-tween-casual-dress-black-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-tween-casual-dress-black-and-white-16.jpg||-||Elisa B Tween Cocktail Dress Gold Sequins|,|A glittering design that stands out from all other special occasion dresses for tweens, this piece comes from Elisa B. The dress is cut for a fitted look that is accented with the horizontal stripes. The dress is colored with rows and rows of shimmering sequins in white and gold. The neckline is framed with solid white shoulder straps. A straight hemline finishes the look while a hidden zipper finishes the fit. 100% Polyester. Hand wash inside out in cold water. Hang to dry. |,|$59.25$|,||,|ELISA-B-TWEEN-COCKTAIL-DRESS-GOLD-SEQUINS|,|$URL$elisa-b-tween-cocktail-dress-gold-sequins.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-tween-cocktail-dress-gold-sequins-1.jpg||-||Elisa B Tween Color Block Dress (Size 7 & 8)|,|^|Orange accents this tween dress from Elisa B. The sleeveless neckline in orange tops this fuchsia pink fitted dress. An orange band accents the hemline. The back is zippered. Polyester blend. Hand wash, line dry. SIZE 7 AND 8 ONLY LEFT. ^||,|$29.00$|,||,|ELISA-B-TWEEN-COLOR-BLOCK-DRESS|,|$URL$elisa-b-tween-color-block-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-tween-color-block-dress-32.jpg||-||Elisa B Tween Dress (Size 7)|,|^|A unique design that is absolutely lovely, this new designer dress for tweens was created by the trendy Elisa B line. The fitted look of the bodice is secured by the hidden zipper that runs up the back while the neckline is cut for a wide shape. The short sleeves are textured with rows of pin tucks. The waistline is subtly accented while the skirt is a classic pencil shape. The sides of the skirt are striped with matching tucks in the fabric while a cute, single ruffle decorates the hemline. Created from a polyester blend fabric. Hand wash and line dry. ONLY (1) SIZE 7 REMAINING. ^||,|$48.00$|,||,|ELISA-B-TWEEN-DRESS|,|$URL$elisa-b-tween-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-tween-dress-20.jpg||-||Elisa B Tween Dress in Coral (Size 7)|,|^|A dreamy design in a hot color, this new dress from trendy tween designer Elisa B is a beautiful creation. The coral pink is a warm tone that compliments her sunkissed skin. The neckline is framed by thin shoulder straps. A small ""V"" of gems falls down the front to accent the layers of matching, wide ruffles that drape gracefully. Made with a polyester blend. Hand wash this dress and line dry. SIZE 7 ONLY REMAINING. ^||,|$39.00$|,||,|ELISA-B-TWEEN-DRESS-CORAL|,|$URL$elisa-b-tween-dress-coral.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-tween-dress-in-coral-20.jpg||-||Elisa B Tween Dress Textured Purple|,|Fashioned by a team of designers at Elisa B, this boutique dress for tween girls is a new arrival from their fall and winter line. The dress is a fun purple and is cut for a more fitted look that is fabulous with leggings paired beneath. The bodice is defined with black pleather trim that also runs around the sleeveless neckline. A zipper runs up the back of the dress. The fabric features a unique texture that completes the look and style. Polyester, Spandex blend. Machine wash in cold water, inside out. Line Dry. |,|$49.50$|,||,|ELISA-B-SHORT-TWEEN-DRESS-TEXTURED-PURPLE|,|$URL$elisa-b-short-tween-dress-textured-purple.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-tween-dress-textured-purple-43.jpg||-||Elisa B Tween Fitted Dress Peekaboo Pink|,|A fun design by Elisa B, this new fitted tween dress is a beautiful design that will look wonderful on your daughter. The stylish organic pattern covers this dress in black, purple and pink while it is cut for a shorter look. A zipper runs up the back of the dress to secure the fit while the sleeveless style is framed with round studs. She'll love this new spring style for any occasion! 100% Polyester. Hand wash inside out in cold water. Hang to dry. |,|$86.00$|,||,|ELISA-B-TWEEN-FITTED-DRESS-PEEKABOO-PINK|,|$URL$elisa-b-tween-fitted-dress-peekaboo-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-tween-fitted-dress-peekaboo-pink-1.jpg||-||Elisa B Tween Holiday Dress in White and Gold Lace|,|Beautiful and sweet, this new tween holiday dress comes from Elisa B. The dress creates a beautiful blend of white and gold. A small V slit accents the wide neckline trimmed with gold. The relaxed fit is a perfect match for this flowing fabric that boasts of its graceful movement. The lace look is the perfect texture to add to this piece. Whether she is celebrating a holiday or a wedding, this dress is the perfect choice! 100% Polyester. Machine Wash Inside Out in Cold Water. Line Dry. |,|$59.25$|,||,|ELISA-B-TWEEN-HOLIDAY-DRESS-WHITE-GOLD-LACE|,|$URL$elisa-b-tween-holiday-dress-white-gold-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-tween-holiday-dress-in-white-and-gold-lace-1.jpg||-||Elisa B Tween Party Dress Blue Leopard|,|A draping sheath dress, this gorgeous design is from tween brand Elisa B. The dress falls like an elegant waterfall from the silver slit neckline. The sophisticated chiffon fabric has beautiful movement as she walks about. The dress is colored with a bright pattern that blends animal print with floral for a truly exotic look. 100% Polyester. Hand wash inside out in cold water. Hang to dry. |,|$49.50$|,||,|ELISA-B-TWEEN-PARTY-DRESS-BLUE-LEOPARD|,|$URL$elisa-b-tween-party-dress-blue-leopard.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-tween-party-dress-blue-leopard-1.jpg||-||Elisa B Tween Party Dress in Magenta (7, 8, & 10)|,|Designed by Elisa B, the sister brand of Lipstik Girls, this new tween party dress is sure to excite your darling daughter's fashion palette. The sleeveless bodice has a fitted feel while the blouson overlay flows with her every movement and features a slit down the back of the bodice. The short skirt is fitted as well and embellished by the wrapped design and sublte pink gems. Polyblend fabric. Hand wash and hang to dry. |,|$48.00$|,||,|ELISA-B-TWEEN-PARTY-DRESS-MAGENTA|,|$URL$elisa-b-tween-party-dress-magenta.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-tween-party-dress-in-magenta-16.jpg||-||Elisa B Tween Party Dress Sequin Bubbles (Size 7)|,|^|For the dazzling tween with great style, this new party dress comes from designer Lipstik Girls line, Elisa B. The straight shape of the dress compliments its shorter length and sleeveless fit while sequin design brings all the fun. The mesh overlay is covered in black and white sequins creating a bubbling look that shimmers with her movement. 100% polyester, hand wash with care. SIZE 7 LEFT. ^||,|$34.33$|,||,|ELISA-B-TWEEN-PARTY-DRESS-SEQUIN-BUBBLES|,|$URL$elisa-b-tween-party-dress-sequin-bubbles.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-tween-party-dress-sequin-bubbles-32.jpg||-||Elisa B Tween Sequin Dress for Parties Black|,|Sparkling fun, this fabulous creation is from designer Elisa B. The tween dress features a fitted empire waist bodice fastened by a hidden zipper. A native design is made completely by fun, shimmering sequins. The skirt is created with layers of black tulle that fall down to an even hemline. This dress is perfect for any special occasion this fall or winter. 100% Polyester. Cold water, hand wash inside out. Line Dry. |,|$59.00$|,||,|ELISA-B-TWEEN-SEQUIN-DRESS-PARTIES-BLACK|,|$URL$elisa-b-tween-sequin-dress-parties-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-tween-sequin-dress-for-parties-black-1.jpg||-||Elisa B Tween Sheath Dress Sequin Snake|,|^|Equipping her with style for her next party, Elisa B created this new tween dress to satisfy her taste for fashion. The sleeveless dress is covered n colored sequins creating the illusion and pattern of dazzling snake skin. An invisible side zipper is found under her left arm. Lined in black, 100% polyester, hand wash with care. ALL SOLD OUT 5/29/14.  ^||,|$39.00$|,||,|ELISA-B-TWEEN-SHEATH-DRESS-SEQUIN-SNAKE|,|$URL$elisa-b-tween-sheath-dress-sequin-snake.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-tween-sheath-dress-sequin-snake-17.jpg||-||Elisa B Tween Special Occasion Dress Black|,|A unique look that her friends will envy, this new designer tween dress was created with love by Elisa B. The dress features a sleeveless, wide neckline framed in gold pleather. A zipper is fastened to close the fit. The blouson look of the bodice is created by an overlay of black fabric while the waist is defined by the introduction of a more fitted look for the skirt. A fun plaid pattern is fashioned form glittering sequins, bringing a subtle London feel to this look. Polyester/Spandex. Hand wash inside out in cold water. Hang to dry. |,|$55.50$|,||,|ELISA-B-TWEEN-SPECIAL-OCCASION-DRESS-BLACK|,|$URL$elisa-b-tween-special-occasion-dress-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-tween-special-occasion-dress-black-1.jpg||-||Elisa B White Tween Party Dress|,|Inspired from a flapper style, this tween dress was designed by fabulous Elisa B. The scoop neckline has wide shoulder straps for a sleeveless look that is perfectly easy to layer if needed. The body of the dress is covered with swooping waves made from white sequins. The style features a more fitted look while the hemline is dancing with layers of sheer ruffles. This dress is a great choice for family photos, celebrations, or pageants! |,|$49.50$|,||,|ELISA-B-IVORY-LIGHTS-TWEEN-PARTY-DRESS|,|$URL$elisa-b-ivory-lights-tween-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-white-tween-party-dress-9.jpg||-||Enchanted Shimmer Amirah Girls Tie Back Headband|,|A new arrival from Enchanted Shimmer, this accessory looks fabulous on all ages. The band boasts of a dainty string of square gems that run across her forehead on the front with a cute dangling center. The velvet grey ends are tied to her individual fit at the back of the head. Make a statement no one will forget! |,|$39.00$|,||,|ENCHANTED-SHIMMER-AMIRAH-GIRLS-TIE-BACK-HEADBAND|,|$URL$enchanted-shimmer-amirah-girls-tie-back-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-amirah-girls-tie-back-headband-1.jpg||-||Enchanted Shimmer Aurora Newborn Crown|,|^|A step beyond extraordinary, this fabulous newborn crown comes from designer Enchanted Shimmer. The tall crown peaks at the front with a circle of gems that sparkle along with all the others that create this gorgeous design. Clear prism beads are found in the center shaped as flowers. Designed to make her photo debut unforgettable! SOLD OUT ALL 3/4/14  ^||,|$54.00$|,||,|ENCHANTED-SHIMMER-AURORA-NEWBORN-CROWN|,|$URL$enchanted-shimmer-aurora-newborn-crown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-aurora-newborn-crown-1.jpg||-||Enchanted Shimmer Girls Flower Headband in Marie|,|An exact match to a soft head piece, this hard headband comes from Enchanted Shimmer. The ivory flower is layered with lace and features a sparkling center that is almost hid like a pearl. Tall feather boast of their cool purple and blue shades that make them stand out. All of this is attached off to one side of a thin hard headband wrapped with ivory satin. |,|$29.00$|,||,|ENCHANTED-SHIMMER-GIRLS-FLOWER-HEADBAND-MARIE|,|$URL$enchanted-shimmer-girls-flower-headband-marie.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-girls-flower-headband-in-marie-1.jpg||-||Enchanted Shimmer Girls Headband Bella Feather|,|Living up to the name, this fabulous girls head piece from Enchanted Shimmer truly is beautiful. The white ruffles stretch around her head with an elastic band that is truly comfortable. The sweet pink flower is layered with natural colored lace while two loops of gems dangle and catch the light. A sweet white boa feather pokes out from beneath along with two polka dot flowers. Make a statement with this piece in her first photographs or at any event. |,|$29.00$|,||,|ENCHANTED-SHIMMER-GIRLS-HEAD-PIECE-BELLA-FEATHER|,|$URL$enchanted-shimmer-girls-head-piece-bella-feather.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-girls-headband-bella-feather-1.jpg||-||Enchanted Shimmer Girls Ruffle Band in Pearl Shimmer|,|^|New from Enchanted Shimmer, this fabulous headband adds the perfect elegance to her outfit! The elastic band boasts of a sheer white ruffle finished with small scallop edges. The front of this accessory is adorned by pearl accents placed among sparkling gems! Perfect for newborn photo shoots and special events! (1) NEWBORN REMAINING.  ^||,|$29.00$|,||,|ENCHANTED-SHIMMER-GIRLS-RUFFLE-BAND-PEARL-SHIMMER|,|$URL$enchanted-shimmer-girls-ruffle-band-pearl-shimmer.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-girls-ruffle-band-in-pearl-shimmer-1.jpg||-||Enchanted Shimmer Girls Tie Back Band in Raindrop Jewels|,|Filled with a vintage inspiration, this new girls accessory from Enchanted Shimmer adds a touch of glamour and elegance to her outfit or photo! The gem front of this headband boasts of a row of gems that run straight across and are accented with dangling raindrops. A velvet ribbon is tied in the back for an individual fit. This band changes colors based upon the size that you order. |,|$42.00$|,||,|ENCHANTED-SHIMMER-GIRLS-TIE-BACK-BAND-RAINDROP-JEWELS|,|$URL$enchanted-shimmer-girls-tie-back-band-raindrop-jewels.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-girls-tie-back-band-in-raindrop-jewels-1.jpg||-||Enchanted Shimmer Girls Vintage Rose Headband|,|Darling in design, this Enchanted Shimmer headband will make your daughter feel like the vintage princess she is! The thin hard headband is covered in ivory satin for a timeless look. The beige flower sits off to one side accented with a ruffle of coral lace and gorgeous tall plumes. The gem center is filled with the vintage inspiration that we all know and love! |,|$49.00$|,||,|ENCHANTED-SHIMMER-GIRLS-VINTAGE-ROSE-HEADBAND|,|$URL$enchanted-shimmer-girls-vintage-rose-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-girls-vintage-rose-headband-12.jpg||-||Enchanted Shimmer Grace Fabulous Girls Headband|,|Shining her way to the top, this new head piece comes from the glorious Enchanted Shimmer designers. The sweet pink flower is accented with lace in a natural tone while a sparkling gem center speaks to its vintage inspiration. The green and grey feathers add a truly luxurious feel. The elastic band stretches around her head for a comfortable fit while dress with white ruffles |,|$29.00$|,||,|ENCHANTED-SHIMMER-GRACE-FABULOUS-GIRLS-HEAD-PIECE|,|$URL$enchanted-shimmer-grace-fabulous-girls-head-piece.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-grace-fabulous-girls-headband-1.jpg||-||Enchanted Shimmer Infant Romper in Nude|,|An inspired design, this baby girls romper from designer Enchanted Shimmer is perfect for photographs! The romper is created in a nude tone that is a high trend for the season. Tulle ruffles wrap around in lines to add a splendid texture. Fully lined, this fabric stretches to fit. The strapless top is secured with an elastic band. A removable flower clip is found off centered near the top. This flower is layered in ivory tulle and chiffon while featuring dazzling gem accents and a touch of coral lace underneath. Fun, whimsical plumes fan out at the top. Proudly made in the USA. 100% polyester. Machine wash delicate and line dry. |,|$49.00$|,||,|ENCHANTED-SHIMMER-INFANT-ROMPER-NUDE|,|$URL$enchanted-shimmer-infant-romper-nude.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-infant-romper-in-nude-12.jpg||-||Enchanted Shimmer Juliet Girls Headband|,|This fabulous accessory comes from Enchanted Shimmer Designs. Created for the girl with a style that is beyond glamorous, this tie back features a shimmering gem front that goes all out! The jewels catch every ray of light, creating their dazzling look. The soft velvet ribbon ties offer a one of a kind fit when secured at the back of her head. These ties change color for all three sizes. |,|$42.00$|,||,|ENCHANTED-SHIMMER-JULIET-GIRLS-HEADBAND|,|$URL$enchanted-shimmer-juliet-girls-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-juliet-girls-headband-1.jpg||-||Enchanted Shimmer Marie Floral Headband for Girls|,|Designed by Enchanted Shimmer, this girls head piece makes an elegant appearance. The ruffle white band stretches with its elastic to fit comfortable on her head. The sweet natural tone flower blooms from the center almost hiding its sparkling gems. Royal plumes are proud in their shades of purple and blue to finish off this look. |,|$29.00$|,||,|ENCHANTED-SHIMMER-MARIE-FLORAL-HEAD-PIECE-GIRLS|,|$URL$enchanted-shimmer-marie-floral-head-piece-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-marie-floral-headband-for-girls-1.jpg||-||Enchanted Shimmer Petals Gem Girls Tie Back|,|^|Elegant and unique, this Enchanted Shimmer accessory is sure to not last long! The jewel design found in the front is shaped like a chain of flowers, perfect for the girly girl. A velvet tie secures the fit at the back of her head and changes its color for each size. NEWBORN ONLY LEFT.  ^||,|$38.00$|,||,|ENCHANTED-SHIMMER-PETALS-GEM-GIRLS-TIE-BACK|,|$URL$enchanted-shimmer-petals-gem-girls-tie-back.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-petals-gem-girls-tie-back-1.jpg||-||Enchanted Shimmer Princess Tie Back for Girls|,|Making a statement about your style, this shimmering hair accessory comes from Enchanted Shimmer. The jewel front falls into dangles with a large round gem at the bottom. A velvet tie changes colors based upon the size ordered and creates an individual fit when tied at the back of her head. Available for all ages to make the perfect mother and daughter photo props! |,|$42.00$|,||,|ENCHANTED-SHIMMER-PRINCESS-TIE-BACK-GIRLS|,|$URL$enchanted-shimmer-princess-tie-back-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-princess-tie-back-for-girls-1.jpg||-||Enchanted Shimmer Rosebud Girls Hair Accessory|,|This new design was created by the fabulous Enchanted Shimmer. The band features a sparkling gem front that boasts of sparkling jewels shaped into a row of flowers. A soft ribbon ties at the back and changes color depending upon the size ordered! Perfect for photos, pageants, recitals, and holidays! |,|$38.00$|,||,|ENCHANTED-SHIMMER-ROSEBUD-GIRLS-HAIR-ACCESSORY|,|$URL$enchanted-shimmer-rosebud-girls-hair-accessory.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-rosebud-girls-hair-accessory-17.jpg||-||Enchanted Shimmer Ruby Ruffle Headband for Girls|,|Sure to be a big hit for the winter season, this new girls headband comes from Enchanted Shimmer. The band boasts of a front dazzling with red and silver gems that catch the light to gleam with her every step. This accessory stretches to fit around her head and is meant to be worn across the forehead. The sheer white fabric is ruffled all the way around and a small scallop pattern creates the edge. |,|$29.00$|,||,|ENCHANTED-SHIMMER-RUBY-RUFFLE-HEADBAND-GIRLS|,|$URL$enchanted-shimmer-ruby-ruffle-headband-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-ruby-ruffle-headband-for-girls-1.jpg||-||Enchanted Shimmer Sparkling Dainty Girls Headband|,|Gracing her forehead with elegance and love, this dazzling accessory comes from Enchanted Shimmer. This headband features a gem front in a chevron stripe accented with large round gems to make it truly unique. The color of the ends are different for all three sizes but are created with soft velvet ribbon no matter the shade. Tie these ribbons at the back of the head for a truly individual fit. |,|$38.00$|,||,|ENCHANTED-SHIMMER-SPARKLING-DAINTY-GIRLS-HEADBAND|,|$URL$enchanted-shimmer-sparkling-dainty-girls-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-sparkling-dainty-girls-headband-1.jpg||-||Enchanted Shimmer Tie Back Band in Jasmine Gems|,|A creation that stands out from the rest, this new girls accessory comes from Enchanted Shimmer. The unique piece boasts of its tie back style, allowing a custom fit for everyone! The front is covered with gems that run across her forehead with a dangling pattern. The velvet ribbon tie will change its color based upon size. Looks brilliant in a newborn's photo debut, your princess's recital, or even with your favorite dress! |,|$38.00$|,||,|ENCHANTED-SHIMMER-TIE-BACK-BAND-JASMINE-GEM|,|$URL$enchanted-shimmer-tie-back-band-jasmine-gem.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-tie-back-band-in-jasmine-gems-1.jpg||-||Enchanted Shimmer Waverly Tie Back Band for Girls|,|^|Unlike any other accessory she has, this fabulous tie back band comes from Enchanted Shimmer. The sparkling accessory boasts of four rows of small jewels that are shaped in an elegant and dainty wave. A soft velvet ribbon tie creates an individual fit for all who wear them. This tie changes color depending on which size you order. ADULT ONLY LEFT.  ^||,|$38.00$|,||,|ENCHANTED-SHIMMER-WAVERLY-TIE-BACK-BAND-GIRLS|,|$URL$enchanted-shimmer-waverly-tie-back-band-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-waverly-tie-back-band-for-girls-1.jpg||-||Faith Knight Pencil Bag for Girls in Pink Zebra|,|Decorated with sparkling pink jewels, this new girls pencil bag will stir up the classroom. The soft outer shell features a pink zebra print while the single compartment inside is perfect for holding all her pencils, pens, and markers for the school year! Made to match other Faith Knight items. |,|$9.00$|,||,|FAITH-KNIGHT-PENCIL-BAG-PINK-ZEBRA|,|$URL$faith-knight-pencil-bag-pink-zebra.html|,|http://ep.yimg.com/ay/yhst-17102259411242/faith-knight-pencil-bag-for-girls-in-pink-zebra-13.jpg||-||Faith Knight Sweet Flower Pencil Bag for Girls|,|With a soft, light cream outer shell, this new girls pencil bag from Faith Knight is the perfect school accessory. The lime and pink flower print is slightly raised, while the top features an easy use full length zipper. The inside boasts of plenty of room for all of her pencils and markers. Matches a backpack and lunch box. |,|$9.00$|,||,|FAITH-KNIGHT-FLOWER-PENCIL-BAG-GIRLS|,|$URL$faith-knight-flower-pencil-bag-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/faith-knight-sweet-flower-pencil-bag-for-girls-13.jpg||-||Faith Knight Wild Zebra Girls Pencil Bag|,|The final piece to her wild zebra set, this new girls pencil bag is too adorable! The soft zebra print is adorned with a single pink sequin heart and boa feathers. A full length top zipper opens up to a single compartment perfect for all her school utensils! |,|$9.00$|,||,|FAITH-KNIGHT-WILD-ZEBRA-PENCIL-BAG|,|$URL$faith-knight-wild-zebra-pencil-bag.html|,|http://ep.yimg.com/ay/yhst-17102259411242/faith-knight-wild-zebra-girls-pencil-bag-13.jpg||-||Fall Blossom Fancy Headband for Girls|,|^|Welcoming the fall season in with bright color, this new designer headband was handmade to match the Giggle Moon fall collection ""Fall Blossom."" The soft black lace features subtle scalloped edges and the perfect amount of stretch to fit around her head. The flower builds upon a bed of satin lime petals, contrasting with a beautiful coral pink. The center of the flower is a shimmering jewel while a sheer brown flower sits off to the side. All flowers are finished with heat treated edges. SIZE MD (2T-4T) LEFT.  ^||,|$14.00$|,||,|FALL-BLOSSOM-FANCY-HEADBAND-GIRLS|,|$URL$fall-blossom-fancy-headband-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/fall-blossom-fancy-headband-for-girls-3.jpg||-||Fancy Girls Headband Matching Giggle Moon Happy and Joyful|,|^|Handmade to go with her fabulous new Giggle Moon outfits, this new boutique headband is ready for any occasion. The bright fuchsia band stretches with its elastic and is adorned by a cute ruffle. Three large flowers create a sweet garden with mixed textures. The black lace flower is adorned by a gem center while the two pink flowers are placed on a bed of black boa feathers. LARGE (4-ADULT) ONLY LEFT.  ^||,|$27.00$|,||,|FANCY-GIRLS-HEADBAND-MATCHING-GIGGLE-MOON-HAPPY-JOYFUL|,|$URL$fancy-girls-headband-matching-giggle-moon-happy-joyful.html|,|http://ep.yimg.com/ay/yhst-17102259411242/fancy-girls-headband-matching-giggle-moon-happy-and-joyful-3.jpg||-||Five Loaves Two Fish Soloist Tween Dress Black and White (Size 10)|,|^|An adorable new arrival from designer Five Loaves Two Fish, this tween dress can easily accompany her to any event! The bodice offers her long sleeves and a solid black that looks great paired with almost any color of accessories. The waist is accented by a sash that ties in bow on her back. The striped skirt falls in a classic A line and features a bold mix between white and black. Made in the USA. Bodice: cotton-jersey knit, allow for some stretch. Skirt: 100% cotton. Wash on cold, inside out. Line dry or tumble dry on low heat. SIZE 10 ONLY REMAINING.  ^||,|$39.00$|,||,|FIVE-LOAVES-TWO-FISH-SOLOIST-TWEEN-DRESS-BLACK-WHITE|,|$URL$five-loaves-two-fish-soloist-tween-dress-black-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/five-loaves-two-fish-soloist-tween-dress-black-and-white-2.jpg||-||Flower Girls Headband in Ivory and White|,|An elegant beauty, this new fabulous girls headband is the ideal wedding accessory for your flower girl! The headband features a garden of fabric flowers with a few small touches of pearl bead decorations. The blooms are placed upon an ivory crochet lace bed accented with white wispy threads. The stretch lace is soft and comfortable upon her head. The crowning achievement of this accessory is this fabulous ivory and white color scheme that makes this headband easy to match with her dress while filled with timeless elegance! |,|$29.00$|,||,|FLOWER-GIRLS-HEADBAND-IVORY-WHITE|,|$URL$flower-girls-headband-ivory-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flower-girls-headband-in-ivory-and-white-1.jpg||-||Flowers By Zoe 86 Tween Top|,|^|A new top from Flowers By Zoe, this shirt comes from their spring and summer collection filled with a super hero comic print. The front of the top resembles a sports jersey. The large 86 found on the front is accented with the double stripes found on the short sleeves. The back of the top is filled with bold lines, words, and colors has it takes on a true comic book feel. The shirt has a slight high low hemline. Created with rayon or rayon blend fabrics. Hand wash with care and line dry. Flowers By Zoe runs small. Please order one size up. ^||,|$28.50$|,||,|FLOWERS-BY-ZOE-86-TWEEN-TOP|,|$URL$flowers-by-zoe-86-tween-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-86-tween-top-1.jpg||-||Flowers By Zoe American Flag Girls Tank Top (SM 7/8)|,|^|Filled with patriotic spirit, this new designer girls tank comes from Flowers By Zoe. The top boasts of a black front and a solid white back. The distressed screen print that covers the front is a classic American flag. Small touches of gems accent the piece as they sparkle in the light. The jewel cut neckline is framed with wide shoulders while the shirt is finished with a trendy hi-low hemline. Created with rayon or rayon blend fabrics. Hand wash with care and line dry. Flowers By Zoe runs small. Please order one size up. (1) SMALL (7/8) REMAINING.  ^||,|$29.00$|,||,|FLOWERS-BY-ZOE-AMERICAN-FLAG-GIRLS-TANK-TOP|,|$URL$flowers-by-zoe-american-flag-girls-tank-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-american-flag-girls-tank-top-1.jpg||-||Flowers By Zoe Animal Print Chiffon Tween Top with Pant|,|^|A truly unique look, this new tween outfit is from Flowers By Zoe. The sheer chiffon top boasts of its fun animal print, and open lace back. The long sleeves feature elastic at the cuffs to create a slight bubble. Paired with velour pants in a hazy grey, offering back pockets, belt loops, and an elastic waist. Hand wash both pieces and hang to dry. Flowers by Zoe runs small, please consider ordering one size up.  ^||,|$49.00$|,||,|FLOWERS-BY-ZOE-ANIMAL-PRINT-CHIFFON-TWEEN-TOP-PANT|,|$URL$flowers-by-zoe-animal-print-chiffon-tween-top-pant.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-animal-print-chiffon-tween-top-with-pant-11.jpg||-||Flowers by Zoe Aztec Top with Peace Sign Cutout Back (Size SM 7/8)|,|^|This fun new top for tweens has just arrived from Flowers By Zoe and is simply perfect for summer! The sleeveless tank is covered with a black aztec print. The white background is clouded with purples and yellows. The back features a cool peace sign cut out that is unlike anything else she has. The high low hemline makes this top easy to pair with fitted skinnies or sweet denim shorts. 100% rayon. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. (2) SIZE SMALL (7/8) ONLY LEFT.  ^||,|$19.33$|,||,|FLOWERS-BY-ZOE-AZTEC-TOP-PEACE-SIGN-CUTOUT-BACK|,|$URL$flowers-by-zoe-aztec-top-peace-sign-cutout-back.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-aztec-top-with-peace-sign-cutout-back-1.jpg||-||Flowers by Zoe Black Dress with Jewelled Accents|,|^|Ready for almost any occasion, this new Flowers By Zoe tween dress is unique and stylish. The black dress features a high low hemline hitting above her knee. A draw string waist adds shape to the dress and allows for a custom fit. The v neckline is sleeveless while the shoulders are lined with colorful, large gems. Pair easliy with leggings! Made with rayon blend. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. ^||,|$39.00$|,||,|FLOWERS-BY-ZOE-BLACK-DRESS-JEWELLED-ACCENTS|,|$URL$flowers-by-zoe-black-dress-jewelled-accents.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-black-dress-with-jewelled-accents-1.jpg||-||Flowers By Zoe Blue Party Dress for Tweens PREORDER|,|^|A cute look for any summer occasion, this tween dress comes to us from Flowers By Zoe. The bold cobalt blue color looks great on any skin tone and keeps her on trend with the big girls. The fun, criss cross strappy style sets this dress apart from the rest. Her waist in cinched to give it more shape as the flowy, two tier skirt is perfect for twirling. Flowers By Zoe runs small. Please order one size up. Please note that this is a PreOrder item and is NOT currently in stock. This Flowers by Zoe item is expected to arrive the week of February 2, 2015. ^||,|$74.00$|,||,|FLOWERS-BY-ZOE-BLUE-PARTY-DRESS-TWEENS|,|$URL$flowers-by-zoe-blue-party-dress-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-blue-party-dress-for-tweens-preorder-5.jpg||-||Flowers by Zoe Camp Top in Purple (Size SM 7/8)|,|^|Will she be heading off to camp this summer? This fun new designer top from Flowers By Zoe is sure to send her off in style! The lavender shade has a sweet, calming look while the back flutters from cute drape of fabric. The front is completed devoted to the large screen print that spells ""camp."" A rainbow heart replaces the ""a."" Made with soft, comfortable rayon. Hand wash cold water, line dry. Flowers By Zoe runs small. Please order one size up. ONE SMALL (7/8) ONLY LEFT. ^||,|$19.00$|,||,|FLOWERS-BY-ZOE-CAMP-TOP-PURPLE|,|$URL$flowers-by-zoe-camp-top-purple.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-camp-top-in-purple-1.jpg||-||Flowers by Zoe Capri Set with Smiley Faces (Size MD 10 & LG 10/12)|,|^|A cute new creation from designer Flowers By Zoe, this tween outfit is a blend of old and new. The tank top offers a hi-low, sharkbite hemline. Retro inspiration creeps in with the rainbow daisy crown that is found on the large smiley face. The back of the top is covered with a smiley white print. The matching leggings are worn beneath and are cut for a capri fit. Top: 100% rayon. Leggings: Made with rayon blend. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. MEDIUM (10) AND LARGE (10/12) ONLY AVAILABLE.  ^||,|$59.00$|,||,|FLOWERS-BY-ZOE-CAPRI-SET-SMILEY-FACES|,|$URL$flowers-by-zoe-capri-set-smiley-faces.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-capri-set-with-smiley-faces-1.jpg||-||Flowers by Zoe Cat Tank Top in Grey (SM 7/8 & LG 10/12)|,|^|Hitting on a hot trend, this new Flowers By Zoe tank boasts of cat fever! The grey fabric is easily paired with most anything in her closet while allowing slight stretch in its comfortable fit. The large cat screen print is given a bold touch of color with the bright sunglasses. Pair this cool cat with a pair of rainbow shorts available in their summer line. The back of the tank features a cut out too. Cotton. Hand wash cold water, line dry. Flowers By Zoe runs small. Please order one size up. SMALL (7/8) AND LARGE (10/12) ONLY LEFT. ^||,|$19.00$|,||,|FLOWERS-BY-ZOE-CAT-TANK-TOP-GREY|,|$URL$flowers-by-zoe-cat-tank-top-grey.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-cat-tank-top-in-grey-1.jpg||-||Flowers by Zoe Chevron Girls Shorts and Sunglass Tank (LG 10/12)|,|^|The hottest color this summer, mint green star of this new tween top and short set from Flowers By Zoe. The sleeveless tank boasts of a large cut out upon the back and a colorful sunglass screen print found on the front. Found beneath the top, the white shorts have a stretch waist fit. Colorful chevron stripes race across the shorts with a few matching studs. Summer ready and comfortable in no time. Cotton top with rayon shorts. Hand wash cold water, line dry. Flowers By Zoe runs small. Please order one size up. LARGE (10/12) ONLY REMAINING.  ^||,|$34.33$|,||,|FLOWERS-BY-ZOE-CHEVRON-GIRLS-SHORTS-SUNGLASS-TANK|,|$URL$flowers-by-zoe-chevron-girls-shorts-sunglass-tank.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-chevron-girls-shorts-and-sunglass-tank-1.jpg||-||Flowers By Zoe Chic Tween Sequin Dress PREORDER|,|^|This tween sequin dress from Flowers By Zoe is truly fabulous! The white form fitting style is made with a blended fabric with a slight stretch for comfort. The embellishments on the front of the dress are just gorgeous. Chevron and triangle shapes dance across the front while sequin flowers are strewn around the design. Perfect for any summer event, she will be the envy of all her friends in this dress!Flowers By Zoe runs small. Please order one size up. Please note that this is a PreOrder item and is NOT currently in stock. This Flowers by Zoe item is expected to arrive the week of February 2, 2015. ^||,|$88.50$|,||,|FLOWERS-BY-ZOE-CHIC-TWEEN-SEQUIN-DRESS|,|$URL$flowers-by-zoe-chic-tween-sequin-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-chic-tween-sequin-dress-preorder-11.jpg||-||Flowers By Zoe Chiffon Dress for Tweens Blue Ombre (LG 10/12)|,|^|A beautiful new design, this fabulous tween party dress comes from Flowers By Zoe. The sleeveless bodice boasts of a blouson fit provided by the draw string waist. A cute bow ties at the front of the waist while the collared neckline is sleeveless. The light weight fabric flows in the breeze while the ombre fade turns to blue. The skirt of this dress is ended with a shirt-tail hemline. Created with rayon or rayon blend fabrics. Hand wash with care and line dry. Poly/Rayon. Hand wash cold. Flowers By Zoe runs small. Please order one size up. SIZE MEDIUM (10) AND LARGE (10/12) ONLY LEFT.  ^||,|$42.33$|,||,|FLOWERS-BY-ZOE-CHIFFON-DRESS-TWEENS-BLUE-OMBRE|,|$URL$flowers-by-zoe-chiffon-dress-tweens-blue-ombre.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-chiffon-dress-for-tweens-blue-ombre-1.jpg||-||Flowers by Zoe Chiffon Dress Jeweled in White (Size 4 & LG 10/12)|,|^|A stand out design from Flowers By Zoe, this off white summer dress is easy to fall in love with quickly. The bodice has an empire waist decorated with rows of sequins and gems creating a beautiful design. Elegant chiffon falls from her waist to create a graceful skirt that flows with her every move. The skirt is lined in a comfortable fabric. She will be ready for summer weddings, family photos or dinner in a flash. Rayon/spandex/polyester. Hand wash cold water, line dry. Flowers By Zoe runs small. Please order one size up. SIZE 4 AND LARGE (10/12) ONLY LEFT. ^||,|$59.00$|,||,|FLOWERS-BY-ZOE-CHIFFON-DRESS-JEWELED-WHITE|,|$URL$flowers-by-zoe-chiffon-dress-jeweled-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-chiffon-dress-jeweled-in-white-1.jpg||-||Flowers By Zoe Cold Shoulder Top with Black Tank (Size SM 7/8)|,|^|Hitting the top trend for fall with a twist, designer Flowers By Zoe always delivers great style. The sheer chiffon top boasts of a white star print and a flutter short sleeves boasting of their lace insets and cold shoulder details. Paired with a solid black tank underneath. Tank: 100% cotton, Chiffon Top: 100% polyester. Hand wash both items. SM (7-8) ONLY AVAILABLE. ^||,|$28.33$|,||,|FLOWERS-BY-ZOE-COLD-SHOULDER-CHIFFON-TOP-BLACK-TANK|,|$URL$flowers-by-zoe-cold-shoulder-chiffon-top-black-tank.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-cold-shoulder-top-with-black-tank-14.jpg||-||Flowers By Zoe Comic Book Tank Top (MD 10 & LG 10/12)|,|^|Created by Flowers By Zoe, this new summer top is available in tween sizes. The white tank is cut for a fitted look while the fabric allows slight stretch in its fit. The longer cut makes it great for layering even past the summer season. The action print is inspired by the comic book style. Bold greens, pinks, blues, and yellows are blended in this pattern to fill the clouds and words. Created with rayon or rayon blend fabrics. Hand wash with care and line dry. Flowers By Zoe runs small. Please order one size up. SIZE MEDIUM (10) AND LARGE (10/12) LEFT. ^||,|$18.33$|,||,|FLOWERS-BY-ZOE-COMIC-BOOK-TANK-TOP|,|$URL$flowers-by-zoe-comic-book-tank-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-comic-book-tank-top-1.jpg||-||Flowers by Zoe Coral Top with Tie Dye Pom Pom Skirt (XL 12/14)|,|^|A new design for spring and summer, this fabulous tween outfit comes from trendy designer Flowers By Zoe. The crop top is in a bright coral shade and boasts of a sleeveless neckline decorated with large white gems. A tie dye skirt is paired just beneath. Three tiers wrap around her legs finished with colorful pom poms. The skirt and top both have pull on fits and their fabrics allow slight stretch in fit. Top: Made with rayon blend. Skirt: 100% rayon. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. XLARGE (12/14) ONLY REMAINING. ^||,|$54.00$|,||,|FLOWERS-BY-ZOE-CORAL-TOP-TIE-DYE-POM-POM-SKIRT|,|$URL$flowers-by-zoe-coral-top-tie-dye-pom-pom-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-coral-top-with-tie-dye-pom-pom-skirt-11.jpg||-||Flowers by Zoe Crop Top with Long Skirt (SM 7/8 & LG 10/12)|,|^|A unique tween outfit from Flowers By Zoe, this new arrival is lots of fun! The neon tie dye print covers the sleeveless top while large gems accent the wide neckline. The top is shorter with its cropped hemline. The long maxi skirt is paired beneath. The waistline stretches with elastic. The cool pink shade is a fun color that stands apart this spring and summer. Top: Made with rayon blend. Skirt: 100% rayon. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. SIZE SMALL (7/8) AND LARGE (10/12) ONLY LEFT.  ^||,|$47.33$|,||,|FLOWERS-BY-ZOE-CROP-TOP-LONG-SKIRT|,|$URL$flowers-by-zoe-crop-top-long-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-crop-top-with-long-skirt-11.jpg||-||Flowers by Zoe Daisy Fringe Skirt with Top|,|^|Easy going and fun, this new tween outfit from designer Flowers By Zoe will certainly catch her eye. The white top is shaped by the hemline gathered with a stretch elastic. The neckline has short, batwing sleeves. Large studs sit upon both shoulders. The grey skirt that is paired beneath is covered with a white daisy print. The skirt is finished with long, flowing fringe. 100% rayon. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. ^||,|$36.33$|,||,|FLOWERS-BY-ZOE-DAISY-FRINGE-SKIRT-TOP|,|$URL$flowers-by-zoe-daisy-fringe-skirt-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-daisy-fringe-skirt-with-top-1.jpg||-||Flowers by Zoe Daisy Shorts and Chiffon Top (MD 10 & XL 12/14)|,|^|A sophisticated style for your stylish tween, this new spring outfit for girls comes from Flowers By Zoe. The sheer chiffon top has a sleeveless, scoop neckline and fabric that ties in a knot on the hemline. A row of buttons fasten in the front while small pleats in the back open of the fit just slightly. A matching skirt is worn beneath offering a stretch waistline. The fun daisy print finishes with a double ruffle hemline. Top: 100% polyester. Shorts: 100% polyester. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. MEDIUM (10) AND XLARGE (12/14) ONLY LEFT.  ^||,|$39.00$|,||,|FLOWERS-BY-ZOE-DAISY-SHORTS-CHIFFON-TOP|,|$URL$flowers-by-zoe-daisy-shorts-chiffon-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-daisy-shorts-and-chiffon-top-1.jpg||-||Flowers by Zoe Daisy Tank with High Low Hem and Capri (MD 10)|,|^|Another wonderful daisy creation, this new tween top and legging set comes from Flowers By Zoe. The sleeveless lack top offers her a hi-low hemline and a light grey back. Large white flowers with shimmering centers dress the front. Solid white leggings come with the top and are worn beneath. The capris feature a stretch fit with a comfortable elastic waistline. Top: 100% rayon. Leggings: Made with rayon blend. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. MEDIUM (10) ONLY LEFT. ^||,|$36.33$|,||,|FLOWERS-BY-ZOE-DAISY-TANK-HIGH-LOW-HEM-CAPRI|,|$URL$flowers-by-zoe-daisy-tank-high-low-hem-capri.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-daisy-tank-with-high-low-hem-and-capri-1.jpg||-||Flowers by Zoe Denim Vest with Daisies (Size MD 10 & LG 10/12)|,|^|Going with so many new arrivals from Flowers By Zoe, this fabulous tween denim jacket is a must have for spring and summer. The medium wash vest features raw edges on her shoulders and sweet white daisy appliques that are blooming on the top. A row of classic metal buttons fasten in the front while two flap pockets are the perfect style. Small tucks and a fitted hemline give this vest the perfect, trendy shape. Made with cotton blend. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. MEDIUM (10) AND LARGE (10/12) ONLY LEFT. ^||,|$39.00$|,||,|FLOWERS-BY-ZOE-DENIM-VEST-DAISIES|,|$URL$flowers-by-zoe-denim-vest-daisies.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-denim-vest-with-daisies-1.jpg||-||Flowers by Zoe Designer Leopard Print Leggings (LG 10/12 & XL 12/14)|,|^|Easy to pair with many of the new tops found in her fall wardrobe, these patterned tween leggings come from Flowers By Zoe. The leggings have a comfortable stretch fit and feature an elastic waist. The leggings are covered with a fun leopard print in snow white. The leggings are styled with a longer length, perfect for the colder months! Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. SIZE LG 10/12 & XL 12/14 LEFT. ^||,|$28.50$|,||,|FLOWERS-BY-ZOE-DESIGNER-LEOPARD-PRINT-LEGGINGS|,|$URL$flowers-by-zoe-designer-leopard-print-leggings.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-designer-leopard-print-leggings-1.jpg||-||Flowers By Zoe Designer Tween Romper for Girls PREORDER|,|^|This Flowers By Zoe romper is the perfect combination of dressy and cute. The black top is made with two layers of fabric, one being a sheer black mesh. The shorts are made with a brightly colored version of a damask print with yellow orange and purple. Mimicking the style of a tank top and shorts, this romper is quite a complete look. Flowers By Zoe runs small. Please order one size up. Please note that this is a PreOrder item and is NOT currently in stock. This Flowers by Zoe item is expected to arrive the week of February 2, 2015. ^||,|$52.00$|,||,|FLOWERS-BY-ZOE-DESIGNER-TWEEN-ROMPER-GIRLS|,|$URL$flowers-by-zoe-designer-tween-romper-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-designer-tween-romper-for-girls-preorder-1.jpg||-||Flowers By Zoe Flag Tween Maxi Dress (Size LG 10 & XL 12/14)|,|^|A true Flowers By Zoe design, this trendy tween maxi dress is perfect for any summer celebration, especially the Fourth of July. The casual gray dress boasts of its long flowing fit and high low hemline. The scoop neckline is sleeveless while offering a racer back cut. Large gems are found falling from both shoulders, catching the light as it shimmers. The front of the dress is covered with a faded screen print boasts of stars and stripes. The distressed design creates a unique feel to her patriotic dress! Created with rayon or rayon blend fabrics. Hand wash with care and line dry. Flowers By Zoe runs small. Please order one size up. SIZE LARGE (10/12) AND XLARGE (12/14) AVAILABLE. ^||,|$39.00$|,||,|FLOWERS-BY-ZOE-FLAG-TWEEN-MAXI-DRESS|,|$URL$flowers-by-zoe-flag-tween-maxi-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-flag-tween-maxi-dress-17.jpg||-||Flowers by Zoe Fringe Skirt and Neon Top for Tweens (Size XL 12/14)|,|^|Filling the summer line with bright neon pink, Flowers By Zoe creates trendy tween clothing that cannot be ignored. This bright top is a cropped cut with a sleeveless neckline. A unique design is created from the sequins that shimmer upon the front. The coordinating skirt is a soft gray on the front, featuring the same sparkling design. Long fringe is used to make the hemline dance with the breeze. The back of the skirt is also neon pink. Rayon/spandex. Hand wash cold water, line dry. Flowers By Zoe runs small. Please order one size up. SIZE XLARGE (12/14) ONLY LEFT.  ^||,|$42.33$|,||,|FLOWERS-BY-ZOE-FRINGE-SKIRT-AND-NEON-TOP-TWEENS|,|$URL$flowers-by-zoe-fringe-skirt-and-neon-top-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-fringe-skirt-and-neon-top-for-tweens-1.jpg||-||Flowers By Zoe Girls Burn Out Top with Legging (LG 10/12 & XL12/14)|,|^|Turn an ordinary day in to something exquisite, this tween outfit is perfect for school and comes from trendy Flowers By Zoe. The long sleeve burn out top is in a rich turquoise shad and boasts of its classic button up style, collar neckline, and button cuff long sleeves that can roll up. The paired leggings blend unexpected colors together in a chevron pattern. Top:100% rayon. Legging: Rayon spandex blend. Hand wash both pieces and hang to dry. Please note that Flowers By Zoe runs small, please consider ordering a size up. LARGE (10/12) AND XLARGE (12/14) ONLY LEFT. ^||,|$38.33$|,||,|FLOWERS-BY-ZOE-GIRLS-BURN-OUT-TOP-LEGGING|,|$URL$flowers-by-zoe-girls-burn-out-top-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-girls-burn-out-top-with-legging-3.jpg||-||Flowers by Zoe Girls Classy Black Pants with White Pleather|,|^|Looking fabulous with the new tops from the fall and winter collection, this new skinny pant was designed by Flowers By Zoe. The pants boast of a fitted look that pairs wonderfully with many different types of tops. The pleather is a popular fabric for the season. A bold white stripe runs down the outer side of both legs while the stretch fit waist is comfortable as can be. Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. SIZE MEDIUM (10) AND XLARGE (12/14) ONLY LEFT. ^||,|$43.50$|,||,|FLOWERS-BY-ZOE-GIRLS-CLASSY-BLACK-PANTS-WHITE-PLEATHER|,|$URL$flowers-by-zoe-girls-classy-black-pants-white-pleather.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-girls-classy-black-pants-with-white-pleather-1.jpg||-||Flowers by Zoe Girls Jean Shorts with Daisy Trim (Size MD 10)|,|^|These new tween denim shorts are from designer Flowers By Zoe and are sure to be loved by any tween girl! The shorts feature a medium wash, aged by fading and whiskering on the front. The raw edge hemline seals the deal while a classic button-zipper fly and belt loops give her a comfortable, sure fit. The front of the shorts are dressed with white daisy appliques complete with sunshine yellow centers. Pair these tween shorts to the new ""Daisy Tank Top in Black"" for the perfect pair! Made with cotton blend. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. (2) MEDIUM (10) ONLY LEFT. ^||,|$28.00$|,||,|FLOWERS-BY-ZOE-GIRLS-JEAN-SHORT-DAISY-TRIM|,|$URL$flowers-by-zoe-girls-jean-short-daisy-trim.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-girls-jean-shorts-with-daisy-trim-1.jpg||-||Flowers by Zoe Girls Short Set (MD 10)|,|^|Oversized for a comfortable fit, this new Flowers By Zoe short set is part of their spring and summer collections. The top features a gray cloud print with touches of pink at the neckline and blue near the hem. The large arm holes drape on the side to create a shark bite hemline while a neon print is layered beneath. The black shorts offer a zipper and button fly and neon tie dye leggings peaking out from the hem. Large gems are found decorating her left leg. Top: 100% rayon. Shorts: Made with cotton blend. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. MEDIUM (10) ONLY LEFT. ^||,|$42.33$|,||,|FLOWERS-BY-ZOE-GIRLS-SHORT-SET|,|$URL$flowers-by-zoe-girls-short-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-girls-short-set-11.jpg||-||Flowers by Zoe Girls Special Occasion Lace Dress in Teal|,|^|Created in a beautiful style, this new Flowers By Zoe dress is a beautiful arrival for her holiday celebrations. The bodice features a sweet lacey flower overlay that is beyond elegant. The sheer lace creates the long sleeves while the wide neckline adds a graceful finish. The skirt opens slightly in shape and is completely covered with the flowers. Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. ^||,|$59.25$|,||,|FLOWERS-BY-ZOE-GIRLS-SPECIAL-OCCASION-LACE-DRESS-TEAL|,|$URL$flowers-by-zoe-girls-special-occasion-lace-dress-teal.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-girls-special-occasion-lace-dress-in-teal-1.jpg||-||Flowers By Zoe Girls Stipe Romper in Pink PREORDER|,|^|Flowers By Zoe brings us this adorable little striped romper in her new summer collection. Made with the same ice cream striped fabric we've seen throughout the collection, this romper is just too cute! It's elastic smocked bandeau style top will keep her on trend while the cinched waist gives the piece shape. Tiny white ruffles adorn the neckline, while a coral drawstring accents the waist. An easy effortless style that works as a complete outfit, this is a staple for any designer girl's summer closet! Flowers By Zoe runs small. Please order one size up. Please note that this is a PreOrder item and is NOT currently in stock. This Flowers by Zoe item is expected to arrive the week of March 2, 2015. ^||,|$44.00$|,||,|FLOWERS-BY-ZOE-GIRLS-STIPE-ROMPER-PINK|,|$URL$flowers-by-zoe-girls-stipe-romper-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-girls-stipe-romper-in-pink-preorder-11.jpg||-||Flowers By Zoe Girls Stripe Dress PREORDER|,|^|A cute little summer dress from Flowers By Zoe is just what she needs! The short sleeves and v-neck make this a classic tee shirt style dress. The summery stripes flow through the fabric in pinks, oranges, blues and yellows. A drawstring cinches her waist to give the style more shape.Flowers By Zoe runs small. Please order one size up. Please note that this is a PreOrder item and is NOT currently in stock. This Flowers by Zoe item is expected to arrive the week of March 2, 2015. ^||,|$48.00$|,||,|FLOWERS-BY-ZOE-GIRLS-STRIPE-DRESS|,|$URL$flowers-by-zoe-girls-stripe-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-girls-stripe-dress-preorder-5.jpg||-||Flowers By Zoe Girls Summer Outfit in Black with Coral Flowers (LG 10/12 & XL 12/14)|,|^|An adorable outfit, this new creation comes from the beloved designer Flowers By Zoe. The long top boasts of a high low hemline and contrast cap sleeves. The shoulders are decked out in sequins that sparkle in the light. The black and white stripe print is covered with coral roses upon the front and the back. Paired beneath this tunic we find solid black leggings that offer her comfort throughout the whole day. Created with rayon or rayon blend fabrics. Hand wash cold with care and line dry. Flowers By Zoe runs small. Please order one size up. SIZE LARGE (10/12) AND XLARGE (12/14) ONLY LEFT. ^||,|$59.00$|,||,|FLOWERS-BY-ZOE-GIRLS-SUMMER-OUTFIT-BLACK-CORAL-FLOWERS|,|$URL$flowers-by-zoe-girls-summer-outfit-black-coral-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-girls-summer-outfit-in-black-with-coral-flowers-11.jpg||-||Flowers By Zoe Glittering Metallic Strappy Tween Dress (MD 10 & LG 10/12)|,|^|This strappy and fun tween dress from Flowers By Zoe is sure to be one of her favorites. The strappy bodice is done in black metallic with a decorative zipper in the center. The hi low skirt of pink chiffon flows from the empire waist. Decorative silver studs adorn the front of the skirt. A pink lining is found under the chiffon. Made from polyester/rayon. Hand wash cold, line dry. SIZE MEDIUM (10) AND LARGE (10/12) ONLY AVAILABLE.  ^||,|$29.00$|,||,|FLOWERS-BY-ZOE-GLITTERING-METALLIC-STRAPPY-TWEEN-DRESS|,|$URL$flowers-by-zoe-glittering-metallic-strappy-tween-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-glittering-metallic-strappy-tween-dress-14.jpg||-||Flowers By Zoe Gold Chevron Tween Dress (Size SM 7/8)|,|^|Looking for the perfect fun party dress for your tween? This Flowers by Zoe gold chevron dress is perfect for all holiday parties and to ring in the New Year! The sparkling bodice features a flattering scoop neck and simple cap sleeves. This darling dress features purple, black, gold and silver chevron stripes that dance around her upper half, while an open solid black skirt flows at the bottom. The sequins will catch the light at any angle! Made with rayon blend. Hand wash cold, line dry. Please note that the Flowers By Zoe brand runs small. Please consider ordering a size up. (1) SIZE SMALL (7/8) ONLY LEFT.  ^||,|$39.33$|,||,|FLOWERS-BY-ZOE-GOLD-CHEVRON-TWEEN-DRESS|,|$URL$flowers-by-zoe-gold-chevron-tween-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-gold-chevron-tween-dress-2.jpg||-||Flowers by Zoe Gold Sequin Shorts with Leopard Top (XL 12/14)|,|^|Flowers by Zoe hit a home run with this cool summer outfit for tweens! The top is a casual fit tank in white. Leopard spots cover the tank with small accents of sequins. The flutter back is made with draping sheer fabric. The second half of this gorgeous duo is the comfortable denim shorts with stunning gold sequins. Two pockets are found upon the back while a classic zipper and button combination fasten the waist. Add a cami or simple tank and she is ready for summer fun. Rayon top and Cotton/Spandex short. Hand wash cold water, line dry. Flowers By Zoe runs small. Please order one size up. XLARGE (12/14) ONLY REMAINING.  ^||,|$44.33$|,||,|FLOWERS-BY-ZOE-GOLD-SEQUIN-SHORTS-LEOPARD-TOP|,|$URL$flowers-by-zoe-gold-sequin-shorts-leopard-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-gold-sequin-shorts-with-leopard-top-1.jpg||-||Flowers by Zoe Gray Zip Jacket (Size LG 12)|,|^|Knit of gray rayon and spandex, this tween girls light weight jacket has pretty pink trim. Zip pockets, zip front closure, hand wash.ONLY ONE SIZE LARGE 12 AVAILABLE. ^||,|$14.00$|,||,|FLOWERS-BY-ZOE-GRAY-ZIP-JACKET|,|$URL$flowers-by-zoe-gray-zip-jacket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-gray-zip-jacket-7.jpg||-||Flowers By Zoe Hawaiian Romper for Girls PREORDER|,|^|Flowers By Zoe brings us this cute romper just in time for summer. Made with the same Hawaiian print fabric we've seen throughout the collection, this romper is just too cute! It's drawstring bandeau style top will keep her on trend while the cinched waist gives the piece shape. Two hand pockets fall just below the waistline. An easy effortless style that works as a complete outfit, this is a staple for any designer girl's summer closet! Flowers By Zoe runs small. Please order one size up. Please note that this is a PreOrder item and is NOT currently in stock. This Flowers by Zoe item is expected to arrive the week of March 2, 2015. ^||,|$49.00$|,||,|FLOWERS-BY-ZOE-HAWAIIAN-ROMPER-GIRLS|,|$URL$flowers-by-zoe-hawaiian-romper-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-hawaiian-romper-for-girls-preorder-1.jpg||-||Flowers By Zoe Hi Low Tank Top Express Your Selfie PREORDER|,|^|A vibrant tank top sure to see her though the summer, this design comes to us from Flowers By Zoe. This sleeveless tank top with the trendy hi-low hemline is made from a bright fuchsia light weight fabric. The graphic on the front of the top reads ""Express your selfie"" which is a phrase that has caught the young generation by storm. Pair it with one of her new pairs of shorts or capris to complete the look. Flowers By Zoe runs small. Please order one size up. Please note that this is a PreOrder item and is NOT currently in stock. This Flowers by Zoe item is expected to arrive the week of February 2, 2015. ^||,|$38.00$|,||,|FLOWERS-BY-ZOE-HI-LOW-TANK-TOP-EXPRESS-YOUR-SELFIE|,|$URL$flowers-by-zoe-hi-low-tank-top-express-your-selfie.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-hi-low-tank-top-express-your-selfie-preorder-1.jpg||-||Flowers By Zoe High End Girls Sweatshirt PREORDER|,|^|Made from oh so fun stripes that flow throughout the collection, this zip up sweatshirt is from Flowers By Zoe. Made from lightweight material to keep her cool in the warmer months, this high end sweatshirt will definitely be noticed! Multi-colored stripes flow throughout the design, while the wider shoulder hem sets this hoodie apart from the rest. Complete with a drawstring hood, zip up the front and two hand pockets on either side of the zipper. Flowers By Zoe runs small. Please order one size up. Please note that this is a PreOrder item and is NOT currently in stock. This Flowers by Zoe item is expected to arrive the week of March 2, 2015. ^||,|$44.00$|,||,|FLOWERS-BY-ZOE-HIGH-END-GIRLS-SWEATSHIRT|,|$URL$flowers-by-zoe-high-end-girls-sweatshirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-high-end-girls-sweatshirt-preorder-1.jpg||-||Flowers By Zoe Jean Shorts with Stone Accents|,|^|Created for her sunny summer plans, this new denim short from Flowers By Zoe is a staple in any tween closet this season. The grey blue wash of the denim has a retro feel that is welcomed while the frayed hemline creates a casual look. The front of the shorts is speckled with ovals, circles, and diamonds shaped out of sequins. The shorts offer her the classic pockets and belt loops. A zipper and button fly secure the fit. These shorts are created with a cotton blend fabric. Hand wash and line dry. Flowers By Zoe runs small, please order one size up.  ^||,|$27.33$|,||,|FLOWERS-BY-ZOE-JEAN-SHORTS-STONE-ACCENTS|,|$URL$flowers-by-zoe-jean-shorts-stone-accents.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-jean-shorts-with-stone-accents-1.jpg||-||Flowers by Zoe Jewelled Top with Skirt|,|^|Flowers By Zoe is now offering this cute tween outfit as a part of their new line for the warmer months. The short sleeve top is cut for a more fitted look while offering short sleeves. Large, colorful gems cover the front and reflect the sun's rays. Paired with a bright coral skirt that is worn beneath. The skirt has a sheer overlay that moves with grace at her every step. The waistband stretches for a comfortable and easy fit. Top: Made with rayon blend. Skirt: 100% polyester. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up.  ^||,|$42.33$|,||,|FLOWERS-BY-ZOE-JEWELLED-TOP-SKIRT|,|$URL$flowers-by-zoe-jewelled-top-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-jewelled-top-with-skirt-11.jpg||-||Flowers by Zoe Lace Dress for Girls (Size 4 & XL 12/14)|,|^|Flowers By Zoe has created this summer dress for girls as a part of their bright summer line! The dress is lined with a soft cotton knit that will keep her comfortable. The bright rainbow hand dyed color peeks out through the sweet white lace which adds a dressy look. The back of the dress features a large heart cut out. Created with a polyester-rayon blend. Hand wash cold water, line dry. Flowers By Zoe runs small. Please order one size up. SIZE 4 AND XL (12/14) ONLY LEFT.  ^||,|$39.00$|,||,|FLOWERS-BY-ZOE-LACE-DRESS-GIRLS|,|$URL$flowers-by-zoe-lace-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-lace-dress-for-girls-1.jpg||-||Flowers By Zoe Leopard Tween Sweat Pant and Peace Top (Size MD 10)|,|^|Filled with style and love, this unique tween outfit can be found only from designer Flowers By Zoe. The long sleeve top is covered with a rich rainbow top boasts of a cute screen print on her left sleeve. The back of the top shows support of peace while the elastic waist sweatpants are tightened by drawstrings. The wild animal print fades slowly into color as you reach the hem. 100% Rayon. Hand wash cold, line dry. SIZE MEDIUM (10) ONLY LEFT.  ^||,|$44.33$|,||,|FLOWERS-BY-ZOE-LEOPARD-TWEEN-SWEAT-PANT-PEACE-TOP|,|$URL$flowers-by-zoe-leopard-tween-sweat-pant-peace-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-leopard-tween-sweat-pant-and-peace-top-22.jpg||-||Flowers by Zoe Little Girls Summer Dress in Pink (Size 4)|,|^|Matching to other great arrivals found within the summer line, this Flowers By Zoe party dress is available in sizes 4 to 6X. The dress is easy to wear with a pull over fit and slight stretch offered in the fabric. The empire bodice is a neutral grey graced with a sequin design. The skirt stands out in its bright shade of pink! Pair it with her favorite sandals for a dressy look or a pair of converse for everyday deliciousness! Flowers By Zoe runs small. Please order one size up. SIZE 4 ONLY LEFT. ^||,|$38.33$|,||,|FLOWERS-BY-ZOE-TWEEN-SUMMER-DRESS-PINK|,|$URL$flowers-by-zoe-tween-summer-dress-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-little-girls-summer-dress-in-pink-1.jpg||-||Flowers By Zoe Love Girls Summer Top (MD 10)|,|^|An eye catching new design, this fabulous Flowers By Zoe tween tank top is sure to become one of her most worn tops of the summer. The dark top boasts of a bold punch of comic book flavor that creates the heart print on the front. Large letters spell ""love"" while accented with matching studs. The overlay of the top boasts of an uneven hemline while a fun, fitted pattern lengthens the fit from underneath. Pairs beautifully with so many new leggings and shorts! Created with rayon or rayon blend fabrics. Hand wash with care and line dry. Flowers By Zoe runs small. Please order one size up. (1) MEDIUM (10) ONLY LEFT.  ^||,|$22.33$|,||,|FLOWERS-BY-ZOE-LOVE-GIRLS-SUMMER-TOP|,|$URL$flowers-by-zoe-love-girls-summer-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-love-girls-summer-top-1.jpg||-||Flowers by Zoe Love White Sweatpant (Size MD 10 & LG 10/12)|,|^|Designed by Flowers By Zoe, these tween sweatpants are ready for any fun activity she has planned. The white pants offer a draw string waist that is tied in the front. The elastic hem gathers the fabric of both legs and makes it easy for her to wear them cropped. A ""LOVE"" print is found running down the left leg with a yellow daisy replacing the ""O."" These match easily to other new arrivals from Flowers By Zoe! 100% rayon. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. MEDIUM (10) AND LARGE (10-12) ONLY. ^||,|$39.00$|,||,|FLOWERS-BY-ZOE-LOVE-WHITE-SWEATPANT|,|$URL$flowers-by-zoe-love-white-sweatpant.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-love-white-sweatpant-1.jpg||-||Flowers by Zoe Maxi Dress Aztec Print with Pom Poms|,|^|Created by Flowers By Zoe, this new tween dress is sure to have a memorable spring and summer in the sun. The strappy bodice has a soft ""u"" neckline. Fabric drapes down from the neckline to create the illusion of an empire waistline; small white pom poms are found dangling from the edge. The white, maxi dress for tweens is covered with a black aztec print and a small touch of cloudy color. 100% rayon. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. ^||,|$47.00$|,||,|FLOWERS-BY-ZOE-MAXI-DRESS-AZTEC-PRINT-POM-POMS|,|$URL$flowers-by-zoe-maxi-dress-aztec-print-pom-poms.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-maxi-dress-aztec-print-with-pom-poms-1.jpg||-||Flowers By Zoe Maxi Dress for Tweens Floral (Size MD 10 & LG 10/12)|,|^|New from Flowers By Zoe, this spring maxi dress is an adorable design. The long dress is covered with a black and white stripe print that changes from thin to thick. Fragrant coral roses fall upon the dress from the strappy neckline to the hem. The bodice of this dress is covered with a matching overlay that drapes gracefully. The hem of this overlay is finished with sweet dancing pom poms. Created with rayon or rayon blend fabrics. Hand wash with care and line dry. Flowers By Zoe runs small. Please order one size up. SIZE MEDIUM (10) AND LARGE (10/12) ONLY LEFT.  ^||,|$49.00$|,||,|FLOWERS-BY-ZOE-MAXI-DRESS-TWEENS-FLORAL|,|$URL$flowers-by-zoe-maxi-dress-tweens-floral.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-maxi-dress-for-tweens-floral-1.jpg||-||Flowers By Zoe Mint Daisy and Striped Skirt Set (MD 10)|,|^|Minty fresh and just in time for spring, this skirt set is from Flowers By Zoe. The mint green top boasts of adjustable straps and sharkbite hemline. A large white daisy adorns the front and features a cluster of sequins at the center. The long skirt is striped with gray alternating with white, mint and lavender. Both garments are made from rayon. Hand wash, line dry. Flowers by Zoe runs small, please consider ordering one size up. ONE SIZE MD (10) ONLY REMAINING. ^||,|$39.00$|,||,|FLOWERS-BY-ZOE-MINT-DAISY-STRIPED-SKIRT-SET|,|$URL$flowers-by-zoe-mint-daisy-striped-skirt-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-mint-daisy-and-striped-skirt-set-16.jpg||-||Flowers by Zoe Neon Orange Girls Dress|,|^|Unique from so many other designs that are offered, this Flowers By Zoe is for the bold in style and color. The sleevless dress features a collared ""V"" neckline. The waist is cinched with a drawstring that ties into a bow on the front. The dress finishes with an uneven hemline that falls down from the sides. The sheer overlay has a punch out pattern that allows the pink lining to peak through. 100% polyester. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. ^||,|$47.00$|,||,|FLOWERS-BY-ZOE-CORAL-GIRLS-DRESS|,|$URL$flowers-by-zoe-coral-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-coral-girls-dress-1.jpg||-||Flowers by Zoe Neon Pink Sequin Skirt Set (Size XL 12/14)|,|^|A fresh new look, this tween outfit is a new arrival from Flowers By Zoe. The top has a standard, sleeveless neckline while styled for a cropped, mid drift length. The bright neon pink stands out in the sun's rays! A beautiful summer skirt accompanies the top. This skirt offers sequin detailing found upon the front, catching every bit of light in its sparkle. Rayon/spandex. Hand wash cold water, line dry. Flowers By Zoe runs small. Please order one size up. XLARGE (12/14) ONLY LEFT.  ^||,|$47.33$|,||,|FLOWERS-BY-ZOE-NEON-PINK-SEQUIN-SKIRT-SET|,|$URL$flowers-by-zoe-neon-pink-sequin-skirt-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-neon-pink-sequin-skirt-set-1.jpg||-||Flowers By Zoe Neon Pink Sequin Tween Dress (Size XL 12/14)|,|^|From Flowers By Zoe, she'll be the prettiest in pink in this tween dress. The bodice is sleeveless with a scoop neckline. Vibrant neon pink sequins cover the entire front of the dress. At the drop waist is a drawstring tie. The back of the dress is solid pink. Made of rayon/spandex. Hand wash cold, line dry. SIZE XLARGE (12/14) ONLY LEFT.  ^||,|$39.00$|,||,|FLOWERS-BY-ZOE-NEON-PINK-SEQUIN-TWEEN-DRESS|,|$URL$flowers-by-zoe-neon-pink-sequin-tween-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-neon-pink-sequin-tween-dress-14.jpg||-||Flowers by Zoe New York Printed Shirt with Skirt (SM 7/8 & XL 12/14)|,|^|A patriotic outfit that boasts of love for New York City, this new arrival comes from fabulous Flowers By Zoe. The long sleeve top is covered with NYC photos and small touches of color. A zipper is found at the front base of both shoulders. The A line skirt is made from trendy solid black pleather accented with two silver zippers. 100% Rayon. Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up.SIZE SM 7/8 & XL 12/14 ONLY LEFT. ^||,|$70.50$|,||,|FLOWERS-BY-ZOE-NEW-YORK-PRINTED-SHIRT-SKIRT|,|$URL$flowers-by-zoe-new-york-printed-shirt-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-new-york-printed-shirt-with-skirt-1.jpg||-||Flowers By Zoe Party Dress for Tweens (SM 7/8 & MD 10)|,|^|Sure to stand apart at any event, this fabulous tween party dress comes from Flowers By Zoe. The black bodice has a strappy, fitted cut. The sheer black overlay boasts of its blouson fit while a single button keyhole is found on the back of the illusion neckline. The fitted skirt wraps around her legs with slight stretch found in its fabric. The front is striped with white rows while blooming cute coral flowers. The front of the skirt is accented completely with shimmer sequins. Created with rayon or rayon blend fabrics. Hand wash with care and line dry. Poly/Rayon. Hand wash cold. Flowers By Zoe runs small. Please order one size up. SIZE SMALL (7/8) AND MEDIUM (10) ONLY LEFT. ^||,|$79.00$|,||,|FLOWERS-BY-ZOE-PARTY-DRESS-TWEENS|,|$URL$flowers-by-zoe-party-dress-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-party-dress-for-tweens-1.jpg||-||Flowers By Zoe Plaid Tween Dress with Peplum Skirt (MD 10 & LG 10/12)|,|^|Always taking the top seasonal styles to the next level, this Flowers By Zoe dress is great for school, parties, or family photos! The red plaid bodice is a fitted, sleeveless cut. Sparkling gems line the neck and arms to add a touch of glamour. The short skirt is dressed up with a darling peplum ruffle that falls from the waist. Made with rayon blend. Hand wash cold, line dry. Please note that the Flowers By Zoe brand runs small. Please consider ordering a size up. SIZE MEDIUM (10) AND LARGE (10/12) LEFT. ^||,|$39.33$|,||,|FLOWERS-BY-ZOE-PLAID-TWEEN-DRESS-PEPLUM-SKIRT|,|$URL$flowers-by-zoe-plaid-tween-dress-peplum-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-plaid-tween-dress-with-peplum-skirt-2.jpg||-||Flowers By Zoe Radiant Beading Silver Tween Dress (MD 10, LG 10/12)|,|^|Ready for a party, this new Flowers By Zoe tween dress is also available in a white style. The sleeveless bodice features satin trim around the V neckline and her waist. The grey tulle overlay beading falls down into the top of the skirt. Lined, hand wash with care. FLOWERS BY ZOE RUNS SMALL CONSIDER ORDERING UP A SIZE. MEDIUM 10 & LG 10/12 ONLY LEFT. ^||,|$39.33$|,||,|FLOWERS-BY-ZOE-RADIANT-BEADING-SILVER-TWEEN-DRESS|,|$URL$flowers-by-zoe-radiant-beading-silver-tween-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-radiant-beading-silver-tween-dress-14.jpg||-||Flowers by Zoe Sequin Daisy Dress|,|^|Designed by Flowers by Zoe, this girls dress is available in tween sizes only. The strappy neckline is ready for warm summer days in the sun. The shapeless style allows for a more relaxed fit. A sheer overlay is covered with cute daisies inspired from the new blooms of spring. This dress is perfect for a casual Easter celebration or almost any party! 100% polyester. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. ^||,|$39.33$|,||,|FLOWERS-BY-ZOE-SEQUIN-DAISY-DRESS|,|$URL$flowers-by-zoe-sequin-daisy-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-sequin-daisy-dress-1.jpg||-||Flowers by Zoe Sequin Dress for Tweens|,|^|Matching another new arrival from Flowers By Zoe, this tween party dress is dazzling. The bodice offers her a sleevless and a scoop neckline. Sparkling sequins wrap around from front to back in chevron pattern. The dark navy is perfectly complimented by the fun coral pink. The skirt drapes from the waist and sways with her every movement. Made with rayon blend. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up.  ^||,|$69.00$|,||,|FLOWERS-BY-ZOE-SEQUIN-DRESS-TWEENS|,|$URL$flowers-by-zoe-sequin-dress-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-sequin-dress-for-tweens-1.jpg||-||Flowers by Zoe Sequin Shorts for Tweens (Size XL 12/14)|,|^|Filled with fun, these fabulous tween shorts have newly arrived from designer Flowers By Zoe. The blue denim shorts are a medium dye and offer classic belt loops. The button fly also has a zipper. Multi colored sequins cover the front and both legs are ended with a raw edged hemline. Pair these shorts with her favorite new top from Flowers By Zoe's spring and summer line. Made with cotton blend. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. SIZE XL (12/14) ONLY REMAINING. ^||,|$39.00$|,||,|FLOWERS-BY-ZOE-SEQUIN-SHORTS-TWEENS|,|$URL$flowers-by-zoe-sequin-shorts-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-sequin-shorts-for-tweens-11.jpg||-||Flowers By Zoe Sheer Army Top and Legging Set for Tweens (Size MD 10)|,|^|Complete from head to toe, this new tween outfit from designer Flowers By Zoe will make her first days back at school a breeze! The sheer button up top is styled by single button cuffs and the classic collar and breast pocket. The sheer fabric is printed in green army camo. A solid black tank with a fitted fabric is paired beneath the top adorned only by the gold studs lining her strappy neckline. Solid black leggings are added to finish this trendy look with faux zippers running up the outer side of both legs. Top: 100% polyester. Tank: rayon and spandex blend. Leggings: rayon and spandex blend. All three pieces are hand wash only, hang to dry. Please note that Flowers By Zoe runs small, please consider ordering a size up. MEDIUM (10) ONLY LEFT.  ^||,|$48.33$|,||,|FLOWERS-BY-ZOE-SHEER-ARMY-TOP-LEGGING-SET-TWEENS|,|$URL$flowers-by-zoe-sheer-army-top-legging-set-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-sheer-army-top-and-legging-set-for-tweens-2.jpg||-||Flowers By Zoe Skirt Set for Tweens Love Stripe PREORDER|,|^|A fun summer skirt set that will make her the envy of all her friends, this outfit comes from Flowers By Zoe. The short sleeved tee shirt will keep her cool all summer with it's lightweight material. The front is embellished with a large ""LOVE"" rainbow graphic while the sleeves are striped to match the skirt. The skirt is filled with fun pink and blue stripes to keep her happy as she twirls through the day. Flowers By Zoe runs small. Please order one size up. Please note that this is a PreOrder item and is NOT currently in stock. This Flowers by Zoe item is expected to arrive the week of March 2, 2015. ^||,|$88.00$|,||,|FLOWERS-BY-ZOE-SKIRT-SET-TWEENS-LOVE-STRIPE|,|$URL$flowers-by-zoe-skirt-set-tweens-love-stripe.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-skirt-set-for-tweens-love-stripe-preorder-1.jpg||-||Flowers By Zoe Sleeveless Tween Dress in Camo and Pleather|,|^|Designed for the trendy tween girl from Flowers By Zoe, this new dress is filled with style unlike any other. The bodice boasts of a sleeveless neckline and offers a slight stretch in fit. The bright neon camo is accented by small touches of matching colored sequins. The skirt opens to almost a full circle shape and is made in coordinating black pleather. Bodice: rayon and spandex blend. Skirt: nylon and spandex blend. Hand wash in cold water, line dry. Please note that Flowers By Zoe runs small, please consider ordering a size up.  ^||,|$27.33$|,||,|FLOWERS-BY-ZOE-SLEEVELESS-TWEEN-DRESS-CAMO-PLEATHER|,|$URL$flowers-by-zoe-sleeveless-tween-dress-camo-pleather.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-sleeveless-tween-dress-in-camo-and-pleather-2.jpg||-||Flowers by Zoe Smiley Face Dress with Fringe Hem (MD 10)|,|^|Flowers By Zoe has this newly created tween dress available for the spring and summer months. The white dress features a strappy neckline accented with cute studs. Many smiley faces turn and tumble down the dress to the long fringe hemline. This light weight fabric is comfortable for her to wear and allows the sweet breeze to cool her off. 100% rayon. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. MEDIUM (10) ONLY LEFT.  ^||,|$24.33$|,||,|FLOWERS-BY-ZOE-SMILEY-FACE-DRESS-FRINGE-HEM|,|$URL$flowers-by-zoe-smiley-face-dress-fringe-hem.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-smiley-face-dress-with-fringe-hem-11.jpg||-||Flowers By Zoe Stripe Short Set for Girls PREORDER|,|^|A beach inspired short set from Flowers By Zoe is her perfect summer look. With a fun ""donut love"" graphic covering the front of the aqua top, the short sleeves and looser fitting style will be a staple for her summer wardrobe. The matching striped elastic waist shorts will keep her cool and comfortable, with white pom pom trim finishing the look. Flowers By Zoe runs small. Please order one size up. Please note that this is a PreOrder item and is NOT currently in stock. This Flowers by Zoe item is expected to arrive the week of March 2, 2015. ^||,|$59.00$|,||,|FLOWERS-BY-ZOE-STRIPE-SHORT-SET-GIRLS|,|$URL$flowers-by-zoe-stripe-short-set-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-stripe-short-set-for-girls-preorder-1.jpg||-||Flowers By Zoe Stylish Tween Pink Top with Splatter Leggings (XL 12/14)|,|^|A fun outfit for her back to school wardrobe, this new design comes from Flowers By Zoe, a trendy tween designer that is loved by all. The baseball styled tee features black long sleeves and a wide neckline decorated with sparkling accents. The rich pink color stands out and finishes with a high low hemline. Black and white clouded leggings are worn beneath with splatters of pink. 100% Rayon. Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. XLARGE (12/14) REMAINING.  ^||,|$58.50$|,||,|FLOWERS-BY-ZOE-STYLISH-TWEEN-PINK-TOP-SPLATTER-LEGGINGS|,|$URL$flowers-by-zoe-stylish-tween-pink-top-splatter-leggings.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-stylish-tween-pink-top-with-splatter-leggings-1.jpg||-||Flowers by Zoe Sunglass Tank with Sequin Skirt (Size XL 12/14)|,|^|Created for your fun-loving tween, this bright new outfit is available from the spring and summer line by trendy Flowers By Zoe. The tank boasts of a ribbed knit fabric that is comfortable to wear and styled with a keyhole back. The front of the top boasts of a large screen print of rainbow sunglasses. Paired with the tank, the short skirt is created with a fabric that has a soft stretch for fit. The front of the skirt is covered with a rainbow of dazzling sequins while the back is a solid neon pink. Rayon/spandex skirt with cotton tank top. Hand wash cold water, line dry. Flowers By Zoe runs small. Please order one size up. XLARGE (12/14) ONLY AVAILABLE. ^||,|$47.33$|,||,|FLOWERS-BY-ZOE-SUNGLASS-TANK-SEQUIN-SKIRT|,|$URL$flowers-by-zoe-sunglass-tank-sequin-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-sunglass-tank-with-sequin-skirt-1.jpg||-||Flowers By Zoe Tie Dyed Tween Sweatshirt (Size XL 12/14)|,|^|Perfect for cool evenings on the beach and made to match the Tie Dyed Maxi Dress from Flowers By Zoe, this tween sweatshirt is a must have. The neckline has a raw edge with pink stitching to accent. Silver cone shaped studs adorn the tops of the sleeves. Colorful tie dye covers the entire top. A hi low hemline is another feature. Made from rayon. Hand wash cold, line dry. SIZE XLARGE (12/14) ONLY LEFT.  ^||,|$29.33$|,||,|FLOWERS-BY-ZOE-TIE-DYED-TWEEN-SWEATSHIRT|,|$URL$flowers-by-zoe-tie-dyed-tween-sweatshirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tie-dyed-tween-sweatshirt-12.jpg||-||Flowers By Zoe Trendy Tween Top and Capri Outfit Selfie PREORDER|,|^|A vibrant, active style for any tween this summer, this designer outfit comes from Flowers By Zoe. Catching your eye first is the bold graffiti print scattered throughout this outfit. Fully covering the back of the shirt, the front is a white sleeveless style with the popular ""Express Your Selfie"" phrase placed across the front, with a few rhinestones scattered throughout the design. The active capri pants fit like a yoga pant to keep her nice and comfortable. Flowers By Zoe runs small. Please order one size up. Please note that this is a PreOrder item and is NOT currently in stock. This Flowers by Zoe item is expected to arrive the week of February 2, 2015. ^||,|$76.00$|,||,|FLOWERS-BY-ZOE-TRENDY-TWEEN-TOP-CAPRI-OUTFIT-SELFIE|,|$URL$flowers-by-zoe-trendy-tween-top-capri-outfit-selfie.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-trendy-tween-top-and-capri-outfit-selfie-preorder-1.jpg||-||Flowers By Zoe Trendy Tween Top and Leggings with Zippers (SM 7/8)|,|^|Designed by Flowers By Zoe, this new tween outfit is a fun creation she will love wearing. The long sleeve top boasts of a wide neckline and a light-weight feel that is perfect for layering or wearing on its own. Two zippers are found on the front while the black and white clouded pattern is colored with splashes of pink. Small touches of silver studs are found on the front as well. The paired leggings have quilted pleather sides for a great texture look. Two zippers are found on both legs. 100% Rayon. Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. SIZE SMALL (7/8) ONLY LEFT.  ^||,|$69.00$|,||,|FLOWERS-BY-ZOE-TRENDY-TWEEN-TOP-LEGGINGS-ZIPPERS|,|$URL$flowers-by-zoe-trendy-tween-top-leggings-zippers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-trendy-tween-top-and-leggings-with-zippers-1.jpg||-||Flowers by Zoe Tunic with Capri for Tweens (4, 5 MD 10 & LG 10/12)|,|^|Newly created from Flowers By Zoe, this girls outfit is a darling choice as the snow melts to make room for the new flower blooms. The long tunic is colored bright as a rainbow. A white lace overlays the vibrant fabric with a floral print. The drop waist introduces a hi-low skirt. Paired beneath are fitted leggings in a matching shade of coral. The sleeveless style is easy to layer and transition from early spring through the summer. Top: 100% polyester. Leggings: Made with rayon blend. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up.  ^||,|$42.33$|,||,|FLOWERS-BY-ZOE-TUNIC-CAPRI-TWEENS|,|$URL$flowers-by-zoe-tunic-capri-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tunic-with-capri-for-tweens-1.jpg||-||Flowers by Zoe Tween Back to School Outfit in Pleather|,|^|A sweet outfit, this creation comes from designer Flowers By Zoe. The blooming top is a black and white motif covered with darling roses. The fitted shape of the top is accented by the black pleather trimmings. The long sleeves offer her a touch of warmth during the fall and winter months. Paired with this top we find black pleather leggings that boast solely of their metallic silver sides. Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. ^||,|$66.00$|,||,|FLOWERS-BY-ZOE-TWEEN-BACK-SCHOOL-OUTFIT-PLEATHER|,|$URL$flowers-by-zoe-tween-back-school-outfit-pleather.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-back-to-school-outfit-in-pleather-1.jpg||-||Flowers by Zoe Tween Black Pleather Shorts with Studs|,|^|A real rocking look, these new shorts from Flowers By Zoe are filled with edge and style. The black pleather is a trendy fabric that is sure to fill the season. The shorts offer her front pockets and belt loops found upon the waist. A zipper button fly fasten in the front. Stitching creates a quilted look while small studs accent the intersections. Pair these shorts with leggings and tops from Flowers By Zoe's fall and winter creations! Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. ^||,|$42.00$|,||,|FLOWERS-BY-ZOE-TWEEN-BLACK-PLEATHER-SHORTS-STUDS|,|$URL$flowers-by-zoe-tween-black-pleather-shorts-studs.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-black-pleather-shorts-with-studs-1.jpg||-||Flowers By Zoe Tween Chiffon Dress Animal Print (Size MD 10)|,|^|Making a hit at any party, this new tween girls dress comes from Flowers By Zoe. The dress boasts of a solid, sleeveless black bodice while the skirt offers an animal print chiffon overlay. Just above the elastic black waistband peaks out quaint chiffon ruffles. Hand wash and hang to dry. Flowers by Zoe runs small, please consider ordering one size up. ONE SIZE MEDIUM(10) ONLY REMAINING. ^||,|$29.00$|,||,|FLOWERS-BY-ZOE-TWEEN-CHIFFON-DRESS-ANIMAL-PRINT|,|$URL$flowers-by-zoe-tween-chiffon-dress-animal-print.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-chiffon-dress-animal-print-14.jpg||-||Flowers by Zoe Tween Circle Lace Dress in White|,|^|Elegant and graceful, this new designer tween dress is a Flowers By Zoe design that she will love at first sight! The dress is styled with a rounded square neckline and bell ruffle cuffs on the sleeves. The circle lace overlay allows the tank dress beneath to peak through. The dress is cut for a classic A-line shape that is a timeless fit. Wear this dress to any holiday, wedding or special occasion celebration! Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. ^||,|$55.50$|,||,|FLOWERS-BY-ZOE-TWEEN-CIRCLE-LACE-DRESS-WHITE|,|$URL$flowers-by-zoe-tween-circle-lace-dress-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-circle-lace-dress-in-white-1.jpg||-||Flowers By Zoe Tween Color Block Skirt with Top|,|^|Stylish as ever, this new Flowers By Zoe tween outfit is just what her fall style desires. The black top features a looser fit with a beaded neckline. The pairing skirt boasts of its rectangles of color block and shorter length. Pairs great with boots and leggings. Hand wash both pieces with care. Flowers by Zoe runs small, please consider ordering one size up.  ^||,|$34.00$|,||,|FLOWERS-BY-ZOE-TWEEN-COLOR-BLOCK-SKIRT-TOP|,|$URL$flowers-by-zoe-tween-color-block-skirt-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-color-block-skirt-with-top-17.jpg||-||Flowers By Zoe Tween Crop Top and Maxi Skirt Set PREORDER|,|^|A fun skirt set perfect for a warm summer day, this outfit comes from Flowers By Zoe. A hot pink short sleeved top is unique enough with it's tie dyed cutouts in the back. The crop style top will keep her on trend while the maxi skirt exudes fun with every step. The fold over skirt with a stretch material will keep her nice and comfortable while splashed in a tie dyed print. Flowers By Zoe runs small. Please order one size up. Please note that this is a PreOrder item and is NOT currently in stock. This Flowers by Zoe item is expected to arrive the week of February 2, 2015. ^||,|$38.00$|,||,|FLOWERS-BY-ZOE-TWEEN-CROP-TOP-MAXI-SKIRT-SET|,|$URL$flowers-by-zoe-tween-crop-top-maxi-skirt-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-crop-top-and-maxi-skirt-set-preorder-1.jpg||-||Flowers by Zoe Tween Designer Leggings in Black with Zippers (SM 7/8)|,|^|Created to be paired with the beautiful new tops arriving as part of their fall and winter line, these leggings come from Flowers By Zoe. The black leggings have an easy stretch fit that is super comfortable and easy to wear. The long leggings are styled only by two zippers upon both legs. Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. (1) SIZE SM 7/8 ONLY LEFT. ^||,|$42.00$|,||,|FLOWERS-BY-ZOE-TWEEN-DESIGNER-LEGGINGS-BLACK-ZIPPERS|,|$URL$flowers-by-zoe-tween-designer-leggings-black-zippers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-designer-leggings-in-black-with-zippers-1.jpg||-||Flowers by Zoe Tween Designer Sweater with Leggings in Red (SM 7/8)|,|^|A new arrival by popular designer Flowers By Zoe, this new tween outfit has arrived just in time for her to add it to her back to school wardrobe. The black sweater is create with a soft knit that helps to keep her cozy and warm during the chillier months. The front of the top boasts of its large white star. The long sleeves are accented with silver zippers. Leggings are paired beneath this sweater featuring black pleather trimming and a large reptile skin pattern upon the red fabric. Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. (1) SM 7/8 ONLY LEFT. ^||,|$108.00$|,||,|FLOWERS-BY-ZOE-TWEEN-DESIGNER-SWEATER-LEGGINGS-RED|,|$URL$flowers-by-zoe-tween-designer-sweater-leggings-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-designer-sweater-with-leggings-in-red-1.jpg||-||Flowers by Zoe Tween Dress|,|^|From Flowers By Zoe, this tween dress is a new arrival for the spring and summer season! The wide neckline is outlined with sequins and sparkling gems. The white top of the dress leads into a fabulous colorblock blend. The dark navy matches a few other pieces from Flowers By Zoe while The bright coral pink is super fun. The dress is made with a soft rayon blend that allows slight stretch in its pull over fit. Made with rayon blend. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. ^||,|$38.00$|,||,|FLOWERS-BY-ZOE-TWEEN-DRESS|,|$URL$flowers-by-zoe-tween-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-dress-1.jpg||-||Flowers By Zoe Tween Dress Aqua with Sequins PREORDER|,|^|This gorgeous Flowers By Zoe tween dress will be perfect for any summer occasion. A light aqua blue covers this dress's inner lining, with thin straps and a circle skirt. An overlay of sheer fabric in the same color boasts a sequin chevron design that will make her the envy of all of her friends. This flowy style will surely be one of her fancy summer favorites. Flowers By Zoe runs small. Please order one size up. Please note that this is a PreOrder item and is NOT currently in stock. This Flowers by Zoe item is expected to arrive the week of March 2, 2015. ^||,|$98.00$|,||,|FLOWERS-BY-ZOE-TWEEN-DRESS-AQUA-SEQUINS|,|$URL$flowers-by-zoe-tween-dress-aqua-sequins.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-dress-aqua-with-sequins-preorder-1.jpg||-||Flowers by Zoe Tween Dress Black with Daisy Print (Size MD 10 & L 10/12)|,|^|A fabulous new dress from Flowers By Zoe, this tween outfit will certainly fill the season with fun! The black dress has a dress shirt hemline that accents the length of her legs. The waist is defined with a drawstring bow. The sleeveless bodice features a color and single pocket. the entire dress is covered with a fun flower print with large yellow centers. 100% polyester. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. SIZE MEDIUM (10) AND LARGE (10/12) ONLY LEFT.  ^||,|$49.00$|,||,|FLOWERS-BY-ZOE-TWEEN-DRESS-BLACK-DAISY-PRINT|,|$URL$flowers-by-zoe-tween-dress-black-daisy-print.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-dress-black-with-daisy-print-11.jpg||-||Flowers by Zoe Tween Formal Dress with Jewels in Teal|,|^|From Flowers By Zoe, this new tween special occasion dress is a gorgeous arrival for the holiday season. The bodice has a boat neckline wrapped in large jewels. A cute keyhole accents the back of the neckline. A teal chiffon overlay is covered with a clouded pattern. The dress is fully lined and is sure to look great by itself or with leggings worn underneath. Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up.  ^||,|$58.50$|,||,|FLOWERS-BY-ZOE-TWEEN-FORMAL-DRESS-JEWELS-TEAL|,|$URL$flowers-by-zoe-tween-formal-dress-jewels-teal.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-formal-dress-with-jewels-in-teal-1.jpg||-||Flowers By Zoe Tween Girls Dress in Coral with Black Sequin Trim (SM 7/8 & MD 10)|,|^|Created in the popular peachy coral, this new designer tween dress comes from Flowers By Zoe. The delicate color is a perfect compliment to her summer skin. The waist is dressed with black sequins while the sleeveless neckline matches. A bold black line divides the bodice down the center in the front and the back. The A-line skirt flows loose from the waist. This dress is sure to be a favorite and can easily be accessorized with leggings and a cute headband. Created with rayon or rayon blend fabrics. Hand wash with care and line dry. Flowers By Zoe runs small. Please order one size up. SIZE SMALL (7/8) AND MEDIUM (10) ONLY LEFT. ^||,|$49.00$|,||,|FLOWERS-BY-ZOE-TWEEN-GIRLS-DRESS-CORAL-BLACK-SEQUIN-TRIM|,|$URL$flowers-by-zoe-tween-girls-dress-coral-black-sequin-trim.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-girls-dress-in-coral-with-black-sequin-trim-1.jpg||-||Flowers by Zoe Tween Gold Rose Dress|,|^|Sweet roses fill this new tween dress from Flowers By Zoe. The black dress features a high neckline with a keyhole found on the back. The black fabric is soft against her skin and is cut for a classic A-line shape. Metallic gold blooms cover the dress completely. Shining studs are subtle accents that complete the look. Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. ^||,|$48.00$|,||,|FLOWERS-BY-ZOE-TWEEN-GOLD-ROSE-DRESS|,|$URL$flowers-by-zoe-tween-gold-rose-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-gold-rose-dress-1.jpg||-||Flowers By Zoe Tween Grey Peace Short Set (MD 10)|,|^|Your tween will love this new design from Flowers By Zoe. A large orange peace symbol adorns the front of the soft grey top with silver studs accenting the sleeveless neckline. The fringed hem adds loads of fun and allows the neon tie dyed shorts to peak from beneath. Top is rayon, shorts are cotton. Both are hand wash, hang to dry. Flowers by Zoe runs small, please consider ordering one size up. ONE SIZE MEDIUM 10 LEFT. ^||,|$42.33$|,||,|FLOWERS-BY-ZOE-TWEEN-GREY-PEACE-SET|,|$URL$flowers-by-zoe-tween-grey-peace-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-grey-peace-short-set-14.jpg||-||Flowers By Zoe Tween Lavender Tank with Crochet Shorts (LG 10/12)|,|^|Your tween can't help but smile when she wears this smiling tank set from Flowers By Zoe. The whimsical smiley face on the lower left of the top is so cute with it's daisy eyes! The tank style bodice in lavender has thin straps and a sharkbite style hemline. The shorts boast of a multi-color crochet overlay done in a floral pattern. They are fully lined. Polyester/rayon. Hand wash, line dry both garments. Flowers by Zoe runs small, please consider ordering one size up. Deeper discount due to top being LG and shorts being XL. Fits like large. LARGE ONLY LEFT.  ^||,|$34.33$|,||,|FLOWERS-BY-ZOE-TWEEN-LAVENDER-TANK-CROCHET-SHORTS|,|$URL$flowers-by-zoe-tween-lavender-tank-crochet-shorts.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-lavender-tank-with-crochet-shorts-14.jpg||-||Flowers By Zoe Tween Leopard Top with Black Skirt|,|Another fabulous style for your tween, Flowers By Zoe is now offering this trendy outfit for her days at school. The long sleeve top boasts of a wild leopard print with vibrant colors while a black line stripes down both sleeves adorned with silver studs. The short skirt allows stretch in its fitted look. The front of the skirt is detailed with silver studs in a diamond pattern. Hand wash cold, line dry. |,|$38.33$|,||,|FLOWERS-BY-ZOE-TWEEN-LEOPARD-TOP-BLACK-SKIRT|,|$URL$flowers-by-zoe-tween-leopard-top-black-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-leopard-top-with-black-skirt-2.jpg||-||Flowers By Zoe Tween Mint Daisy with Lace Shorts Set (Size MD 10)|,|^|Fresh as a daisy and laced with style, this tween shorts set is from Flowers By Zoe. The mint green top boasts of a large white sequined daisy at the center of the front. Adjustable straps are featured at the shoulders and the hem is done in the sharkbite style. The shorts are of a beautiful lace in muted tones of pastel colors and are lined. Faux pockets are on the front and lace pockets adorn the back. Top is made of rayon, shorts are made from polyester and rayon. Hand wash, line dry. Flowers by Zoe runs small, please consider ordering one size up. (1) SIZE MD (10) ONLY LEFT.  ^||,|$38.33$|,||,|FLOWERS-BY-ZOE-TWEEN-MINT-DAISY-LACE-SHORTS-SET|,|$URL$flowers-by-zoe-tween-mint-daisy-lace-shorts-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-mint-daisy-with-lace-shorts-set-13.jpg||-||Flowers by Zoe Tween Pastel Lace Dress (LG 10/12)|,|^|An undeniable style that is sure to be on her top favorite list for the season, this new tween dress comes from Flowers By Zoe. The sleeveless bodice has a strappy neckline accented with silver studs. The rainbow fabric of the dress allows slight stretch and is covered with an electric print. White lace overlays the entire dress. The skirt opens in shape from the waistline to a half circle shape. 100% polyester. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. ONE LARGE (10/12) ONLY LEFT.  ^||,|$27.33$|,||,|FLOWERS-BY-ZOE-TWEEN-PASTEL-LACE-DRESS|,|$URL$flowers-by-zoe-tween-pastel-lace-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-pastel-lace-dress-1.jpg||-||Flowers By Zoe Tween Pleather Skirt with Heart Top (Size LG 10 & XL 12/14)|,|^|Another blend of style, this Flowers By Zoe outfit looks fabulous together, but each piece will make many great outfits for the school year. The long sleeve top lays claim only to a large plaid heart that sits on the front and matches the patterned back. Silver grommets outline the shape while long sleeves help to keep her warm. A short black pleather skirt offers a silver studded waist and a shorter cut. Top: 100% rayon. Skirt: Made with nylon blend. Hand wash cold, line dry. Please note that the Flowers By Zoe brand runs small. Please consider ordering a size up. LARGE (10/12) AND XLARGE (12/14) ONLY LEFT.  ^||,|$38.33$|,||,|FLOWERS-BY-ZOE-TWEEN-PLEATHER-SKIRT-HEART-TOP|,|$URL$flowers-by-zoe-tween-pleather-skirt-heart-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-pleather-skirt-with-heart-top-2.jpg||-||Flowers by Zoe Tween Red Top in Snakeskin with Leggings|,|^|New from trendy designer Flowers By Zoe, this new outfit is a lovely creation from their fall and winter line. The tunic is covered with a large snake skin pattern, the black standing out from the red background. The long sleeves are ideal for the cooler months. The hemline is cut for a trendy Hi-Low shape. Beneath the top we find the solid black leggings that are comfortable to wear all day and are accented with two zippers. The trimming found on the side of her leg and at the waist are in pleather. Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. ^||,|$64.50$|,||,|FLOWERS-BY-ZOE-TWEEN-RED-TOP-SNAKESKIN-LEGGINGS|,|$URL$flowers-by-zoe-tween-red-top-snakeskin-leggings.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-red-top-in-snakeskin-with-leggings-1.jpg||-||Flowers by Zoe Tween Rose Dress with Jeweled Top|,|^|Flowers By Zoe is now offering this fabulous designer dress for your tween daughter. The bodice features a sheer black overlay with a blouson fit and a keyhole back. The neckline is sleeveless and a traditional shape while small jewels sit upon the front. The skirt is fitted and covered with brushed gold roses. Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. ^||,|$51.75$|,||,|FLOWERS-BY-ZOE-TWEEN-ROSE-DRESS-JEWELED-TOP|,|$URL$flowers-by-zoe-tween-rose-dress-jeweled-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-rose-dress-with-jeweled-top-1.jpg||-||Flowers By Zoe Tween Short Set with Trendy Tank PREORDER|,|^|Flowers by Zoe brings us this adorable tween short set for the summer months. The top will keep her nice and breezy with it's sleeveless style. A large Hawaiian heart graphic covers the front of the top, while the sides are airbrushed with yellow and pink. Two ties accent either side of the hem. The shorts are covered in the Hawaiian print and are made with an elastic waist for comfort. Flowers By Zoe runs small. Please order one size up. Please note that this is a PreOrder item and is NOT currently in stock. This Flowers by Zoe item is expected to arrive the week of March 2, 2015. ^||,|$72.00$|,||,|FLOWERS-BY-ZOE-TWEEN-SHORT-SET-TRENDY-TANK|,|$URL$flowers-by-zoe-tween-short-set-trendy-tank.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-short-set-with-trendy-tank-preorder-1.jpg||-||Flowers By Zoe Tween Silver Pleather Shorts with Studs |,|^|A twist in style, these new Flowers By Zoe shorts are available in tween sizes only. The silver pleather has a brilliant sheen in the light while a classic zipper and button fly fasten in the front. Belt loops run around her waist for her to accessorize with a belt if desired. Stitching on the shorts create a quilted look while studs sit upon the intersections. 100% Polyester. Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. ONE X-LARGE (12/14) LEFT.  ^||,|$42.00$|,||,|FLOWERS-BY-ZOE-TWEEN-SILVER-PLEATHER-SHORTS-STUDS|,|$URL$flowers-by-zoe-tween-silver-pleather-shorts-studs.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-silver-pleather-shorts-with-studs-1.jpg||-||Flowers by Zoe Tween Skater Dress with Daisies (MD 10 & LG 10/12)|,|^|Cut in a style that is easy to love, this new tween dress comes from Flowers by Zoe. The ""skater"" style is defined by a fitted top and a relaxed skirt like you see figure skaters wear on the rink. The black dress features a few straps across the back and a scoop neckline. The large white flower print is covered with sparkling gems on the front and plain upon the skirt. Made with rayon blend. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. MEDIUM (10) AND LARGE (10/12) ONLY LEFT.  ^||,|$49.00$|,||,|FLOWERS-BY-ZOE-TWEEN-SKATER-DRESS-DAISIES|,|$URL$flowers-by-zoe-tween-skater-dress-daisies.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-skater-dress-with-daisies-11.jpg||-||Flowers By Zoe Tween Tank and Shorts Graffiti Love PREORDER|,|^|A colorful Flowers By Zoe short set is just what she needs in the warmer months. The sleeveless, flowy top will be nice and breezy with it's softer, lightweight material. The back is covered in the bold graffiti print we've seen throughout this collection. The front is a bright pink with a large psychedelic ""Give Love"" graphic across the front, complete with peace signs and rainbows. The white denim shorts have a frayed hem giving them a retro look. Peeking under the hem are the pockets with the graffiti pattern once again. ""LOVE"" is what we see across the front of the shorts as if it was written in marker. Flowers By Zoe runs small. Please order one size up. Please note that this is a PreOrder item and is NOT currently in stock. This Flowers by Zoe item is expected to arrive the week of February 2, 2015. ^||,|$94.00$|,||,|FLOWERS-BY-ZOE-TWEEN-TANK-SHORTS-GRAFFITI-LOVE|,|$URL$flowers-by-zoe-tween-tank-shorts-graffiti-love.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-tank-and-shorts-graffiti-love-preorder-1.jpg||-||Flowers By Zoe Tween Top Aloha Hawaii PREORDER|,|^|Known for being bright and colorful, this Flowers By Zoe top is no exception. The baseball style tee is first noticed by the bright and colorful floral print that creates the 3/4 length sleeves. The neckline is outlined in black while on the front is a large ""Aloha 18"" graphic print. Pair it with any of her new summer shorts to complete the look. Flowers By Zoe runs small. Please order one size up. Please note that this is a PreOrder item and is NOT currently in stock. This Flowers by Zoe item is expected to arrive the week of March 2, 2015. ^||,|$42.00$|,||,|FLOWERS-BY-ZOE-TWEEN-TOP-ALOHA-HAWAII|,|$URL$flowers-by-zoe-tween-top-aloha-hawaii.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-top-aloha-hawaii-preorder-1.jpg||-||Flowers By Zoe Tween Top and Short Set in Colorful Paisley PREORDER|,|^|Flowers By Zoe brings us this cute tween short set she's sure to love this summer. The lively paisley print covering the top blends yellows, pinks and oranges effortlessly. The loose fitting short sleeved top will keep her comfortable and breezy. The drawstring shorts are lined with pleather around the waistline and hems. Flowers By Zoe runs small. Please order one size up. Please note that this is a PreOrder item and is NOT currently in stock. This Flowers by Zoe item is expected to arrive the week of February 2, 2015. ^||,|$72.00$|,||,|FLOWERS-BY-ZOE-TWEEN-TOP-SHORT-SET-COLORFUL-PAISLEY|,|$URL$flowers-by-zoe-tween-top-short-set-colorful-paisley.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-top-and-short-set-in-colorful-paisley-preorder-5.jpg||-||Flowers By Zoe Tween Top and Skirt Pink Lips (LG 10/12 & XL 12/14)|,|^|A designer outfit that her friends will love and envy, this new arrival comes from the fall and winter line by Flowers By Zoe. The top has a cropped finish that hits right at her waist while the lighter weight fabric makes it easy to layer. The pink long sleeves compliment the lip screen prints that cover the front and are accented with sparkling gems. A fun skirt is paired beneath covered in a white and black clouded print with touches of pink. Subtle pleather accents finish the look of the skater skirt. 100% Rayon. Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. SIZE LARGE (10/12) AND XLARGE (12/14) ONLY REMAINING. ^||,|$58.50$|,||,|FLOWERS-BY-ZOE-TWEEN-TOP-SKIRT-PINK-LIPS|,|$URL$flowers-by-zoe-tween-top-skirt-pink-lips.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-top-and-skirt-pink-lips-17.jpg||-||Flowers By Zoe Tween Top Hashtag Daisy PREORDER|,|^|Sure to be one of her favorites, this trendy top comes from Flowers By Zoe. A bright aqua color covers the look which is sure to be a popular color this season. The daisy patterned graphic front is outlined in a large black square. Inside the design ""#FRIDAY"" is embedded in the daisies. After all, who doesn't love Friday? Flowers By Zoe runs small. Please order one size up. Please note that this is a PreOrder item and is NOT currently in stock. This Flowers by Zoe item is expected to arrive the week of March 2, 2015. ^||,|$36.00$|,||,|FLOWERS-BY-ZOE-TWEEN-TOP-HASHTAG-DAISY|,|$URL$flowers-by-zoe-tween-top-hashtag-daisy.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-top-hashtag-daisy-preorder-1.jpg||-||Flowers By Zoe Tween Top with Matching Shorts Hello Graffiti PREORDER|,|^|Flowers By Zoe brings us this vibrant tween short set that will make her the envy of all her friends! A bright pink sleeveless top is made with a softer, light weight material to be smooth on her skin. A bold ""HELLO"" graphic is placed across the front, sprinkled with rhinestones. Two side ties accent either side of the hem. The shorts are made with a pleather material around the elastic drawstring waistband and hems. The fabric used for the majority of the short is the bright graffiti print we've seen so much of. Flowers By Zoe runs small. Please order one size up. Please note that this is a PreOrder item and is NOT currently in stock. This Flowers by Zoe item is expected to arrive the week of February 2, 2015. ^||,|$72.00$|,||,|FLOWERS-BY-ZOE-TWEEN-TOP-MATCHING-SHORTS-HELLO-GRAFFITI|,|$URL$flowers-by-zoe-tween-top-matching-shorts-hello-graffiti.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-top-with-matching-shorts-hello-graffiti-preorder-1.jpg||-||Flowers By Zoe Tween Tunic Top Paisley Jewell PREORDER|,|^|An embellished tween tunic is just what she needs this summer from Flowers By Zoe. The thin straps are covered in sparkly sequins while the neckline is embellished with a small, keyhole cutout in the front and back. The top is covered in a brighter version of a damask print with yellows, oranges and purples. Two layers of fabric complete the top giving it a tiered look around the hem. Flowers By Zoe runs small. Please order one size up. Please note that this is a PreOrder item and is NOT currently in stock. This Flowers by Zoe item is expected to arrive the week of February 2, 2015. ^||,|$52.00$|,||,|FLOWERS-BY-ZOE-TWEEN-TUNIC-TOP-PAISLEY-JEWELL|,|$URL$flowers-by-zoe-tween-tunic-top-paisley-jewell.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-tunic-top-paisley-jewell-preorder-1.jpg||-||Flowers by Zoe Tween Tunic Top with Gold Chain Neck|,|^|From Flowers By Zoe, this new tween tunic has arrived just in time to make her style the envy of all her school friends. The wide neckline is created with a golden chain. A ""v"" shaped slit is found in both the front and the back of the neck. The tunic has a loose fit that is casual and comfortable! Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. ^||,|$36.75$|,||,|FLOWERS-BY-ZOE-TWEEN-TUNIC-TOP-GOLD-CHAIN-NECK|,|$URL$flowers-by-zoe-tween-tunic-top-gold-chain-neck.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-tunic-top-with-gold-chain-neck-1.jpg||-||Flowers by Zoe Tween White Lace Dress with Pearl Collar|,|^|A beautiful holiday dress for tweens, this new arrival comes from the beloved designer Flowers By Zoe. The black bodice has a fitted shape with a sleeveless neckline. A single button closes the keyhole back while a sweet peter pan collar is dressed in glamorous beads. The skirt is an elegant white covered with a lace overlay. This dress is sure to stand out at any celebration she attends! Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. ^||,|$64.50$|,||,|FLOWERS-BY-ZOE-TWEEN-WHITE-LACE-DRESS-PEARL-COLLAR|,|$URL$flowers-by-zoe-tween-white-lace-dress-pearl-collar.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-white-lace-dress-with-pearl-collar-1.jpg||-||Flowers By Zoe White Leopard Print Tween Jacket (XL 12/14)|,|^|The perfect accessory for her summer attire from Flowers By Zoe, this jacket is so fun! The leopard print in white is accented with pink and mint down the sides of the jacket and inner edges of the sleeves. An array of silver studs grace the top panel beside the collar of the jacket. Silver buttons close the front as well as the top two pockets. Two hand pockets are also located on the lower half of the jacket. Cotton/spandex. Hand wash, line dry. Flowers by Zoe runs small, please consider ordering one size up. ONE XLARGE (12/14) ONLY LEFT. ^||,|$39.00$|,||,|FLOWERS-BY-ZOE-WHITE-LEOPARD-PRINT-TWEEN-JACKET|,|$URL$flowers-by-zoe-white-leopard-print-tween-jacket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-white-leopard-print-tween-jacket-15.jpg||-||Flowers By Zoe White Summer Top with Flag Graphic|,|^|Flowers By Zoe created this new tween top with love and style. The white short sleeve top is cut for a relaxed fit while the light weight fabric breathes easily in the hot sun. The front of the top has a mouth screen print accessorized with a stars and stripe lipstick. Touches of sparkle are added with many small studs. Matches the new flag leggings perfectly! Created with rayon or rayon blend fabrics. Hand wash with care and line dry. Flowers By Zoe runs small. Please order one size up. ^||,|$29.00$|,||,|FLOWERS-BY-ZOE-WHITE-SUMMER-TOP-FLAG-GRAPHIC|,|$URL$flowers-by-zoe-white-summer-top-flag-graphic.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-white-summer-top-with-flag-graphic-1.jpg||-||Flowers By Zoe Zap Pow Girls Pom Pom Shorts|,|^|Newly created by Flowers By Zoe, these fabulous tween shorts are sure to make a splash. The white fabric is soft and comfortable for all day wear while the elastic waistband has a secure, stretch fit. The loud pattern is inspired by the loved super hero graphic novels while it is filled with bold colors. The hem line is covered with a dancing pom pom trim. The relaxed fit of this style is one that she can love and is sure to match perfectly with all of the new ""comic love"" tops. Created with rayon or rayon blend fabrics. Hand wash with care and line dry. Flowers By Zoe runs small. Please order one size up. ^||,|$18.33$|,||,|FLOWERS-BY-ZOE-ZAP-POW-GIRLS-POM-POM-SHORTS|,|$URL$flowers-by-zoe-zap-pow-girls-pom-pom-shorts.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-zap-pow-girls-pom-pom-shorts-1.jpg||-||Funtasia Too Girls Coverup with Lavender Flowers|,| |,|$29.25$|,||,|FUNTASIA-TOO-GIRLS-COVERUP-LAVENDER-FLOWERS|,|$URL$funtasia-too-girls-coverup-lavender-flowers.html|,|||-||Funtasia Too Girls One Piece Swimsuit with Lavender Flowers|,| |,|$29.25$|,||,|FUNTASIA-TOO-GIRLS-ONE-PIECE-SWIMSUIT-LAVENDER-FLOWERS|,|$URL$funtasia-too-girls-one-piece-swimsuit-lavender-flowers.html|,|||-||Funtasia Too Lavender Flower Towel|,| |,|$23.25$|,||,|FUNTASIA-TOO-LAVENDER-FLOWER-TOWEL|,|$URL$funtasia-too-lavender-flower-towel.html|,|||-||Giggle Moon Accessory Girls Headband in Red|,|^|Created to complete her ""Peace and Joy"" outfit, this designer girls headband is from Giggle Moon. The two flowers are accented with sequins or beads at the center while designed to be worn off to one side of the head. The red stripe band has an easy-to-wear stretch that is comfortable. A wrap headband is also available from this collection while supplies last. ^||,|$20.25$|,||,|GIGGLE-MOON-ACCESSORY-GIRLS-HEADBAND-RED|,|$URL$giggle-moon-accessory-girls-headband-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-accessory-girls-headband-in-red-preorder-12.jpg||-||Giggle Moon Apron Dress in Glory Shines|,|^|From the ""Glory Shines"" collection, this Giggle Moon dress matches several other outfits, making it a breeze to plan family photos! The empire bodice is a warm yellow and features a lacey peter pan collar. A keyhole on the back is fastened with a snap. The waist ties on the back in a bow and is accented with a fuchsia flower. The green skirt opens in shape for a relaxed fit while the front has an apron overlay in pink. Cotton/Spandex. Machine wash on gentle cycle. Tumble dry on low. Made in the USA. ^||,|$51.00$|,||,|GIGGLE-MOON-APRON-DRESS-GLORY-SHINES|,|$URL$giggle-moon-apron-dress-glory-shines.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-apron-dress-in-glory-shines-17.jpg||-||Giggle Moon Baby Green Pastures Tillie Apron Dress - Size 6X & 7|,|^|Giggle Moon Baby offers adorable little girls clothing with comfort in mind. Beautiful cabbage roses spring across the green fabric skirting while a ruffled blue apron sits atop. The coordinating fabric waistband features a trio of buttons. The dress is completed with a soft cotton knit bodice and eyelet trim. Wash cool gentle cycle, lay flat to dry. Made in the USA. SIZE 6X AND 7 ONLY LEFT.  ^||,|$49.00$|,||,|GIGGLE-MOON-BABY-GREEN-PASTURES-TILLIE-APRON-DRESS|,|$URL$giggle-moon-baby-green-pastures-tillie-apron-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-baby-green-pastures-tillie-apron-dress-13.jpg||-||Giggle Moon Chloe Pants with Tunic Peace and Joy|,|^|Matching perfectly to her sisters ""Peace and Joy"" outfit, this new tunic and pant set looks fabulous in family photos! Giggle Moon fills this collection with warm red and cool teal blue with small touches of green. The tunic has an empire waist fit with a grey flower off centered on the green fabric. The rest of the tunic is divided by the two different patterns. Pockets are also placed upon the skirt. Teal leggings are worn beneath with tiered ruffles at the hem. PROUDLY MADE IN THE USA. Cotton and Spandex Blend. Machine wash in cold water. Tumble dry in low heat. ^||,|$54.00$|,||,|GIGGLE-MOON-CHLOE-PANTS-TUNIC-PEACE-JOY|,|$URL$giggle-moon-chloe-pants-tunic-peace-joy.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-chloe-pants-with-tunic-peace-and-joy-preorder-17.jpg||-||Giggle Moon Girls Designer Outfit Peace and Joy|,|^|This new outfit was designed by Giggle Moon in their ""Peace and Joy"" collection. The fun tunic blends the beautiful colors of red and teal together perfectly. A touch of green is found defining the empire waist complete with a single flower. The skirt is finished with a two tone, polka dot ruffle hem. The striped leggings match the bodice and have an elastic waistline. A double ruffle caps off both legs. PROUDLY MADE IN THE USA. Cotton and Spandex Blend. Machine wash in cold water. Tumble dry in low heat. ^||,|$51.00$|,||,|GIGGLE-MOON-GIRLS-DESIGNER-OUTFIT-PEACE-JOY|,|$URL$giggle-moon-girls-designer-outfit-peace-joy.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-girls-designer-outfit-peace-and-joy-preorder-12.jpg||-||Giggle Moon Girls Party Dress Treasured Possession|,|^|Matching several new arrivals, this new Giggle Moon dress is part of the ""Treasured Possession"" collection for fall. The bodice is covered in wide stripes and offers long sleeves. The cuffs are dressed with ruffles while the neckline is trimmed with a sheer, scallop ruffle. The skirt opens to a full circle shape. Alternating fabrics are filled with bold colors that blend together for a unique look! Cotton/Spandex Blend. Machine Wash in Cold Water. Lay Flat to Dry. ^||,|$55.50$|,||,|GIGGLE-MOON-GIRLS-PARTY-DRESS-TREASURED-POSSESSION|,|$URL$giggle-moon-girls-party-dress-treasured-possession.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-girls-party-dress-treasured-possession-preorder-22.jpg||-||Giggle Moon Girls Swing Set Sweet as Honey - 3 Mos|,|^|A fun new arrival from designer Giggle Moon, this girls swing set is part of the ""Sweet as Honey"" collection for spring and summer. The sleeveless top boasts of its vibrant yellow damask print. A deep pink yoke is decorated with two centered buttons and a lace border. The hemline dances with a fun blue ruffle that is accented with matching lace. The matching pants are striped from her elastic hemline. The same colorful print creates the loved bell hem. (1) 3 MOS ONLY LEFT. ^||,|$52.00$|,||,|GIGGLE-MOON-GIRLS-SWING-SET-SWEET-AS-HONEY|,|$URL$giggle-moon-girls-swing-set-sweet-as-honey.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-girls-swing-set-sweet-as-honey-10.jpg||-||Giggle Moon Glory Shines Girls Boutique Outfit|,|^|Giggle Moon is offering this fabulous girls outfit as a part of their ""Glory Shines"" collection for fall. The top is covered with a yellow geo print and offers long sleeves. The yoke is trimmed with a ruffle and dressed with two large buttons in the center. The top is finished with a wide ruffle hem in a contrasting green floral. The matching pants are made with coordinating prints in bright pink and green. The double bell hem on both legs is adorable. Fabric allows slight stretch in fit. Cotton/Spandex. Wash on gentle cycle in cool water. Lay flat to dry. Made in the USA. ^||,|$51.00$|,||,|GIGGLE-MOON-GLORY-SHINES-GIRLS-BOUTIQUE-OUTFIT|,|$URL$giggle-moon-glory-shines-girls-boutique-outfit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-glory-shines-girls-boutique-outfit-8.jpg||-||Giggle Moon Glory Shines Headband (Size Toddler 2T-8)|,|^|Matching perfectly to any of her new clothing from the Giggle Moon ""Glory Shines"" collection, this girls headband is a must have! The cotton headband has an easy stretch with a comfortable fit. A white pattern stands out from the rich candy pink. Meant to sit off to one side, we find two sweet flower blooms in soft velvet fabric in pink and green. Cotton/Spandex. Wash in cool water on gentle cycle. Lay flat to dry. Made in the USA. SIZE TODDLER 2T-8 LEFT.  ^||,|$20.25$|,||,|GIGGLE-MOON-GLORY-SHINES-HEADBAND|,|$URL$giggle-moon-glory-shines-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-glory-shines-headband-preorder-12.jpg||-||Giggle Moon Glory Shines Tutu Dress with Legging|,|A golden yellow dress that is sure to become a favorite, this new arrival is from Giggle Moon. The bodice boasts of long sleeves in the fun geo print while the floral yoke is finished with a sheer scallop ruffle. The pink waist ties on her back while a single rose sits off centered on the front. The skirt is created with a graceful tulle that drapes beautifully in rich pink finished with layers of yellow ruffles at the hem. The leggings are worn beneath in a bold pink and finished with a double bell ruffle. Cotton/Spandex. Machine wash gentle. Tumble dry on low. Made in the USA. |,|$57.00$|,||,|GIGGLE-MOON-GLORY-SHINES-TUTU-DRESS-LEGGING|,|$URL$giggle-moon-glory-shines-tutu-dress-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-glory-shines-tutu-dress-with-legging-11.jpg||-||Giggle Moon Golden Crown Stretch Headband|,|^|Matching the tutu dress and the mabel dress from the ""Golden Crown"" collection, this headband for girls comes from Giggle Moon. The stretch headband is striped in pink and grey and provides a comfortable fit. Georgette fabric in sheer blue and fuchsia create the darling flowers that sit off to one side of her head. Both flowers are finished with a large, decorative pearl center. ^||,|$20.25$|,||,|GIGGLE-MOON-GOLDEN-CROWN-STRETCH-HEADBAND|,|$URL$giggle-moon-golden-crown-stretch-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-golden-crown-stretch-headband-8.jpg||-||Giggle Moon Golden Crown Tutu Dress and Legging|,|^|A part of the ""Golden Crown"" collection, this new girls tutu dress was designed by Giggle Moon for the fall and winter seasons. The bodice of the dress offers her long sleeves while wrapped in grey and pink stripes. The yellow, floral waistline is tied in the back creating a large bow while a fabric flower accent sits off centered on the front with a pearl center. Layers of fuchsia tulle fall down the skirt in a full circle shape. Tiers of blue ruffles frost the hemline. Paired beneath are pink plaid leggings with double ruffle hemlines. Proudly Made in the USA. This outfit is a cotton/spandex blend. Machine wash on the gentle cycle in cold water and hang to dry. ^||,|$57.00$|,||,|GIGGLE-MOON-GOLDEN-CROWN-TUTU-DRESS-LEGGING|,|$URL$giggle-moon-golden-crown-tutu-dress-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-golden-crown-tutu-dress-and-legging-8.jpg||-||Giggle Moon Green Pastures Connie Skirt Set|,|^|A wonderful spring arrival from Giggle Moon, this girls skirt and top are part of the blooming ""Green Pastures"" collection. The striped top features a wide hemline that ruffles around in the sweet vintage floral and line print. Two large buttons are found just beneath the jewel neckline framed with an eyelet ruffle. Behind the buttons we find a large floral print that really pops out from the neutral fabrics. The fun, full circle skirt boasts of a blooming green print, elastic waistline, and a blue dot print that peeks out as it ruffles just beneath. The extra fabric provides great movement with her every step! ^||,|$65.60$|,||,|GIGGLE-MOON-GREEN-PASTURES-CONNIE-SKIRT-SET|,|$URL$giggle-moon-green-pastures-connie-skirt-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-green-pastures-connie-skirt-set-6.jpg||-||Giggle Moon Green Pastures Floral Headwrap|,|^|Created to match the new arrivals from Giggle Moon's ""Green Pastures"" collection, this girls headband is a fun way to accessorize her new outfits! The blue fabric is covered with a unique dotted print. Tying the head wrap at the back of her head allows for a custom fit. Off set to one side is a fun duo of flowers in matching shades. ^||,|$21.60$|,||,|GIGGLE-MOON-GREEN-PASTURES-FLORAL-HEADWRAP|,|$URL$giggle-moon-green-pastures-floral-headwrap.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-green-pastures-floral-headwrap-1.jpg||-||Giggle Moon Green Pastures Suzy Pant Set|,|^|Giggle Moon is now offering this fun girls outfit from their ""Green Pastures"" collection for the spring. The tank top is a soft fabric that allows slight stretch in its comfortable fit. A single blue dot pocket is off centered to the side and skirted with a fun eyelet fabric that is finished with a scallop edge. A single large button adorns the pocket. The neutral stripes can be paired with just about anything! Paired beneath are the fun green floral bottoms that have a stretch, pink waist ruffled with eyelet to match the floral bell ruffle hem. ^||,|$59.00$|,||,|GIGGLE-MOON-GREEN-PASTURES-SUZY-PANT-SET|,|$URL$giggle-moon-green-pastures-suzy-pant-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-green-pastures-suzy-pant-set-1.jpg||-||Giggle Moon Green Pastures Twirl Dress (Size 4) |,|^|A new part of the Giggle Moon ""Green Pastures"" collection, this girls dress is sure to be one of favorites! The pink empire bodice has a wide, elastic neckline that bunches to a cute peasant design. The blue waist is covered with dots and ties in a large bow on her back. The single large sheer flower is a deep shade and off centered. Opening to a full shape, the three tiers of fabric found on the skirt alternate between two floral prints. The shade of green is perfect to welcome in the spring time sun! SIZE 4 LEFT.  ^||,|$49.00$|,||,|GIGGLE-MOON-GREEN-PASTURES-TWIRL-DRESS|,|$URL$giggle-moon-green-pastures-twirl-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-green-pastures-twirl-dress-1.jpg||-||Giggle Moon Hair Accessory for Girls Glory Shines|,|^|Offering her a personalized fit, this new hair accessory was created by Giggle Moon. The floral pattern on the fabric headband is a perfect match to the ""Glory Shines"" collection. The piece is designed to tie at the back of her head with tail falling down her back. Two flowers sit side by side and are meant to be off centered on her head. The blooms are made in pink and green velvet. Cotton/Spandex. Wash in cool water on gentle cycle. Lay flat to dry. Made in the USA. ^||,|$20.25$|,||,|GIGGLE-MOON-HAIR-ACCESSORY-GIRLS-GLORY-SHINES|,|$URL$giggle-moon-hair-accessory-girls-glory-shines.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-hair-accessory-for-girls-glory-shines-preorder-17.jpg||-||Giggle Moon Hair Accessory for Girls Treasured Possession|,|^|Giggle Moon now offers this head wrap to match her new outfits from their ""Treasured Possession"" collection. The cotton fabric is colored with a pattern colored in turquoise and green. The accessory is tied at the back of her head for a custom fit. Off to the side of her head we find a flower duet. The bold orange and relaxed grey make an unlikely pair while sequins add a small touch. ^||,|$20.25$|,||,|GIGGLE-MOON-HAIR-ACCESSORY-GIRLS-TREASURED-POSSESSION|,|$URL$giggle-moon-hair-accessory-girls-treasured-possession.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-hair-accessory-for-girls-treasured-possession-preorder-22.jpg||-||Giggle Moon Mabel Dress and Legging Golden Crown|,|^|A darling dress perfect for running errands with mom or spending the day at school, this new arrival is from Giggle Moon's ""Golden Crown"" collection. The drop waist dress is covered in stripes while a patterned ruffle runs down the center with three buttons found on top. The skirt is a bright yellow covered with pink roses and finished with a circle hemline. Solid blue leggings are worn beneath the dress to add warmth and to accent the blue on the dress. These leggings are finished with a double ruffle. Proudly Made in the USA. This outfit is a cotton/spandex blend. Machine wash on the gentle cycle in cold water and hang to dry. ^||,|$54.00$|,||,|GIGGLE-MOON-MABEL-DRESS-LEGGING-GOLDEN-CROWN|,|$URL$giggle-moon-mabel-dress-legging-golden-crown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-mabel-dress-and-legging-golden-crown-18.jpg||-||Giggle Moon Mabel Dress Peace and Joy|,|^|A new creation as a part of the ""Peace and Joy"" collection, this arrival is sure to be loved as it arrives just in time for the holiday season. The dress is styled with a drop waist fit while wrapped in cream and red stripes. A satin ruffle runs down the center creating the bed for the large buttons. The skirt is divided into three tiers of different fabrics. The matching leggings are worn beneath while the hem is ruffled in a light polka dot. PROUDLY MADE IN THE USA. Cotton and Spandex Blend. Machine wash in cold water. Tumble dry in low heat. ^||,|$54.00$|,||,|GIGGLE-MOON-MABEL-DRESS-PEACE-JOY|,|$URL$giggle-moon-mabel-dress-peace-joy.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-mabel-dress-peace-and-joy-preorder-14.jpg||-||Giggle Moon Mabel Dress with Ruffled Legging (12 mos, 24 mos, 2T & 4)|,|Designed by Giggle Moon, this new girls dress is perfect for the warmer months. The bright yellow damask print covers the drop waist bodice. Her sleeveless neckline is trimmed with a lace ruffle on both shoulders to match the framing of the buttons that run down the center. The skirt is a fun deep pink print fabric. Matching yellow leggings are worn beneath with fun stripes. The double bell hem flips the stripes vertical and the elastic waist offers a comfortable fit. |,|$51.75$|,||,|GIGGLE-MOON-MABEL-DRESS-RUFFLED-LEGGING|,|$URL$giggle-moon-mabel-dress-ruffled-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-mabel-dress-with-ruffled-legging-5.jpg||-||Giggle Moon Mabel Girls Outfit Treasured Possession|,|^|Giggle Moon has created this beautiful little girls outfit as a part of their ""Treasured Possession"" collection. The mabel top boasts of a drop waist fit wrapped with bold green and blue ruffles. The long sleeves are capped off with polka dot ruffle cuffs. The hemline has a wide ruffle that skirts around in a bold orange fabric. Down the center of the top we have a ruffle bed upon which we find a trio of large buttons. The matching pants placed beneath are created with the same fabric that has a soft stretch fit. The hem of both legs are bell ruffles to finish the outfit off perfectly! Made in the USA. Cotton/Spandex Blend. Machine Wash in Cold Water. Tumble Dry Low. ^||,|$54.00$|,||,|GIGGLE-MOON-MABEL-GIRLS-OUTFIT-TREASURED-POSSESSION|,|$URL$giggle-moon-mabel-girls-outfit-treasured-possession.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-mabel-girls-outfit-treasured-possession-preorder-17.jpg||-||Giggle Moon Maddison Girls Outfit Thankful Hearts|,|^|Matching many new pieces created by Giggle Moon, this dress and pant set is filled with the orange and lime of the ""Thankful Hearts"" collection. The bold striped bodice has an empire waistline that ties into a bow on the back. The fruit pattern is a sweet addition found on the cotton skirt. The matching pants have a casual fit with an elastic waistline. A double ruffle bell finishes off both legs to match the cuffs. ^||,|$49.00$|,||,|GIGGLE-MOON-MADDISON-GIRLS-OUTFIT-THANKFUL-HEARTS|,|$URL$giggle-moon-maddison-girls-outfit-thankful-hearts.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-maddison-girls-outfit-thankful-hearts-preorder-27.jpg||-||Giggle Moon Maddison Outfit for Girls|,|^|Part of the ""Glory Shines"" collection by Giggle Moon, this new boutique girls outfit is a beautiful creation she will love to wear any day. The top boasts of a bright candy pink empire bodice with long sleeves and a glitter yoke trimmed with a ruffle. The unique flower pattern covers the skirt of the tunic. Matching pants are worn beneath with a quaint polka dot print. The waist has an elastic stretch while the fabric is comfortable for all day wear. A double ruffle layers the hemline. Cotton/Spandex. Machine wash on gentle cycle. Tumble dry on low. Made in the USA. ^||,|$58.50$|,||,|GIGGLE-MOON-MADDISON-OUTFIT-GIRLS|,|$URL$giggle-moon-maddison-outfit-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-maddison-outfit-for-girls-preorder-17.jpg||-||Giggle Moon Morning Glory Dress with Capri|,|^|A beautiful blend of color, this new girls dress from Giggle Moon is a part of the ""Morning Glory"" collection. The empire bodice has a sleeveless neckline while dressed with a green and ivory chevron stripe print. The dotted waistline ties in the back while a single, off-centered flower is found on the front. The floral skirt is filled with rich tones and a ruffle peeks out beneath the hem. Matching capris are paired beneath with double bells at the hem. ^||,|$57.00$|,||,|GIGGLE-MOON-MORNING-GLORY-DRESS-CAPRI|,|$URL$giggle-moon-morning-glory-dress-capri.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-morning-glory-dress-with-capri-27.jpg||-||Giggle Moon Morning Glory Girls Party Dress|,|^|Part of Giggle Moon's spring collection, ""Morning Glory,"" this girls dress is filled with new life and lots of pink! The bodice is covered with a lattice print and the sleeveless neckline is accented with ruffles. The orange, empire waistline ties in a bow on her back and is dressed with a large flower in the front. The skirt opens in shape as it leads down to the hemline. Three different fabrics are tiered and coordinate in a unique look. A sheer ruffle peeks out beneath the skirt to finish the look! ^||,|$54.00$|,||,|GIGGLE-MOON-MORNING-GLORY-GIRLS-PARTY-DRESS|,|$URL$giggle-moon-morning-glory-girls-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-morning-glory-girls-party-dress-7.jpg||-||Giggle Moon Morning Glory Girls Swing Set|,|^|A fun outfit for girls from Giggle Moon, this new arrival is part of the ""Morning Glory"" collection. The sleeveless top boasts of its blend of two-tone, pink patterns. The hem is dressed with two tiers of printed fabric ruffles and just above we find a large orange flower. The bottoms are covered with a green and ivory stripe. The waist stretches with elastic for all day comfort while the bell hem has two layers and a pop of floral. ^||,|$49.50$|,||,|GIGGLE-MOON-MORNING-GLORY-GIRLS-SWING-SET|,|$URL$giggle-moon-morning-glory-girls-swing-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-morning-glory-girls-swing-set-23.jpg||-||Giggle Moon Morning Glory Lucy Dress for Girls|,|A spring and summer dress that welcomes warm sunrays, this new arrival was designed by Giggle Moon. The strappy bodice is green and ivory while the straight neckline is accented with a fun texture of trim. The pink rose fabric creates the skirt while two scoop pockets sit upon the front, accented with trims. The orange sorbet hemline is covered with fun spots to finish this look off right! |,|$51.00$|,||,|GIGGLE-MOON-MORNING-GLORY-LUCY-DRESS-GIRLS|,|$URL$giggle-moon-morning-glory-lucy-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-morning-glory-lucy-dress-for-girls-7.jpg||-||Giggle Moon Morning Glory Tutu Dress with Capri (Size 3 Mos, 9 Mos, & 18 Mos)|,|^|Sure to be a popular piece this coming spring and summer, this fabulous tutu dress from Giggle Moon is a part of their ""Morning Glory"" collection. The sleeveless bodice is striped in green and ivory, featuring a fabric that allows slight stretch in its fit. The wide floral waist is dressed with a orange rosette and ties behind her back. The skirt drapes in a full circle shape from her waist. The pink and orange tulle is as sweet as sorbet and gracefully dances around as she moves. Matching capris are found beneath boasting only of the double bell hemline. ^||,|$55.50$|,||,|GIGGLE-MOON-MORNING-GLORY-TUTU-DRESS-CAPRI|,|$URL$giggle-moon-morning-glory-tutu-dress-capri.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-morning-glory-tutu-dress-with-capri-1.jpg||-||Giggle Moon Peace and Joy Connie Skirt|,|^|Designer Giggle Moon is now offering this adorable girls outfit in their ""Peace and Joy"" holiday collection. The top is styled by a green empire waist with a grey flower found in the center. Above the waist we find red stripes while underneath large polka dots are colored in teal. The paired skirt is a full circle shape with horizontal panels of different fabric patterns. Two scoop pockets are also found on the skirt. MADE IN THE USA. Cotton and Spandex Blend. Machine wash in cold water. Tumble dry in low heat. ^||,|$61.50$|,||,|GIGGLE-MOON-PEACE-JOY-CONNIE-SKIRT|,|$URL$giggle-moon-peace-joy-connie-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-peace-and-joy-connie-skirt-preorder-12.jpg||-||Giggle Moon Peace and Joy Head Wrap|,|^|Giggle Moon's ""Peace and Joy"" collection is loveable and unique. This hair accessory was made to compliment the dresses and outfits from this collection. The headband is a cotton fabric patterned with a fun design. Tying at the back of her head, this piece offers her a personalized fit. Two flowers sit together off to one side of her head. The centers of these flowers are accented with sequins. ^||,|$20.25$|,||,|GIGGLE-MOON-PEACE-JOY-HEAD-WRAP|,|$URL$giggle-moon-peace-joy-head-wrap.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-peace-and-joy-head-wrap-preorder-12.jpg||-||Giggle Moon Peace and Joy Romper for Baby Girls (Newborn, 9 Mos)|,|^|A unique look, this new baby romper was designed by Giggle Moon in their ""Peace and Joy"" collection. Red stripes wrap around the empire bodice and the long sleeves. The pale green waist is accented with a grey flower while the bodice and legs are covered in fun teal polka dots. Both legs are finished with a double ruffle hem. The fabric allows a soft stretch and changing snaps line the inseam. PROUDLY MADE IN THE USA. Cotton and Spandex Blend. Machine wash in cold water. Tumble dry in low heat. SIZE NEWBORN & 9 MOS ONLY LEFT.  ^||,|$45.75$|,||,|GIGGLE-MOON-PEACE-JOY-ROMPER-BABY-GIRLS|,|$URL$giggle-moon-peace-joy-romper-baby-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-peace-and-joy-romper-for-baby-girls-preorder-12.jpg||-||Giggle Moon Peace and Joy Tunic and Pant for Girls|,|Designed by Giggle Moon, this new girls dress and pant is a unique take for the holiday season. The bodice is cream and red with the chevron stripe point running down the center. A large grey flower sits off centered beneath the neckline. The teal skirt is cut with a handkerchief hemline and wrapped with a grey ruffle. Pockets are found upon the skirt in a pattern that stands out. Striped pants are worn beneath finished in a double ruffle created by a light teal polka dot. PROUDLY MADE IN THE USA. Cotton and Spandex Blend. Machine wash in cold water. Tumble dry in low heat. |,|$54.00$|,||,|GIGGLE-MOON-PEACE-JOY-TUNIC-PANT-GIRLS|,|$URL$giggle-moon-peace-joy-tunic-pant-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-peace-and-joy-tunic-and-pant-for-girls-preorder-17.jpg||-||Giggle Moon Pink Girls Romper Glory Shines|,|^|A beautiful gift for a sweet baby girl, this new designer baby romper comes from Giggle Moon as a part of the ""Glory Shines"" collection. The pink romper is covered with a scroll and flower print in white. A strip of glitter in fuchsia pink runs down the center framed with scallop lace and a soft rosette. The long sleeves are finished with a bell ruffle. The long legs are also finished with a ruffle but in a different fabric. Snaps are found on the inseam for changing. Cotton/Spandex. Machine wash on gentle cycle. Tumble dry on low. Made in the USA. NEWBORN & 6 MOS ONLY LEFT.  ^||,|$45.75$|,||,|GIGGLE-MOON-PINK-GIRLS-ROMPER-GLORY-SHINES|,|$URL$giggle-moon-pink-girls-romper-glory-shines.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-pink-girls-romper-glory-shines-15.jpg||-||Giggle Moon Simply Beautiful Lace Apron Dress (4, 5, 6X)|,|^|A sweet new creation from Giggle Moon, this darling pink apron dress is part of the ""Simply Beautiful"" collection. The empire bodice features wide shoulder straps and a lacey ruffle that accents the neckline. The wide waist is accented with a single, off-centered fabric rose. The light pink skirt is covered with a floral pattern and boasts of the dreamy lace apron front. The bottom of the apron is tiered in adorable ruffles, making this a piece filled with feminine charm. SIZE 4, 5 & 6 LEFT.  ^||,|$49.50$|,||,|GIGGLE-MOON-SIMPLY-BEAUTIFUL-LACE-APRON-DRESS|,|$URL$giggle-moon-simply-beautiful-lace-apron-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-simply-beautiful-lace-apron-dress-5.jpg||-||Giggle Moon Simply Beautiful Pink Tutu Dress with Capri - 3 Mos|,|^|A darling dress for birthdays or any spring celebration, this new tutu dress is from designer Giggle Moon. The light pink bodice boasts of a fitted cut and a fabric that allows a slight stretch. The empire waist is accented with a softer floral print that ties in a cute bow on her back and features a rosette on the front. The skirt is draped with light pink tulle that is frosted with ivory lace ruffles on the hemline. The skirt sways beautifully around her legs with each movement. Paired beneath are pink and ivory striped capris with double bell ruffles. ONE SIZE 3 MOS ONLY LEFT.  ^||,|$55.50$|,||,|GIGGLE-MOON-SIMPLY-BEAUTIFUL-PINK-TUTU-DRESS-CAPRI|,|$URL$giggle-moon-simply-beautiful-pink-tutu-dress-capri.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-simply-beautiful-pink-tutu-dress-with-capri-5.jpg||-||Giggle Moon Simply Beautiful Swing Set (Size 5 & 6)|,|^|A purely innocent sweetness, this new girls outfit from Giggle Moon is filled with love. The light pink top is tiered with three ruffles alternating from floral pattern to sweet ivory lace. The cotton fabric of the bodice allows slight stretch in its fit. Matching pink striped capris are worn beneath. Two ivory lace ruffles create a dreamy bell hemline. Matches all of the new arrivals in the ""Simply Beautiful"" collection for spring and summer. SIZE 5 & 6 LEFT.  ^||,|$49.50$|,||,|GIGGLE-MOON-SIMPLY-BEAUTIFUL-SWING-SET|,|$URL$giggle-moon-simply-beautiful-swing-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-simply-beautiful-swing-set-5.jpg||-||Giggle Moon Sweet as Honey Dress with Capri (3Mos, 12Mos, 4 & 5)|,|^|""Sweet as Honey,"" this new spring and summer collection from Giggle Moon is filled with wonderful girls dresses just like this 'Maddison' dress! The empire waist bodice is a bright yellow fabric that allows slight stretch in its fit. A rich pink fabric is found on the front of the waist, adorned with a green sheer flower. The kaleidoscope floral print covers the blue skirt while a cute ruffle peeks out from beneath. The capris are striped with the same rich shade and offers a double bell hem on both legs. ^||,|$57.00$|,||,|GIGGLE-MOON-SWEET-AS-HONEY-DRESS-CAPRI|,|$URL$giggle-moon-sweet-as-honey-dress-capri.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-sweet-as-honey-dress-with-capri-5.jpg||-||Giggle Moon Sweet as Honey Floral Headwrap|,|^|An adorable new accessory, this Giggle Moon headwrap is designed to match the Sweet as Honey collection, but she will want to wear it with everything! The blue floral fabric has touches of pink and yellow in the pattern. Tie the wrap at the back of her head with a knot or a bow. Off to one side of the front, a large pink flower is accompanied with a vibrant yellow bloom! YOUTH ONLY REMAINING.  ^||,|$20.25$|,||,|GIGGLE-MOON-SWEET-AS-HONEY-FLORAL-HEADWRAP|,|$URL$giggle-moon-sweet-as-honey-floral-headwrap.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-sweet-as-honey-floral-headwrap-10.jpg||-||Giggle Moon Thankful Hearts Baby Romper (Size 6 Mos)|,|^|Ready to celebrate fall, this new baby girls romper from Giggle Moon is part of their gorgeous ""Thankful Hearts"" collection. The romper features a beautiful blend of orange and lime green. The bodice boasts of a yoke collar decorated with two buttons and an eyelet ruffle. The long sleeves are finished with striped ruffles to match the double bell ruffle that caps off both legs. A row of changing snaps line her inseam. The fabric is a soft cotton that allows stretch in fit and is delicate on her skin.SIZE 6 MOS REMAINING. ^||,|$45.75$|,||,|GIGGLE-MOON-THANKFUL-HEARTS-BABY-ROMPER|,|$URL$giggle-moon-thankful-hearts-baby-romper.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-thankful-hearts-baby-romper-preorder-17.jpg||-||Giggle Moon Thankful Hearts Party Dress for Girls|,|A Giggle Moon creation, this new dress is a sweet design that both mother and daughter will love. The dress features a full circle skirt tiered by alternating patterns of fabrics. Her long sleeve bodice is completed by bell ruffle cuffs. The blend of warm oranges and lime green is filled with the feeling of the fall season. A green polka dot yoke is trimmed with an eyelet ruffle and accented by two buttons in the center. |,|$55.50$|,||,|GIGGLE-MOON-THANKFUL-HEARTS-PARTY-DRESS-GIRLS|,|$URL$giggle-moon-thankful-hearts-party-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-thankful-hearts-party-dress-for-girls-preorder-17.jpg||-||Giggle Moon Thankful Hearts Wrap Headband|,|^|From Giggle Moon, this girls hair accessory is the perfect match to any of the pieces from the ""Thankful Hearts"" collection. The fabric headband is tied at the back of her head, allowing her a fit that is all her own. Two flowers are placed upon the fabric, meant to sit off to one side of her head. One of the flowers is a rich orange layered with tulle while the other is a soft ivory with a sequin center. ^||,|$20.25$|,||,|GIGGLE-MOON-THANKFUL-HEARTS-WRAP-HEADBAND|,|$URL$giggle-moon-thankful-hearts-wrap-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-thankful-hearts-wrap-headband-preorder-17.jpg||-||Giggle Moon Treasured Possession Top and Ruffle Pant|,|^|Part of the unique ""Treasured Possession"" collection, this new arrival comes from Giggle Moon. The top boasts of an empire waist that ties into a large bow on her back and is accented with a single fabric bloom on the front. The long sleeves are finished with a single ruffle while the skirt of the tunic is a bold orange, paisley print. The pants are covered with the same fun stripes found on the bodice. Double bell hems are layered with two different cotton fabrics. Cotton/Spandex Blend. Machine Wash in Cold Water. Lay Flat to Dry. ^||,|$58.50$|,||,|GIGGLE-MOON-TREASURED-POSESSEION-TOP-RUFFLE-PANT|,|$URL$giggle-moon-treasured-posesseion-top-ruffle-pant.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-treasured-possession-top-and-ruffle-pant-preorder-17.jpg||-||Giggle Moon Tutu Dress and Legging Thankful Hearts|,|One of the famous styles from Giggle Moon, this tutu dress looks perfect in photographs! The empire bodice is covered with a modern flower print while a single ruffle creates the cuff on both long sleeves. The polka dot waist ties into a bow on her back while the yoke collar is home to two quaint buttons and a touch of eyelet fabric. The skirt is draped with a full circle, tulle overlay in orange with frosting ruffles in green. Matching leggings come with the dress to complete the outfit! |,|$57.00$|,||,|GIGGLE-MOON-TUTU-DRESS-LEGGING-THANKFUL-HEARTS|,|$URL$giggle-moon-tutu-dress-legging-thankful-hearts.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-tutu-dress-and-legging-thankful-hearts-preorder-22.jpg||-||Giggle Moon Tutu Dress Sweet as Honey - 3 Mos|,|^|Giggle Moon is now offering this unique girls dress from their ""Sweet as Honey"" collection. The bodice boasts of a fun damask print in yellow while the fabric allows slight stretch in fit. The empire waistline is a blue floral print that ties in the back. A large bow is found in the front, boasting of a patterned center. The skirt is draped with vibrant yellow tulle. The tiers of ruffles are like frosting on a cake as they gracefully move with her every step and sway. Matching striped leggings are placed beneath and finished with a double ruffle hemline. SIZE 3 MOS ONLY LEFT.  ^||,|$55.50$|,||,|GIGGLE-MOON-TUTU-DRESS-SWEET-AS-HONEY|,|$URL$giggle-moon-tutu-dress-sweet-as-honey.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-tutu-dress-sweet-as-honey-10.jpg||-||Girls Handmade Headband in Pink and Silver|,|^|Quickly becoming a favorite way to top off all of her beautiful outfits, this handmade pink headband is now available. The pink lace allows stretch to fit around her head while a matching light pink puff flower is made up of skinny loops of raw-edged tulle. Sitting to the side we find a sparkling silver flower and a darker grey flower splattered with intermittent glitter and featuring a pearl center. (1) MEDIUM (2T-4T) ONLY REMAINING.  ^||,|$21.75$|,||,|GIRLS-HANDMADE-HEADBAND-PINK-SILVER|,|$URL$girls-handmade-headband-pink-silver.html|,|http://ep.yimg.com/ay/yhst-17102259411242/girls-handmade-headband-in-pink-and-silver-12.jpg||-||Girls Handmade Peach Flower Clip with Jewel Center|,|Arriving just in time to compliment her many fall and winter outfits, this new girls hair clip is handmade with great love. The peach satin circles gather in the center and layer with their raw edges. A quaint jeweled center finishes off the clip with a dazzle. Placed upon an alligator pinch clip. |,|$12.00$|,||,|GIRLS-HANDMADE-PEACH-FLOWER-CLIP-JEWEL-CENTER|,|$URL$girls-handmade-peach-flower-clip-jewel-center.html|,|http://ep.yimg.com/ay/yhst-17102259411242/girls-handmade-peach-flower-clip-with-jewel-center-11.jpg||-||Girls Headband Made to Match Giggle Moon|,|^|Such a darling new arrival, this handmade boutique girls headband will finish off her new Giggle Moon outfit with whimsical beauty. The colors blend beautifully from the lime green, coral pink, and warm autumn orage. The trio of flowers boast of four separate textures introducting, chiffon, raw edges, satin, and sparkling tulle. The chocolate brown lace stretches around her head and perfectly compliments the vibrant garden. SIZE LARGE (4-ADULT) ONLY LEFT.  ^||,|$24.00$|,||,|GIRLS-HEADBAND-MADE-MATCH-GIGGLE-MOON|,|$URL$girls-headband-made-match-giggle-moon.html|,|http://ep.yimg.com/ay/yhst-17102259411242/girls-headband-made-to-match-giggle-moon-3.jpg||-||Halabaloo Blue and White Infant and Toddler Dress|,|Halabaloo is now offering this new dress as a part of their fun-filled spring collection. The dress features a shapeless fit created with a fabric that has a carefree drape. The front of the dress is framed with a scrolling print. The scoop neckline is made with thin black straps while the pleats fall down to open a relaxed fit. A keyhole in the back is tied shut with a matching bow. Cotton/Poly blend. Hand wash and line dry. |,|$52.50$|,||,|HALABALOO-BLUE-WHITE-INFANT-TODDLER-DRESS|,|$URL$halabaloo-blue-white-infant-toddler-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-blue-and-white-infant-and-toddler-dress-1.jpg||-||Halabaloo Blue Flare Dress with Pom Poms|,|A sweet new design by loved Halabaloo, this new girls dress is a part of their spring and summer collection. The boat neckline features thin shoulder straps and a sweet row of pom poms. The piece features an easy pull over fit that she can even do herself. The shape opens to a full circle, introduced by the panels of periwinkle blue fabric. The excess fabric flowers around her with every step that she takes. |,|$52.50$|,||,|HALABALOO-BLUE-FLARE-DRESS-POM-POMS|,|$URL$halabaloo-blue-flare-dress-pom-poms.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-blue-flare-dress-with-pom-poms-1.jpg||-||Halabaloo Couture Sparkle Dress for Girls|,|A perfect match to another special occasion dress by Halabaloo, this adorable design is perfect for a sister pair. The burgundy fabric is rich and filled with holiday cheer while featuring an embroidered design. Touches of metallic silver splatters catch the light. The cap sleeves frame the wide neckline and a hidden zipper funs up the back. The skirt opens to a full circle shape. This dress looks darling paired with leggings! 100% Polyester. Hand wash in cold water. Hang to dry. |,|$88.50$|,||,|HALABALOO-COUTURE-SPARKLE-DRESS-GIRLS|,|$URL$halabaloo-couture-sparkle-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-couture-sparkle-dress-for-girls-17.jpg||-||Halabaloo Elegant Girls Dress in Blue Lace (Size 5, 6 & 6X)|,|A true show stopper for the holiday season, this new Halabaloo dress is sure to make memories last a lifetime. The bodice features a classic waist and sheer cap sleeves. The metallic silver lining shines through the navy contrast as a hidden zipper closes the back. The sweet floral lace covers her from neck to hem while a matching satin sash ties around her waist in a bow. This dress is perfect for photos, gatherings, celebrations, and recitals! Lace: viscose and nylon; Lining: nylon and metal. Gently hand wash and line dry. |,|$38.33$|,||,|HALABALOO-ELEGANT-GIRLS-DRESS-BLUE-LACE|,|$URL$halabaloo-elegant-girls-dress-blue-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-elegant-girls-dress-in-blue-lace-2.jpg||-||Halabaloo Elegant Sparkle Tutu Dress for Little Girls|,|Glittering its way to the top, the girls tutu dress was designed by Halabaloo just in time for the holiday season. The bodice of this dress is a warm burgundy. Shimmering metallic silver splatters the embroidered bodice and catches the lighting. The silver skirt is created with several layers of tulle with the top glitter tulle becoming the perfect match for the bodice. The hemline is a hi-low cut. 100% Polyester. Hand Wash in Cold Water. Hang to Dry. |,|$85.50$|,||,|HALABALOO-ELEGANT-SPARKLE-TUTU-DRESS-LITTLE-GIRLS|,|$URL$halabaloo-elegant-sparkle-tutu-dress-little-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-elegant-sparkle-tutu-dress-for-little-girls-17.jpg||-||Halabaloo Garden Party Ivory Girls Dress (2T, 3T)|,|^|Prepared for whatever event may be in her calendar, this new designer girls flower dress comes from Halabaloo. The dress is draped from the neck to the hem with a sheer fabric covered with a quaint dot print. The strappy neckline has a scoop shape while accented with a garden of pastel flowers finished with shimmering centers. A small keyhole on the back with button closure. Nylon. Hand wash. Line dry. SIZE 2T & 3T ONLY LEFT. ^||,|$49.00$|,||,|HALABALOO-GARDEN-PARTY-IVORY-GIRLS-DRESS|,|$URL$halabaloo-garden-party-ivory-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-garden-party-ivory-girls-dress-1.jpg||-||Halabaloo Geo Print Dress for Girls (Size 18 Mos & 2T)|,|^|Bright and lively, this new designer dress for girls was created by New York brand, Halabaloo. The fun printed fabric is covered with orange, lime, and sky blue with small touches of pink. The dress features a high, wide neckline accented with a single fabric rosette. The back of the dress has a cute keyhole feature secured with a button. The fabric drapes down the dress with a flare, shapeless fit. The fabric responds actively to her movements has it sways around her legs. Cotton. Hand wash gently in cold water. Hang to dry. SIZE 18 MOS AND 2T ONLY LEFT.  ^||,|$49.00$|,||,|HALABALOO-GEO-PRINT-DRESS-GIRLS|,|$URL$halabaloo-geo-print-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-geo-print-dress-for-girls-17.jpg||-||Halabaloo Girls Fancy Lace Dress Princess|,|A gorgeous special occasion dress for girls was designed by Halabaloo. The dress was designed for a princess complete with a lace overlay bodice that has a golden shimmer beneath. The bodice has a subtle cap sleeve while a hidden zipper runs up the back. The fairy tale skirt is created with glitter tulle that captures the light and is lined for her comfort. 100% Polyester. Hand Wash in Cold Water. Hang to Dry. |,|$85.50$|,||,|HALABALOO-GIRLS-FANCY-LACE-DRESS-PRINCESS|,|$URL$halabaloo-girls-fancy-lace-dress-princess.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-girls-fancy-lace-dress-princess-12.jpg||-||Halabaloo Girls Fuchsia Feather Dress (2T)|,|^|From designer Halabaloo, this girls fuchsia feather dress has that wow factor! Resplendent in fuchsia, the dress has a mesh overlay simply covered in fuchsia feathers that dance about the front and back. The circular neckline has wide straps over her shoulders. A lining of the same dark fuchsia is found underneath the overlay. Made from nylon/polyester/acetate. Hand wash gently in cold water, line dry. Can also be dry cleaned. SIZE 2T ONLY AVAILABLE.  ^||,|$39.00$|,||,|HALABALOO-GIRLS-FUCHSIA-FEATHER-DRESS|,|$URL$halabaloo-girls-fuchsia-feather-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-girls-fuchsia-feather-dress-14.jpg||-||Halabaloo Girls Polka Dot Dress in Pink|,|^|Perfect for Easter and birthday celebrations, this new Halabaloo design is an adorable polka dot dress. The straight neckline offers her a comfortable smocked fit that allows stretch. The thin shoulder straps tie in a bow on the top of both shoulders. The sheer fabric is covered with the large dots and falls gracefully. The hemline is introduced with tiers of coordinating ruffles. Poly. Hand wash and line dry. SIZE 12 MOS & 18 MOS LEFT.  ^||,|$49.50$|,||,|HALABALOO-GIRLS-POLKA-DOT-DRESS-PINK|,|$URL$halabaloo-girls-polka-dot-dress-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-girls-polka-dot-dress-in-pink-1.jpg||-||Halabaloo Glitter Dot Girls Long Sleeve Dress with Bow (Size 4 & 6)|,|^|This new casual girls dress from designer Halabaloo speaks to her playful side. The comfortable knit bodice features long sleeves and a cute oversized bow just beneath the neckline. The skirt boasts of its tulle overlay covered with silver glitter polka dots. Perfect for the active little girl with style! Made with a stretch cotton blend, hand wash only with care. SIZE 4 & 6 LEFT.  ^||,|$37.00$|,||,|HALABALOO-GLITTER-DOT-GIRLS-LONG-SLEEVE-DRESS-BOW|,|$URL$halabaloo-glitter-dot-girls-long-sleeve-dress-bow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-glitter-dot-girls-long-sleeve-dress-with-bow-14.jpg||-||Halabaloo Ivory Dress Flower Girl - 4T, 5 & 6|,|A couture gown for girls, this new designer dress was created by Halabaloo. The light ivory endears itself to our hearts as it is dressed in rich, rosette texture. The sleeveless neckline is a jewel shape. A hidden zipper fastens in the back. A light sash is tied in a bow around her waist to define the empire height. The skirt is filled with volume that speaks to the grace of the dress. The rosette flowers glimmer in the light with a satin sheen. Polyester. Dry clean only. |,|$73.50$|,||,|HALABALOO-IVORY-DRESS-FLOWER-GIRL|,|$URL$halabaloo-ivory-dress-flower-girl.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-ivory-dress-flower-girl-1.jpg||-||Halabaloo Little Girls Lace Dress Fuchsia Fun|,|An elegant dress for her upcoming holiday celebrations, this new designer girls dress is from Halabaloo. The empire bodice is a bold fuchsia and features quant cap sleeves and a hidden zipper running up the back. A glitter tulle overlay adds a touch of shimmer while the matching lace is a gorgeous, textured finish. The skirt opens to a full circle shape and matches perfectly to the bodice. 100% Polyester. Hand wash in cold water. Hang to dry. |,|$91.50$|,||,|HALABALOO-LITTLE-GIRLS-LACE-DRESS-FUCHSIA-FUN|,|$URL$halabaloo-little-girls-lace-dress-fuchsia-fun.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-little-girls-lace-dress-fuchsia-fun-33.jpg||-||Halabaloo Neon Girls Party Dress|,|A brilliant new design, this fabulous girls dress comes from Halabaloo. The bright neon colors of yellow, orange, and pink stripe from head to hem. The wide boat neckline is accentuated by the straight stripes while a hidden zipper closes the fit in the back. The skirt opens in shape immediately from the waist. The sheer fabric falls gracefully and is fully lined. Poly. Hand wash. Line Dry. |,|$58.50$|,||,|HALABALOO-NEON-GIRLS-PARTY-DRESS|,|$URL$halabaloo-neon-girls-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-neon-girls-party-dress-1.jpg||-||Halabaloo Neon Rainbow Dress for Girls - 24 Mos & 2T|,|^|Matching the fabulous neon dress, this new design from Halabaloo is for the fashionista with a bright style. The flare dress drapes elegantly from the scoop neckline to the dancing hem. The pleats that fall from the neck open the shape while a cute bow ties the keyhole found on the back. The neon orange, pink and yellow fabric is sheer and feminine. The dress is lined in white. Poly. Hand wash cold and line dry. SIZE 24 MOS AND 2T ONLY LEFT.  ^||,|$52.50$|,||,|HALABALOO-NEON-RAINBOW-DRESS-GIRLS|,|$URL$halabaloo-neon-rainbow-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-neon-rainbow-dress-for-girls-1.jpg||-||Halabaloo Pink Tulle Dress with Rosettes|,|A delicate, feminine design, this new girls dress comes from Halabaloo. The soft shade of pink holds an elegance of its own that is amplified by the swaying drape of the sheer, polka dot fabric. The neckline has a classic shape and a sleeveless cut while a single button fastens on the back. The hemline falls to an uneven shape. Small pink flowers are sprinkled upon the skirt. The sheer fabric opens to a full circle shape making it a perfect twirl dress. Nylon. Hand wash. Line dry. |,|$64.50$|,||,|HALABALOO-PINK-TULLE-DRESS-ROSETTES|,|$URL$halabaloo-pink-tulle-dress-rosettes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-pink-tulle-dress-with-rosettes-1.jpg||-||Halabaloo Red Sequin Dress for Girls (Size 3T & 6X)|,|^|Unlike any other dress she owns, this new Halabaloo dress is a fun-filled design sure to make her smile. The red dress offers slight gathers at the neckline and a hidden zipper that secures the fit. Her cap sleeves are simply darling! Large red sequins fall in lines on the red tulle overlay. This dress is fully lined for her comfort and privacy. Made with 100% polyester and 100% acetate. Hand wash delicately and hang to dry. SIZE 3T & 6X ONLY LEFT. ^||,|$49.00$|,||,|HALABALOO-RED-SEQUIN-HOLIDAY-DRESS-GIRLS|,|$URL$halabaloo-red-sequin-holiday-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-red-sequin-holiday-dress-for-girls-2.jpg||-||Halabaloo Scalloped Girls Dress with Bow|,|Halabaloo is now offering this little girls dress as a part of their fall and winter collection. This dress offers a wide neckline that is elegant and sophisticated. A hidden zipper fastens to secure the fit. A black sash ties into a bow around her waistline while the skirt opens in shape. The black dress is covered with a white fish scale design. Nylon/Polyester/Metallic Blend. Hand wash in cold water. Hang to dry. |,|$73.50$|,||,|HALABALOO-SCALLOPED-GIRLS-DRESS-BOW|,|$URL$halabaloo-scalloped-girls-dress-bow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-scalloped-girls-dress-with-bow-1.jpg||-||Handmade Girls Headband Pink Scallop Lace|,|A beautiful design for your darling daughter's new outfits, this girls headband is handmade with great attention to the details. The stretch band is a light pink lace with scalloped edges and a slight sheen to the floral design. An open bloom and spiral rosette sit off centered on her head while a gem center shines out. Small touches of tulle are found in the rosette as well as creating a small fan to peak out from behind the design. |,|$24.00$|,||,|HANDMADE-GIRLS-HEADBAND-PINK-SCALLOP-LACE|,|$URL$handmade-girls-headband-pink-scallop-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/handmade-girls-headband-pink-scallop-lace-13.jpg||-||Handmade Girls Pink Headband|,|^|Handmade by a local Indiana artist, Myka Stutzman, this new girls headband is absolutely a work of art. The light pink knit headband wraps around her head and boasts of a unique flower adornment. The wrapped rosette is accented with a crystal gem while the unique petal rosettes are created with flat satin, lace, and tulle. The trio of flowers measure roughly 5"" X 4.5"" and sit off to one side of her head. SIZE 4 TO 6X ONLY AVAILABLE. ^||,|$19.00$|,||,|HANDMADE-GIRLS-PINK-HEADBAND|,|$URL$handmade-girls-pink-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/handmade-girls-pink-headband-11.jpg||-||Handmade Red Headband |,|^|Absolutely gorgeous, this new girls headband outshines anything compared to it. The oversized flower boasts of multiple fabric and texture in the same warm shade. From satin to French netting and sheer shimmer ribbon, this girls headband is truly remarkable. A shimmering gem center compliments this fancy design. The flower is placed upon a stretch black lace band. This flower is a perfect match for the Giggle Moon Dance for Joy collection as well as many other LaBella Flora designers. Perfect for the holiday season! SIZE LARGE (AGE 4-10) ONLY LEFT.  ^||,|$19.00$|,||,|HANDMADE-RED-HEADBAND-SELLA-DESIGNS|,|$URL$handmade-red-headband-sella-designs.html|,|http://ep.yimg.com/ay/yhst-17102259411242/handmade-red-headband-1.jpg||-||Handmade Rosette Headband in Deep Red and Black|,|With such an elegant color combination, this headband is a LaBella Flora exclusive. The headband is an oh so soft black lace that will keep her comfortable with no itching. Two deep red rosettes offset a black tulle flower with silver detailing. Little wisps of thread on the edges of the flowers finish the look. Proudly crafted in the USA. |,|$24.00$|,||,|HANDMADE-ROSETTE-HEADBAND-DEEP-RED-BLACK|,|$URL$handmade-rosette-headband-deep-red-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/handmade-rosette-headband-in-deep-red-and-black-1.jpg||-||Handmade Teal Blue Sparkling Butterfly Headband|,|Made by local artisan, Myka Stutzman, this gorgeous headband is sure to please. Made to pair with the Moxie and Mabel Amelia Dress in Rodeo Blue, she will adore it. Whimsical fabric butterflies flit about on the teal blue headband. Rhinestone accents on their wings give some sparkle. |,|$19.50$|,||,|HANDMADE-TEAL-BLUE-SPARKLING-BUTTERFLY-HEADBAND|,|$URL$handmade-teal-blue-sparkling-butterfly-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/handmade-teal-blue-sparkling-butterfly-headband-16.jpg||-||Hannah Banana Black Flower Girls Tutu Skirt|,|^|Turning her favorite new tops into a stunning outfit, this tween tutu skirt comes from Hannah Banana. The black skirt is covered with a flower pattern to add great texture. The under layer of tulle that provides the great volume and movement peaks out from underneath the hem. 100% polyester. Hand wash cold, flat dry. ALL SOLD OUT 12/17/14. ^||,|$24.33$|,||,|HANNAH-BANANA-BLACK-FLOWER-GIRLS-TUTU-SKIRT|,|$URL$hannah-banana-black-flower-girls-tutu-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-black-flower-girls-tutu-skirt-2.jpg||-||Hannah Banana Black Pleather Girls Dress with Lace (5, 10)|,|^|Revealing the punk inspirations found in her wardrobe, this new Hannah Banana dress is rocking. The bodice boasts of a fitted shape, with the structure for this piece provided by the tucking on the front. Short sleeves and a hidden zipper finish the bodice along with a silver stud design. The black pleather opens up at the front of the skirt to allow the sweet black lace to peak out. Made with polyester blend. Hand wash cold, flat dry. SIZE 5 & 10 ONLY LEFT. ^||,|$39.00$|,||,|HANNAH-BANANA-BLACK-PLEATHER-GIRLS-DRESS-LACE|,|$URL$hannah-banana-black-pleather-girls-dress-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-black-pleather-girls-dress-with-lace-2.jpg||-||Hannah Banana Boutique Girls Dress Shark Bite Hem|,|^|Hannah Banana is now offering this adorable girls dress from their ""Magic Pink"" collection. The Bodice has an A-line cut and features an embroidered applique upon the front. The sweet notebook stripes alternate between white and pink. The skirt has a touch of glitter polka dot tulle. Brushed lace is found accenting the sides and defining the sharkbite shape. Polyester/Cotton. Hand wash inside out in cold water. Hang to dry. ^||,|$58.50$|,||,|HANNAH-BANANA-BOUTIQUE-GIRLS-DRESS-SHARK-BITE-HEM|,|$URL$hannah-banana-boutique-girls-dress-shark-bite-hem.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-boutique-girls-dress-shark-bite-hem-15.jpg||-||Hannah Banana Couture Dress for Tweens in White ( 7, 8 & 14)|,|The perfect casual dress for your tween this summer, this new design is from the loved brand, Hannah Banana. The bodice of this dress has a sleeveless neckline and an exposed zipper. Touches over lace overlay on the front and are complete with fun studs. The waist is defined with the same lacy fabric while the skirt falls in three tiers. The white sheer fabric is found on top while a lace creates the bottom layer. 100% cotton with polyester/spandex lining. Hand wash cold inside out, dry flat. |,|$63.00$|,||,|HANNAH-BANANA-COUTURE-DRESS-TWEENS-WHITE|,|$URL$hannah-banana-couture-dress-tweens-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-couture-dress-for-tweens-in-white-1.jpg||-||Hannah Banana Fancy Blooms High Low Maxi Dress PREORDER|,|^|Hannah Banana brings us this adorable trendy dress for spring and summer. The sleeveless style is made with gray heathered cotton for a comfortable fit. Crocheted lace details accent the entire front of the bodice in an interesting shape. The skirt is made with a bright and colorful vintage inspired floral print with a hi-lo hemline. This would look adorable with some gladiator sandals! Please note that this is a PreOrder item and is NOT currently in stock. This Hannah Banana item is expected to arrive between January 1 thru February 28, 2015. ^||,|$64.00$|,||,|HANNAH-BANANA-FANCY-BLOOMS-HIGH-LOW-MAXI-DRESS|,|$URL$hannah-banana-fancy-blooms-high-low-maxi-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-fancy-blooms-high-low-maxi-dress-preorder-1.jpg||-||Hannah Banana Faux Leather Tween Jegging with Studs (Size 14)|,|^|Edgy and trendy, these new jeggings from designer Hannah Banana will catch your tween's eye for style. The black legging boasts of its faux leather look insuring that no animal was harmed in their making. With the classic fitted look, these jeggings look great paired with tunics, dresses, and skirts. Catching the light and adding that perfect small touch, silver studs run down the outer side of both legs. Made with a polyester blend. Hand wash cold. SIZE 14 ONLY AVAILABLE.  ^||,|$24.33$|,||,|HANNAH-BANANA-FAUX-LEATHER-TWEEN-JEGGING-STUDS|,|$URL$hannah-banana-faux-leather-tween-jegging-studs.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-faux-leather-tween-jegging-with-studs-3.jpg||-||Hannah Banana Girls A-Line Dress in Geometric|,|Patterned with geometric shapes, this new girls dress was created by Hannah Banana. The dress features long sleeves in pink and a brown trim around the neck. Three large buttons fall from the center of the neckline while the stretch in the fabric allows for an easy pull over fit. The back of the dress matches the black and white ruffle hemline. Polyester/Spandex. Hand wash inside out in cold water. Lay flat to dry. |,|$54.00$|,||,|HANNAH-BANANA-GIRLS-A-LINE-DRESS-GEOMETRIC|,|$URL$hannah-banana-girls-a-line-dress-geometric.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-girls-a-line-dress-in-geometric-19.jpg||-||Hannah Banana Girls Back to School Dress|,|This new girls dress from Hannah Banana is a darling design that will look fabulous on the playground. The dress is cut for a straight, casual fit and features leopard print fabric creating the long sleeves. A zipper runs up the back of the dress to fasten the fit. A fabric applique forms a blooming flower upon the front, complete with two leaves. Polyester/Rayon/Spandex. Hand wash inside out in cold water. Hang to dry. |,|$46.50$|,||,|HANNAH-BANANA-GIRLS-BACK-SCHOOL-DRESS|,|$URL$hannah-banana-girls-back-school-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-girls-back-to-school-dress-16.jpg||-||Hannah Banana Girls Dress with Daisies|,|In a bold pink, this new Hannah Banana dress is part of the collection for spring and summer. The bodice of the dress features a white lining and a neckline that rises higher in the front. The back of the bodice has an exposed metal zipper. A braided belt ties around her waist in a knot or a bow while the ends are finished with colorful tassels. The skirt has the same lining that peaks through the pink mesh. Large sunflowers pattern the sheer fabric and the sleeveless neckline is easy to layer. You can almost do no wrong when accessorizing this fun piece! 100% polyester. Hand wash cold, lay flat to dry. |,|$39.00$|,||,|HANNAH-BANANA-GIRLS-DRESS-DAISIES|,|$URL$hannah-banana-girls-dress-daisies.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-girls-dress-with-daisies-17.jpg||-||Hannah Banana Girls Empire Waist Dress with Lace Applique PREORDER|,|^|In a fluttering summer style, this new dress comes to us from designer Hannah Banana. This trapeze style dress will offer a breezy fit with it's wide cut. The racer back design is created with crocheted lace details outlined in an orange chevron print. The 3 paneled skirt is made with fun summer colors with lace and crocheted accents. Please note that this is a PreOrder item and is NOT currently in stock. This Hannah Banana item is expected to arrive between January 1 thru February 28, 2015. ^||,|$54.00$|,||,|HANNAH-BANANA-GIRLS-EMPIRE-WAIST-DRESS-LACE-APPLIQUE|,|$URL$hannah-banana-girls-empire-waist-dress-lace-applique.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-girls-empire-waist-dress-with-lace-applique-preorder-12.jpg||-||Hannah Banana Girls Lace Dress in Ivory|,|In a white, this new girls dress comes from designer Hannah Banana and is such an adorable style. The sleeveless bodice features a neckline accented with a chevron stripe. The center of the bodice is accented with fabric applique lines. The skirt begins high because of the empire waistline. The lining is draped with a sweet white lace patterned in a flower print. The piece is finished with a handkerchief hemline. Hand wash cold, dry flat. 100% cotton with nylon lining. |,|$54.00$|,||,|HANNAH-BANANA-GIRLS-LACE-DRESS-IVORY|,|$URL$hannah-banana-girls-lace-dress-ivory.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-girls-lace-dress-in-ivory-17.jpg||-||Hannah Banana Girls Legging Outfit with Lace (7)|,|^|Hannah Banana is now offering this wonderful tunic and legging outfit for girls. The taupe top falls to a hi-low hem. The front of the top boasts of several different textures of fabric and color. This decoration includes crochet lace and an embroidered design found near the center. The bottom of the tunic features an ivory lace that falls from beneath the hem. Accompanying the top, the capri leggings are covered with a unique flower print. This outfit will be unlike anything else she has. Poly/rayon blend. Hand wash inside out, dry flat. SIZE 7 LEFT.  ^||,|$49.00$|,||,|HANNAH-BANANA-GIRLS-LEGGING-OUTFIT-LACE|,|$URL$hannah-banana-girls-legging-outfit-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-girls-legging-outfit-with-lace-28.jpg||-||Hannah Banana Girls Maxi Dress in Chevron Print PREORDER|,|^|A perfect resort or warm weather style, this new dress comes from Hannah Banana. The straight neckline is highlighted with a brightly textured band and thin shoulder straps that come together between her shoulders. The rest of the dress is made in a long flowing style with a black and white illustrated chevron pattern. Pair it with some strappy sandals and she'll be good to go! Please note that this is a PreOrder item and is NOT currently in stock. This Hannah Banana item is expected to arrive between January 1 thru February 28, 2015. ^||,|$49.00$|,||,|HANNAH-BANANA-CHEVRON-PRINT-GIRLS-MAXI-DRESS|,|$URL$hannah-banana-chevron-print-girls-maxi-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-girls-maxi-dress-in-chevron-print-preorder-5.jpg||-||Hannah Banana Girls Tunic Dress with Leggings Purple (4, 5 & 6)|,|Positively sweet, this dress and legging set from Hannah Banana is created in rich purple shades. The solid dress is a skater shape that opens in fit as it nears the hemline. A wide neckline is framed with long sleeves. The dress is paired with rose printed leggings that have a comfortable, all day fit. The bottom of the leggings are dressed with soft faux fur. Cotton/Spandex Blend. Hand Wash in Cold Water. Lay Flat to Dry. |,|$51.00$|,||,|HANNAH-BANANA-GIRLS-TUNIC-DRESS-LEGGINGS-PURPLE|,|$URL$hannah-banana-girls-tunic-dress-leggings-purple.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-girls-tunic-dress-with-leggings-purple-27.jpg||-||Hannah Banana Grey Mini Skirt for Tweens (Size 12)|,|^|Matching a new jacket created by Hannah Banana for the fall, this mini skirt is adorable. The grey skirt boasts of two purple pleated stripes running down the front while two large buttons were found on both front pockets. The hemline is accented by contrast white stitching. Made with a cotton blend, hand wash cold. (1) SIZE 12 ONLY LEFT. ^||,|$19.00$|,||,|HANNAH-BANANA-GREY-MINI-SKIRT-TWEENS|,|$URL$hannah-banana-grey-mini-skirt-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-grey-mini-skirt-for-tweens-3.jpg||-||Hannah Banana Hi-Low Girls Graphic Top (12)|,|^|A style all its own, this new tween top comes from designer Hannah Banana. The ivory top features long sleeves to help keep her warm and a classic jewel neckline. The top is finished off with a very trendy hi-low hemline. A large graphic screen print sits upon the front in a black and ivory fashion. Pairs great with the Hannah Banana flower tutu skirt! Made with rayon blend. Hand wash cold, flat dry. SIZE 12 REMAINING. ^||,|$22.33$|,||,|HANNAH-BANANA-HI-LOW-GIRLS-GRAPHIC-TOP|,|$URL$hannah-banana-hi-low-girls-graphic-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-hi-low-girls-graphic-top-3.jpg||-||Hannah Banana Ivory Tween Tunic with Tiered Hem (Size 12)|,|^|New from designer Hannah Banana, this tween girls top will be the show stopper in any of her outfit creations this fall. The long sleeve bodice is a light ivory shade and features a scoop neckline embellished by studs. The tunic's elegant style is enhanced by the light ruffled tiers of matching sheer fabric falling down to the hemline. Made with rayon blend. Hand wash cold, flat dry. 12 AVAILABLE. ^||,|$27.33$|,||,|HANNAH-BANANA-IVORY-TWEEN-TUNIC-TIERED-HEM|,|$URL$hannah-banana-ivory-tween-tunic-tiered-hem.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-ivory-tween-tunic-with-tiered-hem-2.jpg||-||Hannah Banana Leopard Leggings for Girls (10)|,|^|Trendy and truly ready for the fall season, these new tween leggings were designed by Hannah Banana. The fabric is covered with a brown and black leopard print. The fabric is perfectly soft and stretches for fit with an elastic waist. These printed leggings are perfectly paired beneath longer tunics, dresses, or skirts! Whether the rest of her outfit is filled with leopard or if these leggings are a touch of wild spice, they will certainly become a favorite accessory. A stretch poly blend, this item should be hand washed and laid flat to dry. (1) 10 ONLY LEFT. ^||,|$24.00$|,||,|HANNAH-BANANA-LEOPARD-LEGGINGS-GIRLS|,|$URL$hannah-banana-leopard-leggings-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-leopard-leggings-for-girls-1.jpg||-||Hannah Banana Little Girls Chiffon Dress (2T & 4T)|,|^|Filled with fun and a unique look, this new designer girls dress is a new design from Hannah Banana. The bodice is wrapped in blue stripes and the back of the bodice is longer than the front. The fabric is cut for a more fitted look and the punch of yellow on the neckline is a row of dangling pom poms. The sides offer a lace overlay. The pink skirt coordinates well with a blue floral print. The light weight chiffon is a refreshing fabric in the warm sun. The high low hem really ties the piece together while a matching lining is underneath the skirt. Polyester. Hand wash inside out, dry flat. SIZE 2T AND 4T ONLY LEFT. ^||,|$39.00$|,||,|HANNAH-BANANA-LITTLE-GIRLS-CHIFFON-DRESS|,|$URL$hannah-banana-little-girls-chiffon-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-little-girls-chiffon-dress-1.jpg||-||Hannah Banana Little Girls Dress with Fringe (5 & 6X)|,|^|A new creation from designer Hannah Banana, this fabulous girls dress is sure to accompany many adventures in the coming months. The dress features a trendy racer back cut with a wide scoop neckline. The neckline is accented with fringe both in the front and the back. The dress has a color block chevron stripe that is complimented with the three tiers of fringe. The shades of pink include coral and a pale pink. This dress is sure to be one that she fall in love with every time she wears it. Poly/rayon blend. Hand wash inside out, dry flat. SIZE 5 AND 6X ONLY LEFT. ^||,|$39.00$|,||,|HANNAH-BANANA-LITTLE-GIRLS-DRESS-FRINGE|,|$URL$hannah-banana-little-girls-dress-fringe.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-little-girls-dress-with-fringe-1.jpg||-||Hannah Banana Metallic Leggings for Tweens in Bronze (7, 12 & 14)|,|A perfect choice to wear beneath her new dresses and tunics, these metallic tween leggings were designed by Hannah Banana. The leggings have a stretch fit and have a faux finish in metallic silver. The stretch waist is made with elastic. The shimmer from the finish catches the light beautifully. Rayon/Spandex Blend. Hand Wash in Cold Water. Lay Flat to Dry. |,|$25.50$|,||,|HANNAH-BANANA-METALLIC-LEGGINGS-TWEENS-BRONZE|,|$URL$hannah-banana-metallic-leggings-tweens-bronze.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-metallic-leggings-for-tweens-in-bronze-27.jpg||-||Hannah Banana Plaid Chiffon Girls Top with Shorts|,|Helping her set the bar high in style, this new girls outfit comes from Hannah Banana. The long sleeve top features dark blue trimming and a sheer plaid fabric. The collar and button flaps are all adorne dby studs while a solid tank is paired beneath. The matching navy shorts boast of the same embellishments on the pocket flaps. Top: 100% polyester. Tank: Cotton blend. Shorts: 100% cotton. Hand wash cold. |,|$42.33$|,||,|HANNAH-BANANA-PLAID-CHIFFON-GIRLS-TOP-SHORTS|,|$URL$hannah-banana-plaid-chiffon-girls-top-shorts.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-plaid-chiffon-girls-top-with-shorts-2.jpg||-||Hannah Banana Tween Black Tiered Skirt|,|This new tween girls skirt comes from Hannah Banana is a flexible style that can be dressed up or worn casually. The skirt is in jet black, perfect for pairing with multiple pieces in her closet. A stretch waistband pairs smoothly beneath her tops or looks great with her tops tucked in. Tiers of black tulle ruffles fall to the hem while textured with a small dot pattern.. 100% polyester. Hand wash and lay flat to dry. |,|$40.50$|,||,|HANNAH-BANANA-TWEEN-BLACK-TIERED-SKIRT|,|$URL$hannah-banana-tween-black-tiered-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-tween-black-tiered-skirt-1.jpg||-||Hannah Banana Tween Chevron Maxi Dress (Size 12)|,|^|Stylish and cute, this new casual tween dress comes from designer Hannah Banana. The back of the top is accented with criss cross fabric while the front has a unique look. Stripes and stitches of fabric create the appliques and a few buttons are lined up in the center. The main portion of the dress is the deep blue skirt. The background is covered with a retro inspired print that takes on a new look for the popular chevron stripes. Small boxes make up each line in a new shade of blue or green. Cotton/Poly/Spandex Blend. Hand wash inside out, dry flat. SIZE 12 ONLY LEFT. ^||,|$34.33$|,||,|HANNAH-BANANA-TWEEN-CHEVRON-MAXI-DRESS|,|$URL$hannah-banana-tween-chevron-maxi-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-tween-chevron-maxi-dress-1.jpg||-||Hannah Banana Tween Dark Rhinestone Trim Jeans (Size 10 & 12)|,|^|Just for tweens, these dark wash denim jeans are from designer Hannah Banana. The front of the jeans and the back pockets are embellished with rhinestones for a stylish look. They are made of a cotton blend. Hand wash, line dry. SIZE 10 AND 12 AVAILABLE  ^||,|$19.00$|,||,|HANNAH-BANANA-TWEEN-DARK-RHINESTONE-TRIM-JEANS|,|$URL$hannah-banana-tween-dark-rhinestone-trim-jeans.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-tween-dark-rhinestone-trim-jeans-15.jpg||-||Hannah Banana Tween Double Cardigan (Size 10 & 14)|,|^|Unique in style, this new double cardigan from designer Hannah Banana will fill any tween girl with delight. The black sweater is covered with black sequins and features large buttons to close up the front. Two front pockets finish the look while the inner layer is attached and features buttons that run down the front. Made with cotton and polyester, hand wash only.SIZE 10 & 14 ONLY LEFT.  ^||,|$24.33$|,||,|HANNAH-BANANA-TWEEN-DOUBLE-CARDIGAN-COWL-NECK|,|$URL$hannah-banana-tween-double-cardigan-cowl-neck.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-tween-double-cardigan-with-cowl-neck-11.jpg||-||Hannah Banana Tween Girls Fall Jacket|,|Adding warmth to her wardrobe, this new tween jacket was created by Hannah Banana. The piece offers long sleeves with a contrasting roll cuff. The same fabric is found upon the front and adorning the pockets. A ribbed knit lines beneath the large buttons and around the cozy hood. Polyester/Cotton. Hand wash inside out in cold water. Hang to dry. |,|$64.50$|,||,|HANNAH-BANANA-TWEEN-GIRLS-FALL-JACKET|,|$URL$hannah-banana-tween-girls-fall-jacket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-tween-girls-fall-jacket-42.jpg||-||Hannah Banana Tween Hi Low Dress in Berry|,|^|By fabulous Hannah Banana, this new girls dress is a trendy arrival from their fall and winter line. The dress features a square yoke that is finished with a scallop edge and boasts of a trio of buttons that are found in the center. The tiny flower print covers the fabric while accented with a bell cuff on both sleeves. The hi-low hemline is a cute finish to the skirt. This dress is a perfect piece for every day wear! 100% Polyester. Hand Wash in Cold Water. Lay Flat to Dry. SIZE 8 AND 14 REMAINING.  ^||,|$58.50$|,||,|HANNAH-BANANA-TWEEN-HI-LOW-DRESS-BERRY|,|$URL$hannah-banana-tween-hi-low-dress-berry.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-tween-hi-low-dress-in-berry-10.jpg||-||Hannah Banana Tween Top with Floral Back|,|New from designer Hannah Banana, this printed top is available in tween sizes. The front of the top is created with a navy fabric that is slightly sheer and decorated with touches of coral pink and light grey. A ribbed knit hem tames the flowy fit while the short sleeves have a batwing shape. The back of this top is a black chiffon covered with a pink floral print. A polyester fabric, take care of this top by hand washing and drying flat. |,|$39.00$|,||,|HANNAH-BANANA-TWEEN-TOP-FLORAL-BACK|,|$URL$hannah-banana-tween-top-floral-back.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-tween-top-with-floral-back-1.jpg||-||Hannah Banana Tween Tunic with Lace (Size 7 & 10)|,|^|This new tween top from Hannah Banana is sure to be a part of many creative and stylish outfits during this spring and summer. The top features short, rolled sleeves, and a raw edge neckline. Gem appliques add a touch of sparkle just beneath the neck. The hemline of the tunic is made with a wide ruffle draped in ivory and accented with a crochet ribbon. Made with polyester blend. Hand wash cold, lay flat to dry. SIZE 7 AND 10 AVAILABLE.  ^||,|$42.00$|,||,|HANNAH-BANANA-TWEEN-TUNIC-LACE|,|$URL$hannah-banana-tween-tunic-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-tween-tunic-with-lace-1.jpg||-||Hannah Banana Tween Tutu Dress with Vintage Phone (10)|,|^|Sure to be one of the hot new items for this season, this new tween dress was designed by the fashionable Hannah Banana. The cap sleeve bodice offers a tee shirt look with the blouson affect at the waist. The waist is fitted and covered with a swirling design leading into the dreaming skirt made with layers of black tulle printed with white flowers. A large vintage telephone graphic sits on the bodice and is embellished by a touch of sparkling accents. Made with a polyblend. Dry clean only. ONE 10 ONLY LEFT.  ^||,|$34.33$|,||,|HANNAH-BANANA-TWEEN-TUTU-DRESS-VINTAGE-PHONE|,|$URL$hannah-banana-tween-tutu-dress-vintage-phone.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-tween-tutu-dress-with-vintage-phone-2.jpg||-||Hatley Back to School Girls Shirt Pink Apple|,|A new girls top, this shirt is part of the fall and winter line by Hatley. The body of the shirt is in pink and offers her a classic jewel shape neckline. An apple applique sits upon the front complete with a heart core and two leaves. The long sleeves are covered in a print filled with various apples. Cotton/Spandex. Machine wash inside out in cold water. Tumble dry on low. |,|$19.50$|,||,|HATLEY-BACK-TO-SCHOOL-GIRLS-SHIRT-PINK-APPLE|,|$URL$hatley-back-to-school-girls-shirt-pink-apple.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hatley-back-to-school-girls-shirt-pink-apple-1.jpg||-||Hatley Boutique Girls Tunic Elephant Silhouettes|,|Designed by Hatley, this new tunic has arrived in time for her back to school wardrobe. The tunic is a light purple and is covered with an elephant silhouette print. The sleeves are finished with an elastic cuff while the neckline is slightly gathered. A row of three buttons is fastened in the front. Matching purple tassels dangle from the hemline. 100% Cotton. Machine wash inside out in cold water. Tumble dry on low. |,|$27.00$|,||,|HATLEY-BOUTIQUE-GIRLS-TUNIC-ELEPHANT-SILHOUETTES|,|$URL$hatley-boutique-girls-tunic-elephant-silhouettes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hatley-boutique-girls-tunic-elephant-silhouettes-1.jpg||-||Hatley Boutique Pajamas for Girls Early Bird|,|^|Darling pajamas, this new pj outfit comes from the Hatley brand. The pink top is wrapped in bold stripes and offers long sleeves. A cute tree applique sits upon the front complete with large polka dots, a red robin, and text reading ""early bird."" Brown skinny pants are worn beneath and feature a pink hem. Trees and birds cover the soft fabric to match the top. 100% Cotton. Machine wash inside out in cold water. Tumble dry on low. ^||,|$25.50$|,||,|HATLEY-BOUTIQUE-PAJAMAS-GIRLS-EARLY-BIRD|,|$URL$hatley-boutique-pajamas-girls-early-bird.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hatley-boutique-pajamas-for-girls-early-bird-1.jpg||-||Hatley Girls Cute Rain Jacket with Elephants|,|Keeping her dry in the fall rain, this new girls rain jacket is a creation by Hatley Kids. The rain jacket is covered with rows of marching elephants in pink and teal. The large snaps alternate between the two colors. Two pockets are found upon the front. To finish the look, an attached hood keeps the top of her head dry. Cotton/Polyester. Machine wash inside out in cold water on gentle cycle. Hang to dry. |,|$44.25$|,||,|HATLEY-GIRLS-CUTE-RAIN-JACKET-ELEPHANTS|,|$URL$hatley-girls-cute-rain-jacket-elephants.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hatley-girls-cute-rain-jacket-with-elephants-1.jpg||-||Hatley Girls Designer Leggings Ruched Pink|,|Created by Hatley, these new girls leggings have arrived just in time to compliment her new tunics and long sweaters for fall. The rose pink shade is a soft color that is a beautiful choice for fall. An elastic stretch band makes a comfortable waist. The hem is finished with gathered ruching toped off with a bow. Cotton/Spandex. Machine wash inside out in cold water. Tumble dry on low. |,|$18.00$|,||,|HATLEY-GIRLS-DESIGNER-LEGGINGS-RUCHED-PINK|,|$URL$hatley-girls-designer-leggings-ruched-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hatley-girls-designer-leggings-ruched-pink-16.jpg||-||Hatley Little Girls Pajamas Owls in Purple|,|^|An adorable new pj set, this arrival comes from Hatley Kids. The purple top is covered in thin stripes and offers her long sleeves. The front of the top features a ""night owl"" applique in turquoise. Matching pants are paired with the top. These pants are covered in an owl and tree print that is quite the hoot! 100% Cotton. Machine wash inside out in cold water. Tumble dry on low. ^||,|$25.50$|,||,|HATLEY-LITTLE-GIRLS-PAJAMAS-OWLS-PURPLE|,|$URL$hatley-little-girls-pajamas-owls-purple.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hatley-little-girls-pajamas-owls-in-purple-1.jpg||-||Hatley Little Girls Pink Jacket|,|A cute fall jacket she will love to wear, this new arrival is from Hatley. The jacket is in a rose pink and features accents of teal blue. A zipper runs up the front while the hemline has a subtle hi-low cut. The hood is lined in a neutral stripe. Cotton/Polyester/Spandex. Machine wash inside out in cold water. Tumble dry on low. |,|$34.50$|,||,|HATLEY-LITTLE-GIRLS-PINK-JACKET|,|$URL$hatley-little-girls-pink-jacket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hatley-little-girls-pink-jacket-1.jpg||-||Hatley Little Girls T-Shirt with Owl in Teal|,|Such a hoot! This new little girls top is from designer Hatley. The bodice of the top is a rich teal and boasts of a large owl applique made with fabric. Pink long sleeves are covered with a matching owl print. The fabric is soft and comfortable on her skin. Cotton/Spandex. Machine wash inside out in cold water. Tumble dry on low. |,|$19.50$|,||,|HATLEY-LITTLE-GIRLS-T-SHIRT-OWL-TEAL|,|$URL$hatley-little-girls-t-shirt-owl-teal.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hatley-little-girls-t-shirt-with-owl-in-teal-1.jpg||-||Hatley Little Girls Tunic Pink Poppies|,|New from designer Hatley for kids, this fabulous girls tunic is a fresh design. The pink fabric is covered with three shades of poppy flowers and features a neckline fastened with three buttons in the front. The sleeves are finished with a slight stretch cuff. The A-line shape is a casual fit that looks great with many different pants. 100% Cotton. Machine wash inside out in cold water. Tumble dry on low. |,|$27.00$|,||,|HATLEY-LITTLE-GIRLS-TUNIC-PINK-POPPIES|,|$URL$hatley-little-girls-tunic-pink-poppies.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hatley-little-girls-tunic-pink-poppies-1.jpg||-||Hatley Pink Corduroy Pants for Girls|,|A fun pair of pants, this new creation from Hatley is a simply adorable piece of clothing that she is sure to love! The pants are a soft corduroy that is perfect for the fall season. A bright shade of pink makes these pants pop in any outfit. Her waist offers standard belt loops and a zipper button fly. She can wear these with ease at school or on the go! Cotton/Spandex. Machine wash inside out in cold water. Tumble dry on low. |,|$34.50$|,||,|HATLEY-PINK-CORDUROY-PANTS-GIRLS|,|$URL$hatley-pink-corduroy-pants-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hatley-pink-corduroy-pants-for-girls-1.jpg||-||Hatley Striped Little Girl Leggings in Gray|,|A pair of leggings she will love wearing, this new arrival is from Hatley. The fabric has a wonderful stretch fit that is cozy as can be. Both legs are wrapped in thin stripes while the waist is created with an elastic stretch. The outer side of both legs boasts of a gathered ruching and adorned by a single quaint bow. Cotton/Spandex. Machine wash inside out in cold water. Tumble dry on low. |,|$18.00$|,||,|HATLEY-STRIPED-LITTLE-GIRL-LEGGINGS-GRAY|,|$URL$hatley-striped-little-girl-leggings-gray.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hatley-striped-little-girl-leggings-in-gray-1.jpg||-||Haute Baby Amys Garden Hair Clip|,|Made to match her Amy's Garden clothing by Haute Baby. A pink crocheted flower is accented with faux gems with a touch of bling. |,|$4.00$|,||,|HAUTE-BABY-AMY-S-GARDEN-HAIR-CLIP|,|$URL$haute-baby-amy-s-garden-hair-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-amys-garden-hair-clip-9.jpg||-||Haute Baby April Bloom Fancy Take Home Gown|,|A lavish infant take home gown, this fancy creation comes from infant designer Haute Baby. The light pink bodice is covered with a sequin polka dot print. Cute cap sleeves frame the neckline while the back fastens closed. The empire waistline is bedecked by a large orange bow who's center boasts of a large flower. The skirt of this gown is layered with dreamy pink tulle. Look for the matching headband to complete the outfit! Polyester. Dry clean only. Made in the USA. |,|$39.00$|,||,|HAUTE-BABY-APRIL-BLOOM-FANCY-TAKE-HOME-GOWN|,|$URL$haute-baby-april-bloom-fancy-take-home-gown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-april-bloom-fancy-take-home-gown-1.jpg||-||Haute Baby April Bloom Girls Headband|,|^|From designer Haute Baby, this headband will go with so many of her little pink outfits. The stretch band has a comfortable fit around her head. Off centered to one side is a sumptuous floral arrangement placed upon sequin adorned leaves. This hair accessory was designed specifically to go with the lavish dresses found in their ""April Bloom"" collection. ^||,|$14.25$|,||,|HAUTE-BABY-APRIL-BLOOM-GIRLS-HEADBAND|,|$URL$haute-baby-april-bloom-girls-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-april-bloom-girls-headband-1.jpg||-||Haute Baby April Bloom Infant and Toddler Dress|,|Perfect for any special occasion this spring, this new elegant girls dress comes from Haute Baby. The fitted bodice is cut with sleeveless neckline. The fabric is covered with a pink sequin polka dot pattern. The sequins catch the glimmer of the light every where she goes. The orange waist is high and ties in the back. The center front is adorned by an over sized flower. Beneath the flower we find sequin accented leaves. The light pink tulle layers with a great shape. Polyester. Dry clean only. Made in the USA. |,|$49.00$|,||,|HAUTE-BABY-APRIL-BLOOM-INFANT-TODDLER-DRESS|,|$URL$haute-baby-april-bloom-infant-toddler-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-april-bloom-infant-and-toddler-dress-1.jpg||-||Haute Baby Baby Blanket with Lace Ruffles|,|Haute Baby brings us this sweet little blanket for any spring or summer newborn girl. The soft cotton that creates this blanket will be perfectly smooth on baby's new skin. With it's light pink color, it's perfectly complimented by the scalloped lace ruffles running around the hem. The flower and heart applique on the corner is the perfect match to the one on the Haute Baby Sassy Hearts baby gown. Dimensions: 30 in. X 30 in. 100% Cotton. Hand wash in cold water. Lay flat or hang to dry. Made in the USA. |,|$46.00$|,||,|HAUTE-BABY-BABY-BLANKET-LACE-RUFFLES|,|$URL$haute-baby-baby-blanket-lace-ruffles.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-baby-blanket-with-lace-ruffles-1.jpg||-||Haute Baby Butterfly Blanket Flitter Flutter (ONE LEFT)|,|^|Standing apart from the traditional pink that covers many baby girls blankets, this new accessory comes from Haute Baby. The white blanket is covered with blue patterns with small touches of yellow. The reversible blanket is simply flip flopped from one side to the other, both blending a fluttering butterfly print with a zany chevron stripe. The ruffle that trims the edge adds the perfect touch of femininity. ONE REMAINING. ^||,|$34.00$|,||,|HAUTE-BABY-BUTTERFLY-BLANKET-FLITTER-FLUTTER|,|$URL$haute-baby-butterfly-blanket-flitter-flutter.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-butterfly-blanket-flitter-flutter-1.jpg||-||Haute Baby Charlotte Rose Infant Hat ( 6/9 Mos )|,|^|Filled with sweet love, this new baby girls hat is a perfect match to the darling new Charlotte Rose romper from Haute Baby. The white hat boasts of a sweet floral print that is complimented with coordinated polka dots. The roll brim of the hat offers quaint accents and a single satin bow with a rhinestone heart center. Whether she is going home for the first time or just visiting with family, she will look darling as can be! 100% cotton. Hand wash cold, lay flat to dry. Made in the USA. SIZE 6-9 MONTH LEFT.  ^||,|$12.00$|,||,|HAUTE-BABY-CHARLOTTE-ROSE-INFANT-HAT|,|$URL$haute-baby-charlotte-rose-infant-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-charlotte-rose-infant-hat-1.jpg||-||Haute Baby Chic Baby Outfit Swan Lake|,|^|This sweet outfit has just arrived from the ""Swan Lake"" collection created by Haute Baby. The top features an empire bodice and long sleeves finished with a ruffle cuff. The unique texture of the fabric is a cute touch while the waist is dressed in boa feathers and a large bow. The pieces of sheer fabric that cover the skirt dance with her movement. Matching leggings are worn beneath with a sweet feather hemline. Made in the USA. 100% Polyester. Hand wash in cold water. Lay flat or hang to dry. ^||,|$58.50$|,||,|HAUTE-BABY-CHIC-BABY-OUTFIT-SWAN-LAKE|,|$URL$haute-baby-chic-baby-outfit-swan-lake.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-chic-baby-outfit-swan-lake-preorder-6.jpg||-||Haute Baby Child Feather Headband Snow|,|This hair accessory from Haute Baby is made to match a few new arrivals from their fall and winter collections. The stretch headband allows for a comfortable fit and hugs to her head. Ribbon and boa feathers create a beautiful design upon which we find the wrapped rosette. Wear the decorations off to one side of her head for a truly darling look! Made in the USA. |,|$19.50$|,||,|HAUTE-BABY-CHILD-FEATHER-HEADBAND-SNOW|,|$URL$haute-baby-child-feather-headband-snow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-child-feather-headband-snow-preorder-6.jpg||-||Haute Baby Dream Puff Baby Blanket in Brown Damask|,|^|A timeless baby gift that will be cherished for ages, this new baby blanket comes from Haute Baby. The vintage inspired blanket is a warm ivory and brown damask print. The ruffles around the trim as well as the back are covered in a more modern brown and ivory stripe. The ruffles running around the edges are finished with a soft pink stitching to accent the style. The blanket measures roughly 26"" X 27"". Made in the USA. 100% polyester. Hand wash and lay flat to dry. ^||,|$46.00$|,||,|HAUTE-BABY-DREAM-PUFF-BABY-BLANKET-BROWN-DAMASK|,|$URL$haute-baby-dream-puff-baby-blanket-brown-damask.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-dream-puff-baby-blanket-in-brown-damask-1.jpg||-||Haute Baby Elegant Baby Girls Gown Ivory and Pink (EXCLUSIVE)|,|^|A special creation from designer Haute Baby, this new infant gown is a part of their ""Creme de la Creme"" collection. The gown boasts of its warm ivory shade and soft, luxurious lining. The neckline is ruffled with the sheer mesh dot that creates the long sleeves and ruffle cuffs. This same soft tulle overlays the entire gown with a sweet frosting ruffle at the hem. The empire waist is defined by the rose pink velvet and a large pink bow. The center of this bow is decorated with a square of pearl beads. A single button keyhole styles the back. Looking for a perfect baby gift? Several matching accessories can also be found from the ""Creme de la Creme"" collection while quantities last. Made in the USA, this gown is 100% polyester. Delicately hand wash and lay flat to dry. ^||,|$40.50$|,||,|HAUTE-BABY-ELEGANT-BABY-GIRLS-GOWN-IVORY-PINK|,|$URL$haute-baby-elegant-baby-girls-gown-ivory-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-elegant-baby-girls-gown-ivory-and-pink-1.jpg||-||Haute Baby Elegant Baby Outfit Dusty Pink (3/6 Mos & 24 Mos)|,|^|Designed in elegance from Haute Baby, this new girls outfit will look fabulous in photographs. The tunic top features a wrap neckline that is accented with a velvet ruffle. The sheer tulle overlay creates long sleeves while covered with a fun trellis texture and fabric flowers. A touch of pink ribbon creates a bow while matching ruffles are found on the hemline. The leggings are a solid ivory finished in a double bell hem. Cotton/Polyester Blend. Hand Wash in Cold Water. Hang to Dry.ONE EACH 3-6 MOS AND 24 MOS LEFT. ^||,|$51.00$|,||,|HAUTE-BABY-ELEGANT-BABY-OUTFIT-DUSTED-PINK|,|$URL$haute-baby-elegant-baby-outfit-dusted-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-elegant-baby-outfit-dusty-pink-preorder-6.jpg||-||Haute Baby Elegant Christmas Dress for Girls (3T, 4)|,|^|From Haute Baby, this elegant girls dress is a beautiful holiday selection. The sleeveless neckline is trimmed in tulle ruffles. A flower texture complete with sequin accents covers the bodice completely. The wide sash upon the waist is tied on her back into a bow. A hidden zipper runs up the back and secures the fit. The skirt is covered with a sheer overlay. Made in the USA. 100% Polyester. Hand wash in cold water. Lay flat or hang to dry. ONE EACH SIZE 3T AND 4 LEFT.  ^||,|$64.50$|,||,|HAUTE-BABY-ELEGANT-CHRISTMAS-DRESS-GIRLS|,|$URL$haute-baby-elegant-christmas-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-elegant-christmas-dress-for-girls-preorder-6.jpg||-||Haute Baby Elegant Dress for Girls Butter Creme|,| |,|$58.50$|,||,|HAUTE-BABY-ELEGANT-DRESS-GIRLS-BUTTER-CREME|,|$URL$haute-baby-elegant-dress-girls-butter-creme.html|,|||-||Haute Baby Fancy Baby Dress April Bloom|,|^|Part of the ""April Blooms"" spring and summer collection by designer Haute Baby, this new infant dress is perfect for any up coming occasion. The empire waist features an oversized, structured orange bow with a large pink flower placed in the center. Just beneath the flower is a hint of sparkle in the sequin leaves. The bodice is covered with sequin polka dots and has cap sleeves. The matching skirt is finished with an over layer of tulle that adds an elegant finish. Polyester. Dry clean only. Made in the USA. ^||,|$49.50$|,||,|HAUTE-BABY-FANCY-BABY-DRESS-APRIL-BLOOM|,|$URL$haute-baby-fancy-baby-dress-april-bloom.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-fancy-baby-dress-april-bloom-1.jpg||-||Haute Baby Fancy Girls Dress Rosette Flutter|,|Helping to create an enchanting experience, this elegant new girls dress from Haute Baby is part of their Ivory Roses collection for fall and winter. The bodice is covered with a rose covered overlay that introduces a unique and lovely texture. The neckline is framed with a flutter cap sleeves. A single button keyhole is found on the back. The drop waist is dressed with a large ribbon bow on the front while the skirt is divided into two tiers. Cotton/Polyester Blend. Hand Wash in Cold Water. Hang to Dry. |,|$55.50$|,||,|HAUTE-BABY-FANCY-GIRLS-DRESS-ROSETTE-FLUTTER|,|$URL$haute-baby-fancy-girls-dress-rosette-flutter.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-fancy-girls-dress-rosette-flutter-preorder-6.jpg||-||Haute Baby Fancy Girls Headband with Rosettes|,|Filled with fabrics that match several new pieces from the Haute Baby collection, this new little girls headband is a sweet accessory to finish the outfit off right. A stretch ivory band fits comfortably around her head. The trio of flowers boast of three fabrics: A pale pink creating the larger of the three, a chocolate brown covered with a white circle print, and an ivory tulle finished with a heart center. |,|$19.50$|,||,|HAUTE-BABY-FANCY-GIRLS-HEADBAND-ROSETTES|,|$URL$haute-baby-fancy-girls-headband-rosettes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-fancy-girls-headband-with-rosettes-20.jpg||-||Haute Baby Fancy Headband for Baby|,|^|Haute Baby is now offering this graceful baby headband to match the new ""Creme de la Creme"" collection. The headband is made with a sheer ivory mesh that is decorated with a quaint swiss dot pattern. A velvet adornment is shaped as a bow and meant to sit off to one side of her head. The center of the bow is finished with a circle of pearls. ^||,|$16.50$|,||,|HAUTE-BABY-FANCY-HEADBAND-BABY|,|$URL$haute-baby-fancy-headband-baby.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-fancy-headband-for-baby-1.jpg||-||Haute Baby Fancy Pink Blanket|,|An ornate baby girls blanket, this fabulous creation comes from Haute Baby and matches perfectly to one of their new baby gowns. The light pink fabric is covered with a flower texture that is a subtle touch of class and decoration. A single corner is accented with a matching bow that has a pearl center. The ruffle that wraps around the entire blanket matches the fabric that creates the bow. |,|$51.75$|,||,|HAUTE-BABY-FANCY-PINK-BLANKET|,|$URL$haute-baby-fancy-pink-blanket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-fancy-pink-blanket-1.jpg||-||Haute Baby Feathered Infant Hat|,|^|The perfect match to the ""Haute Baby Frilly Baby Gown Snow White,"" this baby girls accessory is a must have to complete the gift! The hate is covered with a sweet small dot texture. The fabric allows stretch in its comfortable fit. A large flower is set upon the hat and looks darling just off to one side of her head. The center of the bloom is a large gem with dancing boa feather accents. Made in the USA. 100% Polyester. Hand wash in cold water. Lay flat or hang to dry. ^||,|$16.50$|,||,|HAUTE-BABY-FEATHERED-INFANT-HAT|,|$URL$haute-baby-feathered-infant-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-feathered-infant-hat-preorder-6.jpg||-||Haute Baby Frilly Baby Gown Snow White|,|A take home gown designed for a princess, this new Haute Baby design is the perfect newborn gift! The empire bodice is covered with a polka dot texture while the sleeves and neckline are trimmed in ribbon. The waist is accented with boa feathers and a sweet ribbon bow. The long skirt to this gown is covered with falling, sheer feathers. The fairy tale look of this piece is beautiful in person and in her first photographs! Made in the USA. 100% Polyester. Hand wash in cold water. Lay flat or hang to dry. |,|$49.50$|,||,|HAUTE-BABY-FRILLY-BABY-GOWN-SNOW-WHITE|,|$URL$haute-baby-frilly-baby-gown-snow-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-frilly-baby-gown-snow-white-preorder-6.jpg||-||Haute Baby Frilly Christmas Dress for Toddlers Ruby|,|Coordinating with her younger sister, this little girls Christmas dress is new from Haute Baby's fall and winter collections. The bodice features a classic neckline framed with ruffle cap sleeves. The front of the bodice is covered with a chiffon and sequin texture that resembles flowers. The velvet ribbon around the waist is tied into a bow off to one side. The skirt opens to a full circle shape and is draped in matching, sheer fabric. Made in the USA. 100% Polyester. Hand wash in cold water. Lay flat or hang to dry. |,|$58.50$|,||,|HAUTE-BABY-FRILLY-CHRISTMAS-DRESS-TODDLERS-RUBY|,|$URL$haute-baby-frilly-christmas-dress-toddlers-ruby.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-frilly-christmas-dress-for-toddlers-ruby-preorder-6.jpg||-||Haute Baby Garden Party Girls Dress ( 2T, 3T & 5 )|,|^|Matching several other new arrivals, this Haute Baby dress for girls is a treasured design for the coming summer season. The bodice is fitted and colored with wide yellow stripes. The green empire waist has a blue onion pattern while tying into a knot or bow on her back. The full circle skirt is layered in blue and white ruffles. The white fabric is covered with an eyelet pattern that introduces a new texture into the dress. Be sure to check out all of the pieces from the ""Garden Party"" collection if you are interested in creating a sister pair. ^||,|$59.00$|,||,|HAUTE-BABY-GARDEN-PARTY-GIRLS-DRESS|,|$URL$haute-baby-garden-party-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-garden-party-girls-dress-1.jpg||-||Haute Baby Girls Couture Skirt Set with Rosettes (Size 3T, 5)|,|^|A sophisticated style she will adore, this new arrival from fabulous Haute baby is sure to be loved. The ivory top is an elegant design that will look fabulous mixed and matched with other bottoms found in her wardrobe. The sheer overlay is covered with a swiss dot pattern and creates the long, sheer sleeves. Ruffles accent not only the hemline and cuffs but also her neck. A single keyhole button is found upon the back. The matching skirt is a fun circle print covered with a tulle overlay. Large ribbon rosettes spiral to accent the skirt. Cotton/Polyester. Hand wash cold. Hang to dry. ONE SIZE 10 LEFT.  ^||,|$61.50$|,||,|HAUTE-BABY-GIRLS-COUTURE-SKIRT-SET-ROSETTES|,|$URL$haute-baby-girls-couture-skirt-set-rosettes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-girls-couture-skirt-set-with-rosettes-6.jpg||-||Haute Baby Girls Dress in April Bloom (4, 5, 6 & 7)|,|^|Whether she is attending an Easter celebration or part of a wedding, this pink girls dress is sure to catch the light in her eyes. A hidden zipper runs up the back while the sleeveless neckline has a straight shape. The precious skirt is made with the same things that weave her dreams at night. The light pink resembles a rose while layers of tulle are found just above. The shape of the skirt is sure to make her feel like a princess while going beautifully with her dress shoes. Several matching designs are also found in the ""April Bloom"" collection for spring and summer. Polyester. Dry clean only. Made in the USA. ^||,|$59.00$|,||,|HAUTE-BABY-GIRLS-SIZE-EASTER-DRESS-APRIL-BLOOM|,|$URL$haute-baby-girls-size-easter-dress-april-bloom.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-girls-size-4-to-8-easter-dress-april-bloom-1.jpg||-||Haute Baby Girls Floral Capri Set (18 Mos, 4T & 4)|,|Made with sugar and spice and a splash of sass, this new designer girls summer outfit comes from Haute Baby. The sleeveless tunic has an empire waist adorned with a thin ruffle and a pink flower. The bodice is covered with a zebra inspired print while the neckline is cut in the classic jewel shape. The skirt of the tunic is a light and bright floral print. The hem draws back to the zebra two tone print as it ruffles around with a small touch of tulle found just beneath. Matching pants are found beneath the tunic and are finished with a ruffle hem. The fabric is soft and comfortable for all day wear. |,|$46.50$|,||,|HAUTE-BABY-GIRLS-FLORAL-CAPRI-SET|,|$URL$haute-baby-girls-floral-capri-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-girls-floral-capri-set-1.jpg||-||Haute Baby Girls Swing Outfit Garden Party|,|A bright new addition the Haute Baby spring and summer line, this fabulous outfit will encourage her imagination. Ruffled cap sleeves characterize the yellow striped bodice While a wide green fabric sash ties around the waist to define its empire height. The skirt of the top is created with three ruffles, the middle one made with a sweet eyelet fabric. The matching pants worn beneath have a double bell ruffle hemline in white eyelet and yellow stripe. |,|$39.00$|,||,|HAUTE-BABY-GIRLS-SWING-OUTFIT-GARDEN-PARTY|,|$URL$haute-baby-girls-swing-outfit-garden-party.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-girls-swing-outfit-garden-party-1.jpg||-||Haute Baby Honey Child Little Girls Swing Capri Outfit|,|Part of the Honey Child collection from designer Haute Baby, this new infant and toddler outfit is ready for the warm sunshine! The top is a fun yellow floral print with three tiers of ruffles that wrap around the back. The unique neckline boasts of an adjustable pink strap that ties into a bow on her left shoulder. Matching capris are paired beneath the relaxed fit of the top. The capris finish with a bell ruffle hem. 100% cotton. Machine wash cold, tumble dry low. Made in the USA. |,|$49.50$|,||,|HAUTE-BABY-HONEY-CHILD-LITTLE-GIRLS-SWING-CAPRI-OUTFIT|,|$URL$haute-baby-honey-child-little-girls-swing-capri-outfit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-honey-child-little-girls-swing-capri-outfit-1.jpg||-||Haute Baby Infant Hat Flitter Flutter ( 3/6 Mos )|,|^|Matching the new infant short set with butterflies, this fabulous Haute Baby infant hat is too cute! The soft fabric is covered with a blue chevron stripe while the roll brim features the large butterfly print. The front of the hat is adorned with a single yellow flower that is worn off centered to one side. Making it easy to complete the outfit, this hat is the perfect piece to wear with her new bloomer shorts. The butterfly print is a fun way to welcome summertime. SIZE 3-6 MOS ONLY LEFT.  ^||,|$14.25$|,||,|HAUTE-BABY-INFANT-HAT-FLITTER-FLUTTER|,|$URL$haute-baby-infant-hat-flitter-flutter.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-infant-hat-flitter-flutter-1.jpg||-||Haute Baby Infant Shorts Set with Butterflies|,|Fluttering her high with style, this Haute Baby outfit is available in infant sizes. The short sleeve top features a chevron print on her sleeves to match the ruffle that runs down, hiding the snaps that close the wrap style. A yellow flower is found off to the right side, matching perfectly to the small peek of yellow tulle. The white cotton is covered with a blue butterfly print. The matching bloomer shorts are paired beneath. The cute bubble shape is irresistible while ruffle is found on both legs. |,|$39.00$|,||,|HAUTE-BABY-INFANT-SHORTS-SET-BUTTERFLIES|,|$URL$haute-baby-infant-shorts-set-butterflies.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-infant-shorts-set-with-butterflies-1.jpg||-||Haute Baby Infant White Hat with Pink Flower|,|^|Designed by Haute Baby, this new baby girl's hat is alluring with its crisp color and angelic decorations. The hat is created with a soft white cotton that matches the new ""Haute baby White Baby Gown with Pink Flowers"" perfectly! The roll brim is accented with a single light pink flower at full bloom. ^||,|$14.25$|,||,|HAUTE-BABY-INFANT-WHITE-HAT-PINK-FLOWER|,|$URL$haute-baby-infant-white-hat-pink-flower.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-infant-white-hat-with-pink-flower-1.jpg||-||Haute Baby Lazy Dazy Tunic with Capri|,|^|Haute Baby has created this darling new little girls outfit as a part of their ""Lazy Dazy"" collection for summer. The swing top has a relaxed A-line fit. The top boasts of a gathered neckline that is accented with the wide gingham straps that tie into a bow on both shoulders. The large orange flower that sits in the center stands out among the print of yellow flowers. A ruffle finishes off the top in the same fabric. Capri leggings are paired beneath the top and are covered with a yellow and white stripe. The bottoms offer the comfortable elastic waistline and stretch in its fit. ^||,|$39.00$|,||,|HAUTE-BABY-LAZY-DAZY-TUNIC-CAPRI|,|$URL$haute-baby-lazy-dazy-tunic-capri.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-lazy-dazy-tunic-with-capri-1.jpg||-||Haute Baby Leopard Girls Skirt Set|,|Featuring an updated look to a gorgeous vintage inspiration, this new little girls skirt set comes from Haute Baby. The sleeveless top is covered with a scroll and flower print in a wispy white. A scoop yoke is lined with a tulle ruffle and introduces the sweet pink leopard print. Three flower shaped buttons sit in the center upon a ribbon. The top has a more fitted look that is accented by the volume of the skirt. A touch of ruffles and pink tulle overlay make this skirt one that will be loved by all! 100% cotton. Hand wash cold, lay flat to dry. |,|$39.00$|,||,|HAUTE-BABY-LEOPARD-GIRLS-SKIRT-SET|,|$URL$haute-baby-leopard-girls-skirt-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-leopard-girls-skirt-set-1.jpg||-||Haute Baby Little Girls Dress Vintage Twirl|,|A darling creation, this new designer girls dress comes from Haute Baby. The dress has a striped bodice accented with two round buttons. A peter pan collar is trimmed with crochet on the edge. The full circle skirt is layered in different coordinating fabrics. This dress is perfect for just about any errand or day at school! 100% Cotton. Machine wash cold inside out. Tumble dry on low. |,|$51.75$|,||,|HAUTE-BABY-LITTLE-GIRLS-DRESS-VINTAGE-TWIRL|,|$URL$haute-baby-little-girls-dress-vintage-twirl.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-little-girls-dress-vintage-twirl-preorder-6.jpg||-||Haute Baby Little Girls Fancy White Feather Dress|,|^|Haute Baby created this gorgeous new dress in their ""Swan Lakes"" collection. The dress has a sleeveless neckline that is framed with a fluttering ruffle of tulle. The bodice is covered with a white sequin flower pattern. The skirt is covered with the fun feather layers that boast of their graceful movement. This dress matches a few other arrivals to make family photos a breeze! Made in the USA. 100% Polyester. Hand wash in cold water. Lay flat or hang to dry. ^||,|$64.50$|,||,|HAUTE-BABY-LITTLE-GIRLS-FANCY-WHITE-FEATHER-DRESS|,|$URL$haute-baby-little-girls-fancy-white-feather-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-little-girls-fancy-white-feather-dress-preorder-6.jpg||-||Haute Baby Little Girls Floral Tunic Set|,|^|Haute Baby has created this adorable little girls outfit as a part of their ""Ruby Rose"" collection. The long sleeve top is a fair shade of grey and is covered with bold pink rose blooms. The hem of the tunic is a sweet pink ruffle introduced by a touch of lace and a single flower sitting upon the left side. Matching pants accompany the tunic and are finished with the same double ruffle on both legs. 100% Cotton. Hand Wash in Cold Water. Lay Flat to Dry. ^||,|$46.50$|,||,|HAUTE-BABY-LITTLE-GIRLS-FLORAL-TUNIC-SET|,|$URL$haute-baby-little-girls-floral-tunic-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-little-girls-floral-tunic-set-preorder-6.jpg||-||Haute Baby Little Girls Jacket in Ivory|,|A soft designer girls jacket, this new arrival is from designer Haute Baby. This designer girls jacket is made with a textured ivory fabric that is covered in a floral pattern. The sleeves are finished with a single ruffle while a peter pan collar runs around the neckline. A large cluster button is found just beneath the button and fastens to close the top. A matching ruffle is found on the hemline. 100% Polyester. Machine wash cold inside out. Dry on low. |,|$36.75$|,||,|HAUTE-BABY-LITTLE-GIRLS-JACKET-IVORY|,|$URL$haute-baby-little-girls-jacket-ivory.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-little-girls-jacket-in-ivory-1.jpg||-||Haute Baby Little Girls Vintage Headband with Rosettes|,|Haute Baby has created this little girls headband to match several new arrivals from their fall and winter collection. The stretch headband is wrapped with off white and baby blue stripes. Two turned rosettes sit side by side off to one side of her head. One is made with a multi colored pattern while the other is placed upon crochet lace and finished with a real center. |,|$19.50$|,||,|HAUTE-BABY-LITTLE-GIRLS-VINTAGE-HEADBAND-ROSETTES|,|$URL$haute-baby-little-girls-vintage-headband-rosettes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-little-girls-vintage-headband-with-rosettes-preorder-6.jpg||-||Haute Baby Newborn Hat Pretty in Pink|,|^|Created to be paired with the darling ""Haute Baby Take Home Gown for Newborn"" this pretty pink hat is a beautiful accessory. The pale pink cotton allows slight stretch and is a comfortable fit upon her head. The front of the hat is covered with an oversized rose bloom created with spirals of ribbon. ^||,|$19.00$|,||,|HAUTE-BABY-NEWBORN-HAT-PRETTY-PINK|,|$URL$haute-baby-newborn-hat-pretty-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-newborn-hat-pretty-in-pink-2.jpg||-||Haute Baby Party Tunic for Little Girls with Rosettes (Size 3T & 4T)|,|^|A unique style that is simply adorable, this new designer outfit for little girls is sure to be a beautiful choice for any event. The tunic features a chocolate brown skirt that is covered with a circle pattern that is finished with a sheer overlay. Large pink ribbon roses are found upon the skirt and add a touch of pink. The bodice of the tunic has a wide chocolate brown waistline and cute sheer ruffles that dress the neckline and cuffs. Matching pants are worn beneath in the same textured ivory. Cotton/Polyester. Hand wash cold. Hang to dry.ONE EACH SIZE 3T & 4T REMAINING. ^||,|$43.50$|,||,|HAUTE-BABY-PARTY-TUNIC-LITTLE-GIRLS-ROSETTES|,|$URL$haute-baby-party-tunic-little-girls-rosettes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-party-tunic-for-little-girls-with-rosettes-6.jpg||-||Haute Baby Ruby Red Headband for Little Girls|,|^|A beautiful piece made to match her new holiday dress, this headband for girls was designed by Haute Baby as a part of their red ""Holiday Sparkle"" collection. The headband is a soft stretch fabric that hugs her head comfortably. The flower design is accented with sequins and set upon a bed of tulle. Made in the USA. ^||,|$19.50$|,||,|HAUTE-BABY-RUBY-RED-HEADBAND-LITTLE-GIRLS|,|$URL$haute-baby-ruby-red-headband-little-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-ruby-red-headband-for-little-girls-preorder-6.jpg||-||Haute Baby Ruby Red Holiday Gown for Baby|,|Looking fabulous during the holiday season, this new red baby girls dress is from Haute Baby. The empire bodice features a textured front accented with sequins. A thin velvet ribbon finishes in a bow at the center of her waist and matching the soft, long sleeves. The skirt is layered with mesh and has an elegant movement. This dress is beautiful on its own and paired with tights and darling holiday flats! Made in the USA. 100% Polyester. Hand wash in cold water. Lay flat or hang to dry. |,|$46.50$|,||,|HAUTE-BABY-RUBY-RED-HOLIDAY-GOWN-BABY|,|$URL$haute-baby-ruby-red-holiday-gown-baby.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-ruby-red-holiday-gown-for-baby-preorder-6.jpg||-||Haute Baby Sassy Hearts Baby Gown|,|From designer Haute Baby, this new take home gown for newborn girls is an adorable choice. The light pink gown features scallop lace cuffs in a double layer. The front of the gown is accented with a large white flower lined with gems. A large heart patterned shape completes the look. The pale pink color is perfect for any newborn girl, with it's rouched lace hem. 100% Cotton. Hand wash in cold water. Lay flat or hang to dry. Made in the USA. |,|$46.00$|,||,|HAUTE-BABY-SASSY-HEARTS-BABY-GOWN|,|$URL$haute-baby-sassy-hearts-baby-gown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-sassy-hearts-baby-gown-1.jpg||-||Haute Baby Sassy Hearts Baby Set|,|From designer Haute Baby, this new outfit for newborn girls is perfect for your sweet addition. The light pink romper features scallop lace cuffs in a double layer. The front of the gown is accented with a large white flower lined with gems. A large heart patterned shape completes the look. The pale pink color is perfect for any newborn girl, with it's rouched lace legs and changing snaps. 100% Cotton. Hand wash in cold water. Lay flat or hang to dry. Made in the USA. |,|$49.00$|,||,|HAUTE-BABY-SASSY-HEARTS-BABY-SET|,|$URL$haute-baby-sassy-hearts-baby-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-sassy-hearts-baby-set-1.jpg||-||Haute Baby Sassy Hearts Designer Dress for Girls|,|Perfect for Valentine's Day, this adorable dress comes from designer Haute Baby. The bold heart pattern creates the structured, sleeveless bodice, adorned in glitter. The waist is defined by the bow that sits front and center, embellished with a heart shaped gem. The skirt is created by layers of dreamy tulle, while the waist ties into a bow in the back. Her back as an open cutout in a heart shape, one she is sure to love! 100% Cotton. Hand wash in cold water. Lay flat or hang to dry. Made in the USA. |,|$78.00$|,||,|HAUTE-BABY-SASSY-HEARTS-DESIGNER-DRESS-GIRLS|,|$URL$haute-baby-sassy-hearts-designer-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-sassy-hearts-designer-dress-for-girls-1.jpg||-||Haute Baby Special Occasion Ivory Baby Blanket|,|^|An accessory that is perfect for your upcoming baby shower, this new arrival from Haute Baby makes a unique gift. The blanket is created to match a new baby girls gown that is from the ""Creme de la Creme"" collection. A dotted sheer overlay covers the ivory blanket in elegance while also creating the ruffle edge that runs around the entire piece. A single corner is accented with a brown velvet bow. ^||,|$46.00$|,||,|HAUTE-BABY-SPECIAL-OCCASION-IVORY-BABY-BLANKET|,|$URL$haute-baby-special-occasion-ivory-baby-blanket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-special-occasion-ivory-baby-blanket-1.jpg||-||Haute Baby Special Occasion Outfit with Pink Rosettes (12 Mos, 2T, & 6)|,|Haute Baby designed this gorgeous little girls outfit as a part of their fall and winter collections. The tunic has an A-line fit and elegant sheer sleeves. The neckline is dressed with a ruffle to match the hemline and a single ribbon bow. A snap closes at the back. The overlay is dressed with a fun texture that is accented with fabric roses. Beneath the tiered hemline we find the solid matching leggings to complete the look. Cotton/Polyester Blend. Hand Wash in Cold Water. Hang to Dry. |,|$51.75$|,||,|HAUTE-BABY-SPECIAL-OCCASION-INFANT-OUTFIT-PINK-ROSETTES|,|$URL$haute-baby-special-occasion-infant-outfit-pink-rosettes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-special-occasion-outfit-with-pink-rosettes-preorder-1.jpg||-||Haute Baby Take Home Gown for Newborn|,|From designer Haute Baby, this new take home gown for newborn girls is a perfect choice for her first day home or he first photos! The light pink gown features scallop lace cuffs in a double layer. The front of the gown is accented with a large ribbon rosette that is lined with matching lace. The pale pink color is perfect for any newborn girl. Haute Baby also has a matching hat that can be purchased for a complete outfit while supplies last, check out the brand page.100% Cotton. Hand Wash in Cold Water. Lay Flat to Dry. |,|$46.00$|,||,|HAUTE-BABY-TAKE-HOME-GOWN-NEWBORN|,|$URL$haute-baby-take-home-gown-newborn.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-take-home-gown-for-newborn-10.jpg||-||Haute Baby Toile Wrap Set for Baby Girls|,|Too darling! This new outfit from designer Haute Baby is set apart from all others. The top boasts of the wrap style neckline and warm long sleeves. The wrap style is accented with the brown stripe ruffle, embellished by pink tulle and a large flower. Paired with matching pants that are finished in a bell ruffle hemline, coordinating beautifully. This outfit is finished off with a cap that is made with the same sweet toile print. All fabric excluding trimmings: 100% cotton. Hand wash and lay flat to dry. for best results. |,|$74.00$|,||,|HAUTE-BABY-TOILE-WRAP-SET-BABY-GIRLS|,|$URL$haute-baby-toile-wrap-set-baby-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-toile-wrap-set-for-baby-girls-21.jpg||-||Haute Baby Tunic Set for Little Girls Aqua Stripe (12 Mos & 4T)|,|^|Matching her younger sisters outfit, this new little girls tunic set comes from Haute Baby. The tunic offers her a long sleeve bodice in baby blue. The waist is defined with a brown espresso dot sash that ties into a bow on her back. The skirt of the tunic is divided into panels of fabric and features a single scoop pocket. Matching striped pants are worn beneath with a quaint ruffle run around the hemline. 100% Cotton. Machine wash cold inside out. Tumble dry on low.SIZE 12 MOS & 4T LEFT. ^||,|$49.50$|,||,|HAUTE-BABY-TUNIC-SET-LITTLE-GIRLS-AQUA-STRIPE|,|$URL$haute-baby-tunic-set-little-girls-aqua-stripe.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-tunic-set-for-little-girls-aqua-stripe-preorder-6.jpg||-||Haute Baby White Baby Gown with Pink Flowers|,|A truly magnificent new design, this darling baby girls take me home gown comes from Haute Baby. The empire waist bodice boasts of the simply beauty found on the scallop cap sleeves and the row of light pink flowers that are placed upon the front. The skirt is covered with a white eyelet fabric that is gathered at the hemline. This gathering is created with a stretch elastic that causes the hemline to ruffle in response. That hem is cut to the cute scallop shape as well. This impeccable design is sure to look exquisite in her newborn photos! |,|$43.50$|,||,|HAUTE-BABY-WHITE-BABY-GOWN-PINK-FLOWERS|,|$URL$haute-baby-white-baby-gown-pink-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-white-baby-gown-with-pink-flowers-1.jpg||-||Haute Baby White Eyelet Girls Bloomer Set|,|^|A sweet and pleasing design, this fabulous new little girls outfit comes from Haute Baby in their ""Innocence"" collection for summer. The top boasts of a neckline that gathers from the tie that is threaded through the front and the back to create the shoulder straps. This strap ties into a bow on one of her shoulders. The top is covered with the darling white eyelet while a touch of scallop edging runs around the bottom. A few light pink flowers are also added as beloved decorations. The bloomers paired beneath are a light pink cotton. The stretch waist is comfortable while the ruffle hem on both legs is created by a touch of elastic. ^||,|$51.00$|,||,|HAUTE-BABY-WHITE-EYELET-GIRLS-BLOOMER-SET|,|$URL$haute-baby-white-eyelet-girls-bloomer-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-white-eyelet-girls-bloomer-set-1.jpg||-||Haute Baby White Eyelet Girls Dress Innocence ( 3T, 4T & 5 )|,|Newly created by Haute Baby, this designer girls dress is ready for summer! The lovely piece is filled with impeccable style that stands out amongst the crowd. Scallop trim creates the cap sleeves while A row of flowers hide the neckline. The dress has a straight, A-line shape that is subtly elegant. The white overlay is covered with an eyelet pattern and finished with a matching scallop hem. Just beneath we find a touch of light pink. |,|$48.00$|,||,|HAUTE-BABY-WHITE-EYELET-GIRLS-DRESS-INNOCENCE|,|$URL$haute-baby-white-eyelet-girls-dress-innocence.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-white-eyelet-girls-dress-innocence-1.jpg||-||Hudson Jeans Black Knit Pants for Tweens with Sequins|,|A dazzling new design by Hudson Jeans for kids, these fabulous tween pants are perfect for her next recital or special occasion. The black knit pants offer a truly comfortable fit and two button-flap back pockets. Belt loops are provided on her waist while a button and zipper fly secures her fit. The front is covered with a black tulle overlay that is dressed with small black sequins which catch every ray of light. Contrary to appearance, the front does not have pockets. The legs are cut for a straight or skinny fit. This fabric blends polyester, rayon, and spandex; allowing a slight stretch. Machine washable. Tumble dry. |,|$28.33$|,||,|HUDSON-JEANS-BLACK-KNIT-PANTS-TWEENS-SEQUINS|,|$URL$hudson-jeans-black-knit-pants-tweens-sequins.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hudson-jeans-black-knit-pants-for-tweens-with-sequins-1.jpg||-||Hudson Jeans Blue Jean Skinnies for Tweens|,|The perfect shade of dye to fit any occasion, these new tween jeans come from the designer brand Hudson. The medium dark wash can be dressed up or down while distressed tears, fading, and whiskering give great depth to the color. The zipper fly is closed with a single button. The back boasts of classic button flap pockets. Creating comfort with the stretch cotton blend, machine wash and lay flat to dry. |,|$24.33$|,||,|HUDSON-JEANS-BLUE-JEAN-SKINNIES-TWEENS|,|$URL$hudson-jeans-blue-jean-skinnies-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hudson-jeans-blue-jean-skinnies-for-tweens-2.jpg||-||Hudson Jeans Dark Skinny Jeans for Tweens|,|Designed by Hudson Jeans for kids, this new arrival is sure to become a common piece in many of her favorite outfits. The rich dark wash of the jean makes it easy to dress up while the slight stretch in fit adds greatly to her comfort all day long. These pants offer the classic 5 pockets, two with button flaps on the back. The skinny cut is not only trendy but also compliments her legs. Faint fading and whiskering gives a great worn look. Pair these tween jeans with her tunics, tops, sweaters, and so much more! The cotton and elastane blend is machine washable, tumble dry. |,|$18.33$|,||,|HUDSON-JEANS-DARK-SKINNY-JEANS-TWEENS|,|$URL$hudson-jeans-dark-skinny-jeans-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hudson-jeans-dark-skinny-jeans-for-tweens-1.jpg||-||Hudson Jeans Dark Wash Skinny Jeans for Tweens|,|Designed to keep her comfortable while trendy, great care and love is stitched into these fabulous Hudson jeans. The rich dark wash gives a casual dressy feel while the slim fit hugs her legs with a soft stretch cotton blend. Classic fading and slight whiskering helps define the shade of the wash while button flap pockets are found on the back. Machine wash these jeans with like colors and lay flat to dry. |,|$21.33$|,||,|HUDSON-JEANS-DARK-WASH-SKINNY-JEANS-TWEENS|,|$URL$hudson-jeans-dark-wash-skinny-jeans-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hudson-jeans-dark-wash-skinny-jeans-for-tweens-2.jpg||-||Hudson Jeans Girls Blue Shorts in Province|,|From Hudson Jeans for Kids, these new tween shorts are sure to accompany her on many summer days. The dark blue shorts are accented with a light blue stripe on the outer side of both legs. The waist matches these stripes and offers classic belt loops. A single metal button and zipper fly secure the fit. Both legs are finished with a straight hem and five pockets are offered. Made with cotton blend. Machine wash cold, tumble dry medium. |,|$14.33$|,||,|HUDSON-JEANS-GIRLS-BLUE-SHORTS-PROVINCE|,|$URL$hudson-jeans-girls-blue-shorts-province.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hudson-jeans-girls-blue-shorts-in-province-1.jpg||-||Hudson Jeans Grey Skinny Jean with Black Contrast (Size 14 & 16)|,|^|Unique from all other jeans, these Hudson tween jeans show off her great style. The grey pant boasts of its skinny cut that flatters her shape. The added black contrast on the knees is continued on the inside of both legs down to the hem. A black insert wraps almost completely around her waist. Her front pockets are accented with small zippered pockets that are layered beneath. Cotton-elastane blend. Machine wash, tumble dry if necessary. Recommended: Avoid the dryer and lay flat to dry in order to protect the color longer.SIZE 14 & 16 ONLY LEFT. ^||,|$39.50$|,||,|HUDSON-JEANS-GREY-SKINNY-JEAN-BLACK-CONTRAST|,|$URL$hudson-jeans-grey-skinny-jean-black-contrast.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hudson-jeans-grey-skinny-jean-with-black-contrast-2.jpg||-||Hudson Jeans Studded Red Skinny Jeans for Girls (12, 14 & 16)|,|A bright splash of color, these new tween skinny jeans come from designer Hudson. The true red stands out during the fall and winter months and will create a beautiful contrast with many colors. The pant has a slim fit from waist to ankle and boasts of square silver studs that wrap around her waist and down the side of both legs. Buttons secure the back pocket flaps. Created with a stretch cotton. Machine wash with like colors, air dry flat. |,|$34.33$|,||,|HUDSON-JEANS-STUDDED-RED-SKINNY-JEANS-GIRLS|,|$URL$hudson-jeans-studded-red-skinny-jeans-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hudson-jeans-studded-red-skinny-jeans-for-girls-2.jpg||-||Hudson Jeans Trendy Skinny Tween Jeans|,|Sure to become one of the most used pieces in her closet, these staple jeans come from Hudson for girls. The trendy pant offers a great slim fit in a gorgeous dye. Slight distressing is found with the three rips on the front along with fading and whiskering. These skinnies offer five pockets to hold her most precious treasures. A light stretch adds to the comfort of the fit. Created with a cotton stretch blend, machine washable. Do not tumble dry, but instead lay flat. |,|$24.33$|,||,|HUDSON-JEANS-TRENDY-SKINNY-TWEEN-JEANS|,|$URL$hudson-jeans-trendy-skinny-tween-jeans.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hudson-jeans-trendy-skinny-tween-jeans-2.jpg||-||Hudson Jeans Turquoise Tween Skinny Jeans|,|New from designer Hudson, these tween skinny jeans will be envied by all of her peers. The turquoise pant boasts of a two tone wash that gives off the impression of camo. The slim silhouette is created by the fitted cut that hugs her legs from waist to ankle. The pant boasts of five pockets and a button zipper fly. The stretch cotton fabric is light and comfortable. Machine wash with like colors, avoid the dryer and lay flat to dry. |,|$28.33$|,||,|HUDSON-JEANS-TURQUOISE-TWEEN-SKINNY-JEANS|,|$URL$hudson-jeans-turquoise-tween-skinny-jeans.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hudson-jeans-turquoise-tween-skinny-jeans-2.jpg||-||Hudson Jeans Tween Girls Denim Jacket|,|^|A great layering piece for any closet, this new tween jacket was designed by Hudson Jeans. The medium, blue stone wash is filled with authenticity while textured with light fading and patches of distressed ripping. Classic metal buttons run up the front and two button flap pockets complete the style. The traditional tucks in the fabric give this jacket structure and long sleeves add warmth. Her cuffs have a single button. Slight stretch is found in the fit due to the cotton and elastane blend fabric. Machine wash and tumble dry. SIZE LARGE LEFT.  ^||,|$37.00$|,||,|HUDSON-JEANS-TWEEN-GIRLS-DENIM-JACKET|,|$URL$hudson-jeans-tween-girls-denim-jacket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hudson-jeans-tween-girls-denim-jacket-1.jpg||-||Hudson Jeans Tween Skinny Jean in Grey and Black|,|A classic fit with a subtle twist, these new tween jeans were designed by the fabulous Hudson brand. The grey jeans boast of a slim fit and a light stretch cotton blend that provides an all day comfort. The grey is textured with a darker camo print. The jeans offer five pockets, a button zipper fly, and traditional belt loops. Cotton elastane blend. Machine wash and lay flat to air dry. |,|$27.33$|,||,|HUDSON-JEANS-TWEEN-SKINNY-JEANS-GREY-BLACK|,|$URL$hudson-jeans-tween-skinny-jeans-grey-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hudson-jeans-tween-skinny-jean-in-grey-and-black-2.jpg||-||Hudson Jeans Tween Skinny Jeans with Studs|,|A fabulous new arrival from Hudson Jeans for kids, these tween pants are filled with fun and wonder. The unique wash is a darker blue accented with fading, whiskering, and distressed fraying. The front of these fabulous pants are sprinkled with small silver studs giving a completely unique feel. The skinny leg is right on trend while faux front pockets stay true to your classic blue jean look. Her back pockets are dressed with a single button flap. Created with a stretch cotton blend; machine wash and tumble dry. |,|$24.33$|,||,|HUDSON-JEANS-TWEEN-SKINNY-JEANS-STUDS|,|$URL$hudson-jeans-tween-skinny-jeans-studs.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hudson-jeans-tween-skinny-jeans-with-studs-1.jpg||-||Hudson Jeans Tween Skinny Pant in Black Knit (Size 10 & 16)|,|^|Offering a comfortable way to dress up her favorite tops, these new tween pants come from the designer Hudson. The black knit fabric hugs her legs with the slight stretch in its fit. Cut in a slim shape from waist down to her ankle, these pants are trendy and easy to wear at any occasion. A zipper button fly closes the front while the pant boasts of five pockets. Fabric is a polyester-rayon blend with 5% spandex. Machine wash with like colors, tumble dry if necessary. Recommended: lay flat to dry to preserve color longer. SIZE 10 & 16 LEFT.  ^||,|$17.33$|,||,|HUDSON-JEANS-TWEEN-SKINNY-PANT-BLACK-KNIT|,|$URL$hudson-jeans-tween-skinny-pant-black-knit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hudson-jeans-tween-skinny-pant-in-black-knit-2.jpg||-||Hudson Jeans Yellow Shorts for Tweens|,|A bright summer piece, this new creation from Hudson Jeans is available in tween sizes. The yellow shorts boasts of a classic fit while three pockets are found on the front and two on the back. The waist is white to match the stripe found on the outer side of both legs. A zipper and button secure the fit. This yellow compliments the summer sunshine. Made with cotton blend. Machine wash cold, tumble dry medium. |,|$14.33$|,||,|HUDSON-JEANS-YELLOW-SHORTS-TWEENS|,|$URL$hudson-jeans-yellow-shorts-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hudson-jeans-yellow-shorts-for-tweens-1.jpg||-||I Love Gorgeous Eliza Girls Dress in Grey and Turquoise ( 4/5)|,|^|This girls dress comes across the pond from fabulous London designer I Love Gorgeous. The lace overlay in grey will capture her imagination. The bodice boasts of grey trim and a keyhole opening on the front with two buttons. The ruffled sleeves are fringed in lace. Elastic at the waist is finished with the same grey trim as the neckline. A fringed lace ruffle trims out the hemline. A sassy lace pocket sits on each side of the skirt. The lining is of turquoise and peaks through the lace overlay. Made from nylon/cotton. Hand wash cold, lay flat to dry. SIZE 4/5 ONLY LEFT. ^||,|$39.00$|,||,|I-LOVE-GORGEOUS-ELIZA-GIRLS-DRESS-GREY-TURQUOISE|,|$URL$i-love-gorgeous-eliza-girls-dress-grey-turquoise.html|,|http://ep.yimg.com/ay/yhst-17102259411242/i-love-gorgeous-eliza-girls-dress-in-grey-and-turquoise-15.jpg||-||Isaac Mizrahi Tween Skinnies in Fuchsia Knit (Size 16)|,|^|Designed for your darling daughter, these new pink pants from Isaac Mizrahi will spark hint of confidence in her step. The knit pants stretch for a comfort, fitted look that compliments her trendy tops. The bright fuchsia adds a punch of color that stands out in the fall while a button and zipper closes up the front. Belt loops are also found on the waist. Made with a polyester blend. Machine wash cold, tumble dry low. (1) 16 LEFT. ^||,|$19.00$|,||,|ISAAC-MIZRAHI-TWEEN-SKINNIES-FUCHSIA-KNIT|,|$URL$isaac-mizrahi-tween-skinnies-fuchsia-knit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isaac-mizrahi-tween-skinnies-in-fuchsia-knit-3.jpg||-||Isaac Mizrahi Wild Leopard Tween Skinny Jeans (Size 12)|,|^|A spicy style from Isaac Mizrahi sure to transform any top into a fabulous tween outfit. The skinny jean style pairs perfectly with her favorite shoes while the cut is fitted and classic. A zipper and button close up the front while the light tan is spotted with a fun leopard print. Made with a polyester blend. Machine wash cold, tumble dry low. SIZE 12 ONLY LEFT.  ^||,|$19.00$|,||,|ISAAC-MIZRAHI-WILD-LEOPARD-TWEEN-SKINNY-JEANS|,|$URL$isaac-mizrahi-wild-leopard-tween-skinny-jeans.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isaac-mizrahi-wild-leopard-tween-skinny-jeans-2.jpg||-||Isobella & Chloe Bon Voyage Girls Tulle Dress (Size 5 & 7)|,|^|Matching a younger style from the ""Bon Voyage"" collection, this new girls dress is filled with style from Isobella and Chloe. The dress begins with a row of flowers that are layered in tulle and line the neck while the straps are a coordinating light shade. The dress features three groupings of ruffled tiers that blend several shades of pink and purple to create a dreamy effect. The overlay allows the lining to peek through. She is sure to be enchanted by this lovely design! SIZE 5 & 7 REMAINING.  ^||,|$39.00$|,||,|ISOBELLA-CHLOE-BON-VOYAGE-GIRLS-TULLE-DRESS|,|$URL$isobella-chloe-bon-voyage-girls-tulle-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-chloe-bon-voyage-girls-tulle-dress-1.jpg||-||Isobella & Chloe Cute as a Button Girls Dress (7, 8 & 10)|,|Filled with a gorgeous blend of color, this new designer casual dress comes from the one and only Isobella and Chloe. The empire bodice offers her a sleeveless neckline trimmed in stone grey. The center of the bodice is dressed with the same grey ruffled in tiers. The side of the dress introduces a pop of pink in a bright candy and a sweet pale shade. These colors continue into the skirt that opens in fit. The hemline is cut for an uneven look that is partially inspired by the trendy handkerchief design. |,|$29.00$|,||,|ISOBELLA-CHLOE-CUTE-BUTTON-GIRLS-DRESS|,|$URL$isobella-chloe-cute-button-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-chloe-cute-as-a-button-girls-dress-1.jpg||-||Isobella & Chloe Flower Girls Dress in White Ruffles|,|This new white summer dress from designer Isobella and Chloe is perfect for the flower girl has she spreads her petals down the aisle. The neckline is darling and closed in the back. The entire relaxed fit dress is covered with tiny ruffles tiered to the hemline. The ruffles add volume to the dress that cannot be beat! |,|$29.00$|,||,|ISOBELLA-CHLOE-FLOWER-GIRLS-DRESS-WHITE-RUFFLES|,|$URL$isobella-chloe-flower-girls-dress-white-ruffles.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-chloe-flower-girls-dress-in-white-ruffles-1.jpg||-||Isobella & Chloe Pink Girls Summer Outfit with Lace (12 Mos)|,|^|A creation from the ""Macaron"" collection by designer Isobella and Chloe, this new little girls outfit is ready for summer. The tunic offers her a straight, sleeveless neckline. The empire waist is defined by the tiers of ruffles that are layered with subtle lace. A single flower found near the hem matches the trio that sits just beneath her right shoulder. Matching pants are worn beneath. The fabric is soft and comfortable, allowing slight stretch. The hem of both legs is dressed with the same sugary sweet ruffles. ONE 12 MOS MOS ONLY REMAINING. ^||,|$29.00$|,||,|ISOBELLA-CHLOE-PINK-GIRLS-SUMMER-OUFIT-LACE|,|$URL$isobella-chloe-pink-girls-summer-oufit-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-chloe-pink-girls-summer-oufit-with-lace-1.jpg||-||Isobella & Chloe Sweet Caroline Girls Raspberry Capri Set (3 Mos, 6 Mos, 12 Mos)|,|In a cool raspberry tie dye, this new girls set comes from the fabulous designer Isobella and Chloe. The empire bodice on the top features wide, smocked straps, and a straight neckline. The flower pattern is a gorgeous addition of texture and complimented by the trio of rosettes that sit off to the left side. The skirt of the top is covered with layers of ruffles that wrap around the sides down the tiered ruffle hemline. Matching pink tie dye pants are worn beneath and finished in the same fun ruffles. Be sure to look for the wonderful matching pieces that are available in older sizes. |,|$26.33$|,||,|ISOBELLA-CHLOE-SWEET-CAROLE-GIRLS-RASPBERRY-CAPRI-SET|,|$URL$isobella-chloe-sweet-carole-girls-raspberry-capri-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-chloe-sweet-caroline-girls-raspberry-capri-set-1.jpg||-||Isobella & Chloe Violet Dress Darlene|,|A vibrant violet shade, this new designer girls dress comes from designer Isobella and Chloe. The purple dress is started with a boat neckline that is secured in the back. The sheer ruffles are layered, gaining volume as they reach the hemline. This gorgeous dress is sure to gain many compliments this Easter and summer season! |,|$29.00$|,||,|ISOBELLA-CHLOE-VIOLET-DRESS-DARLENE|,|$URL$isobella-chloe-violet-dress-darlene.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-chloe-violet-dress-darlene-1.jpg||-||Isobella and Chloe Black & White Girls Star Flower Headband|,|From designer Isobella and Chloe, this girls headband will finish off many outfits perfectly! The thin headband is covered with a black knit while the two tone flowers boast of small beaded accents. |,|$9.00$|,||,|ISOBELLA-CHLOE-BLACK-WHITE-GIRLS-STAR-FLOWER-HEADBAND|,|$URL$isobella-chloe-black-white-girls-star-flower-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-black-white-girls-star-flower-headband-12.jpg||-||Isobella and Chloe Black Bolero Girls Shrug in Velour (Size 12 Mos)|,|^|Designed to match with their fabulous dresses, this Isobella and Chloe shrug is available in a wide size range. The soft black velour is filled with winter cheer while long sleeves add warmth. The bolero cut is stylish and will not detract from her gorgeous dress layered underneath. The front is dressed with ruffles and a long tie that closes the front shut.. Made with a polyester blend. Hand wash cold, line dry. ONE SIZE 12 MOS LEFT.  ^||,|$14.33$|,||,|ISOBELLA-CHLOE-BLACK-BOLERO-GIRLS-SHRUG-VELOUR|,|$URL$isobella-chloe-black-bolero-girls-shrug-velour.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-black-bolero-girls-shrug-in-velour-2.jpg||-||Isobella and Chloe Black Sleeveless Neverland Dress for Girls (6X)|,|^|Whether she is celebrating a holiday with the family or showing her talent at a recital, this darling new dress from Isobella and Chloe will shine bright. The empire waist bodice features a wide neckline in a square shape and two sheer flowers accenting her right shoulder. The tiers of sheer ruffles in black recieve a subtle touch of color with a midnight blue gradient effect. The A line skirt is made with the same sheer fabric, boasting of sparkles that catch the light as she moves. Match with her younger sister's ""Neverland"" dress for a cute pair! Made with 100% polyester, hand wash this dress and line dry. (1) 6X ONLY LEFT.  ^||,|$24.33$|,||,|ISOBELLA-CHLOE-BLACK-SLEEVELESS-NEVERLAND-DRESS-GIRLS|,|$URL$isobella-chloe-black-sleeveless-neverland-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-black-sleeveless-neverland-dress-for-girls-3.jpg||-||Isobella and Chloe Blue Moon Girls Ruffle Headband|,|New from Isobella and Chloe, this girls headband is too cute. Covered in brown and blue ruffles, this soft headband stretches around her head and is adorned with a matching circle flower. |,|$7.00$|,||,|ISOBELLA-CHLOE-BLUE-MOON-GIRLS-RUFFLE-HEADBAND|,|$URL$isobella-chloe-blue-moon-girls-ruffle-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-blue-moon-girls-ruffle-headband-11.jpg||-||Isobella and Chloe Brown Velvet Winter Coat for Girls|,|A girls dress coat that is fabulously elegant, this new design from Isobella and Chloe is a beautiful example of their sweet styles. The coat is finished in a bubble hemline while the drape of the soft velvet is graceful. Three large buttons fasten in the front while a flower sits just beneath the pleated collar. 100% Polyester. Hand Wash in Cold Water. Hang to Dry. |,|$36.75$|,||,|ISOBELLA-AND-CHLOE-BROWN-VELVET-WINTER-COAT-GIRLS|,|$URL$isobella-and-chloe-brown-velvet-winter-coat-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-brown-velvet-winter-coat-for-girls-1.jpg||-||Isobella and Chloe Casual Girls Tunic and Legging in Gray|,|Designed by Isobella and Chloe, this adorable girls top and legging set is one she can wear any day! The empire waistline is accented with a large striped bow that is set off to one side. The neckline is layered with the same thin stripes. The tunic opens in shape after the waist with a skirt that twirls about as she walks and finishes in an asymmetrical hem. The black leggings that are paired beneath offer a comfortable stretch fit and a trendy look. |,|$29.00$|,||,|ISOBELLA-CHLOE-CASUAL-GIRLS-TUNIC-LEGGING-GRAY|,|$URL$isobella-chloe-casual-girls-tunic-legging-gray.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-casual-girls-tunic-and-legging-in-gray-17.jpg||-||Isobella and Chloe Chiffon Dress for Girls in Black Stella|,|A special occasion dress unlike the rest, this creation from Isobella and Chloe is positively gorgeous! The empire bodice is elegant and styled with a pleating design and darling flowers. The square neckline is shaped by the shoulder straps. The sheer overlay on the skirt has a beautiful movement and boasts of a single cascading ruffle down the front. 100% Polyester. Dry Clean Only. |,|$40.50$|,||,|ISOBELLA-AND-CHLOE-CHIFFON-DRESS-GIRLS-BLACK-STELLA|,|$URL$isobella-and-chloe-chiffon-dress-girls-black-stella.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-chiffon-dress-for-girls-in-black-stella-1.jpg||-||Isobella and Chloe Couture Outfit for Girls in Lavender (6 Mos, 9 Mos, 3T)|,|^|From Isobella & Chloe, this new girls tunic and pant set is a cute outfit she will love. The outfit features an empire waist bodice, a keyhole back, and long sleeves. The skirt of the tunic is introduced with a flower and is covered with textured fabrics. The cuffs are finished with a double ruffle to match the hem of the accompanying leggings. This tunic matches the ""Isobella and Chloe Girls Long Sleeve Dress in Lavender"" perfectly for a sweet sister pair. Cotton/Nylon/Spandex Blend. Hand Wash in Cold Water. Line Dry. ^||,|$36.75$|,||,|ISOBELLA-AND-CHLOE-COUTURE-OUTFIT-GIRLS-LAVENDER|,|$URL$isobella-and-chloe-couture-outfit-girls-lavender.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-couture-outfit-for-girls-in-lavender-1.jpg||-||Isobella and Chloe Creme Brulee Girls Ruffled Dress (6 Mos & 9 Mos)|,|^|A sweet new design, this fancy girls dress comes from designer Isobella and Chloe from their rich ""Creme Brulee"" collection. The bodice is gathered with pleats and fitted at the empire waistline. The straps create a square neckline while the small accents found on both are adorable small touches. The skirt falls in elegant ruffles that are layered with a sheer polka dot tulle. Be sure to find the older style that matches perfectly! SIZE 6 MOS AND 9 MOS REMAINING. ^||,|$36.00$|,||,|ISOBELLA-CHLOE-CREME-BRULEE-GIRLS-RUFFLED-DRESS|,|$URL$isobella-chloe-creme-brulee-girls-ruffled-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-creme-brulee-girls-ruffled-dress-1.jpg||-||Isobella and Chloe Drop Waist Dress for Girls in Black Lace|,|Perfect for recitals and parties, this new girls dress was designed by popular brand Isobella and Chloe. The black bodice has a fitted look with a sleeveless neckline. The waistline boasts of the two fabric flowers in white and black. The skirt is a unique blend of pattern and elegance with the alternating stripes and lace! Polyester/Nylon/Spandex Blend. Dry Clean Only. |,|$43.50$|,||,|ISOBELLA-AND-CHLOE-DROP-WAIST-DRESS-GIRLS-BLACK-LACE|,|$URL$isobella-and-chloe-drop-waist-dress-girls-black-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-drop-waist-dress-for-girls-in-black-lace-17.jpg||-||Isobella and Chloe Enya Teal Waves Little Girls Dress (Size 4)|,|^|A dress you are sure to love, this rich seaside teal is perfect for any occasion and comes from a well loved brand, Isobella and Chloe. The cap sleeve bodice is covered with pleats that wave across the front and are dressed with sequins. The waist is adorned with beading and the neckline is closed by a zipper that runs up the back. The skirt gains its shape from the pleats that fall from the waist. This taffeta fabric is classy and gorgeous! Polyester blend, hand wash this dress and line dry. ONE SIZE 4 REMAINING.  ^||,|$24.33$|,||,|ISOBELLA-CHLOE-ENYA-TEAL-WAVES-LITTLE-GIRLS-DRESS|,|$URL$isobella-chloe-enya-teal-waves-little-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-enya-teal-waves-little-girls-dress-2.jpg||-||Isobella and Chloe Evergreen Girls Spring Dress|,|A vibrant summer dress, this adorable creation comes from Isobella and Chloe. The bright green mimics the new life that was ushered in by spring time. The drop waist bodice is solid and fully lined. The back has a single keyhole that fastens at the top while a large sheer flower sits on her waistline. The skirt is draped with quaint ruffles in lime and ivory. This Isobella and Chloe dress is a one of a kind piece! |,|$38.00$|,||,|ISOBELLA-CHLOE-EVERGREEN-GIRLS-SPRING-DRESS|,|$URL$isobella-chloe-evergreen-girls-spring-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-evergreen-girls-spring-dress-1.jpg||-||Isobella and Chloe Fancy Little Girls Oufit|,|Bright and fun, this new girls outfit from Isobella and Chloe is unlike anything else that she owns in her summer closet. The designer girls dress offers her an empire waist and a single button keyhole back. The sleeveless neckline is accented with the unique rainbow shape stripes that are created with subtle tonal differences in the coral peach. The ivory and peach flower is layered and set to the left of the waist, finished with a decorated center. The skirt of the top finishes with a double layer of ruffles that sweep around the dress with grace and ease. The matching pants have an all day comfort that cannot be beat. The hem of both legs gains the same elegant touch of sheer fabric ruffles. |,|$29.00$|,||,|ISOBELLA-CHLOE-FANCY-LITTLE-GIRLS-OUFIT|,|$URL$isobella-chloe-fancy-little-girls-oufit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-fancy-little-girls-oufit-1.jpg||-||Isobella and Chloe Faux Fur Winter Coat for Girls in White|,|Created by fabulous Isobella and Chloe, this faux fur girls coat is soft and pretty with pink touches. The coat is cut in a swing style that has a bubble hem skirt and a lace overlay waist. The white faux fur is textured and complimented with the dusty pink on her collar and cuffs. A single flower accent is off centered. The front fastens while the coat is lined for comfort. 100% Polyester. Hand Wash in Cold Water. Hang to Dry. |,|$36.75$|,||,|ISOBELLA-AND-CHLOE-FAUX-FUR-WINTER-COAT-GIRLS-WHITE|,|$URL$isobella-and-chloe-faux-fur-winter-coat-girls-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-faux-fur-winter-coat-for-girls-in-white-1.jpg||-||Isobella and Chloe Frilly Pant Set For Girls in Melody|,|^|Created by Isobella & Chloe, this new girls tunic is part of their ""Melody"" collection. The taupe is a perfect fall shade while the touches of coral are a great pop of color. The empire waistline is finished with a ruffle and dressed with a bow. The skirt is covered with ruffles in various sizes and fabrics. The leggings paired beneath are a solid taupe and offer slight stretch in fit. Cotton/Spandex Blend. Hand Wash in Cold Water. Hang to Dry. ^||,|$36.75$|,||,|ISOBELLA-AND-CHLOE-FRILLY-PANT-SET-GIRLS-MELODY|,|$URL$isobella-and-chloe-frilly-pant-set-girls-melody.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-frilly-pant-set-for-girls-in-melody-1.jpg||-||Isobella and Chloe Girls Capped Sleeve Dress in Reese (12 Mos, 24 Mos & 2T)|,|^|From Isobella and Chloe, this new girls dress is a sweet creation for the fall and winter season. The textured bodice has cap sleeves and a wide neckline. A hidden zipper in the back secures the fit while a twist of fabric and a flower sits on her empire waist. The skirt drapes around her legs beautifully in a full circle shape. Ruffles style the skirt perfectly! While supplies last, a matching dress is available for her older sister! 100% Polyester. Dry Clean Only. SIZE 12 MOS, 24 MOS, & 2T LEFT. ^||,|$36.75$|,||,|ISOBELLA-AND-CHLOE-GIRLS-CAPPED-SLEEVE-DRESS-REESE|,|$URL$isobella-and-chloe-girls-capped-sleeve-dress-reese.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-capped-sleeve-dress-in-reese-33.jpg||-||Isobella and Chloe Girls Chiffon Layered Dress in Coral Kiss|,|A unique beauty, this design is from Isobella and Chloe. The dress features a burnout overlay that covers the bodice in a fun pattern. The bold coral is a hot color and looks fabulous blended with the cool sea blue. A touch of fabric accents her waist and is adorned by a flower. The layered skirt is made up with tiers of sheer fabric in sweet shades. 100% Polyester. Dry clean only. |,|$36.75$|,||,|ISOBELLA-AND-CHLOE-GIRLS-CHIFFON-LAYERED-DRESS-CORAL-KISS|,|$URL$isobella-and-chloe-girls-chiffon-layered-dress-coral-kiss.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-chiffon-layered-dress-in-coral-kiss-1.jpg||-||Isobella and Chloe Girls Designer Dress in Whirlwind Stripes|,|Created by designer Isobella and Chloe, this new girls dress is such a gem. The bodice of the dress is textured upon the front and fitted with a hidden zipper in the back. The long sleeves are finished with a sweet ruffle. Her empire waist is defined with a small touch of fabric and a cute flower. The skirt turns the thin stripes for a unique look while the hem is finished with three ruffles. Polyester/Rayon/Spandex Blend. Hand Wash in Cold Water. Hang to Dry. |,|$36.75$|,||,|ISOBELLA-AND-CHLOE-GIRLS-DESIGNER-DRESS-WHIRLWIND-STRIPES|,|$URL$isobella-and-chloe-girls-designer-dress-whirlwind-stripes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-designer-dress-in-whirlwind-stripes-1.jpg||-||Isobella and Chloe Girls Drop Waist Dress in Coral Lace|,|Isobella & Chloe designed this gorgeous girls dress by blending to unique colors. The warm coral tone blended with the cool blue is truly unique. The bodice has a fitted look with a drop waist and cap sleeves. The tropical pattern on the bodice is created by the burnout overlay. The layers of soft tulle create the tutu inspired skirt. 100% Polyester. Dry Clean Only. |,|$43.50$|,||,|ISOBELLA-AND-CHLOE-GIRLS-DROP-WAIST-DRESS-CORAL-LACE|,|$URL$isobella-and-chloe-girls-drop-waist-dress-coral-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-drop-waist-dress-in-coral-lace-1.jpg||-||Isobella and Chloe Girls Empire Waist Dress for Holiday|,|A gorgeous look for the holiday season, this new designer girls dress from Isobella and Chloe is a timeless look for your family holiday photos. The empire bodice has a fitted cut and features a cap sleeve. The rose texture catches the light in a unique, beautiful way. The waistline has a thin line of sparkle to help accent shape. The skirt is created with layers of sheer tulle draping down into three tiers from the waist. 100% Polyester. Dry Clean Only. |,|$40.50$|,||,|ISOBELLA-AND-CHLOE-GIRLS-EMPIRE-WAIST-DRESS-HOLIDAY|,|$URL$isobella-and-chloe-girls-empire-waist-dress-holiday.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-empire-waist-dress-for-holiday-1.jpg||-||Isobella and Chloe Girls Fancy Outfit in Raspberry|,|^|A gorgeous shade of raspberry pink, this fabulous girls birthday dress comes from designer Isobella and Chloe. The top is cut with a wide, straight neckline that is sleeveless and featuring pleats covering the empire bodice. A ruffle wraps around the top and accented with a ruffle flower. The skirt is draped in layers of sheer tulle that falls into the volume-filled hem wrapped in ruffles. Matching pink leggings are worn beneath and have a stretch waistband that is comfortable. The hemline of both legs are finished with two rows of ruffles. Be sure to find the matching ""Raspberry Limeade"" dress for her older sister! ^||,|$29.00$|,||,|ISOBELLA-CHLOE-GIRLS-FANCY-OUTFIT-RASPBERRY|,|$URL$isobella-chloe-girls-fancy-outfit-raspberry.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-fancy-outfit-in-raspberry-1.jpg||-||Isobella and Chloe Girls Holiday Dress in Dark Gray (Size 7 & 8)|,|^|Positively stunning, this holiday dress from designer Isobella and Chloe will make a subtle statement of chic this holiday season. The sleeveless dress boasts of glittering straps and a matching bow that sits on her left shoulder. The dark gray chiffon fabric drapes beautifully in a continuous silhouette from her shoulders to the hem. Gathers on the scoop neckline open up the shape and fit. 100% polyester. Hand wash cold, line dry. SIZE 7 AND 8 REMAINING. ^||,|$24.33$|,||,|ISOBELLA-CHLOE-GIRLS-HOLIDAY-DRESS-NAVY|,|$URL$isobella-chloe-girls-holiday-dress-navy.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-holiday-dress-in-dark-gray-2.jpg||-||Isobella and Chloe Girls Ivory Dress (Size 10)|,|^|Tiers of ruffles in ivory cotton make this dress from Isobella and Chloe the perfect choice for her spring and summer events. Ruffled straps adorn the square bodice, along with two ivory flowers. Tiers of ruffles define the skirt. Ties and a full zipper are features of the back. Fully line with polyester for comfort. 100% cotton, exclusive of lining. Hand wash cold, line dry. ONE SIZE 10 LEFT. ^||,|$24.33$|,||,|ISOBELLA-CHLOE-GIRLS-IVORY-DRESS|,|$URL$isobella-chloe-girls-ivory-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-ivory-dress-15.jpg||-||Isobella and Chloe Girls Lace Holiday Dress in Audrey (Size 2T)|,|^|With short sleeve and a timeless style, this new holiday dress from Isobella and Chloe really takes the cake. The fitted bodice is covered by a graceful black tulle overlay covered with a textured chiffon lace and features cap sleeves and a zipper closing the back. The skirt is tiered with black chiffon ruffles, sheer and fluffy like frosting. She will never want to take this dress off! Wear it to family weddings, holiday celebrations, or recitals! Matches with a younger style for sister pairs. Polyester blend, dry clean recommended. ONE SIZE 2T ONLY LEFT.  ^||,|$29.33$|,||,|ISOBELLA-CHLOE-GIRLS-LACE-HOLIDAY-DRESS-AUDREY|,|$URL$isobella-chloe-girls-lace-holiday-dress-audrey.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-lace-holiday-dress-in-audrey-3.jpg||-||Isobella and Chloe Girls Laura Empire Waist Dress (4 & 6)|,|A beautiful choice for your beautiful girl, this girls empire waist dress is from designer Isobella and Chloe. The strappy bodice places host to swirls of black and white with a diagonal panel of black on the right side. The shoulder straps have a braid of black and white over a solid white strap. The skirt flows from an empire waist and is done in panels of white. Black stitching in a vertical pattern breaks up each panel of white. A full zipper is located on the back along with string ties that finish off in a bow. The dress is fully lined. Made from cotton/polyester. Hand wash cold, line dry. |,|$29.00$|,||,|ISOBELLA-CHLOE-GIRLS-LAURA-EMPIRE-WAIST-DRESS|,|$URL$isobella-chloe-girls-laura-empire-waist-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-laura-empire-waist-dress-16.jpg||-||Isobella and Chloe Girls Long Sleeve Dress in Lavender (3T)|,|^|Isobella and Chloe created this little girls dress as a part of their fall and winter collection. The dress has a drop waist and offers a hidden zipper in the back. The long sleeves help keep her arms warm while a touch of fabric falls from her left shoulder to the flowers at her waist. The skirt has a unique look with two different textured fabrics alternated with some ruffles. This dress is offers a full lining and is as comfortable as can be. Cotton/Nylon/Spandex Blend. Hand Wash in Cold Water. Hang to Dry. SIZE 3T ONLY LEFT.  ^||,|$40.50$|,||,|ISOBELLA-AND-CHLOE-GIRLS-LONG-SLEEVE-DRESS-LAVENDER|,|$URL$isobella-and-chloe-girls-long-sleeve-dress-lavender.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-long-sleeve-dress-in-lavender-1.jpg||-||Isobella and Chloe Girls Party Dress in Candied Ginger|,|^|A pretty girls birthday dress, this new creation from Isobella and Chloe is called ""Candied Ginger."" The cap sleeve bodice is adorable and covered with a vertical, chevron overlay. A zipper closes up the back while a single flower sits off centered on her waistline. The pink skirt is draped with pleated ruffles that begin at the waist and finish on the hem. 100% Polyester. Dry Clean Only. ^||,|$43.50$|,||,|ISOBELLA-AND-CHLOE-GIRLS-PARTY-DRESS-CANDIED-GINGER|,|$URL$isobella-and-chloe-girls-party-dress-candied-ginger.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-party-dress-in-candied-ginger-1.jpg||-||Isobella and Chloe Girls Ruffle Dress in Karen Brown (18 Mos, 4T & 4)|,|Boasting of its unique textured fabric, this ruffle dress from Isobella and Chloe fits the fall and winter holidays perfectly. With a classy and timeless sheen, the cap sleeve bodice is made with a taffeta like fabric that gathers slightly at the waist which is adorned by a cute bow. The tiered skirt has dark brown layers overlayed with a tweed like fabric that adds character and style. A matching drop waist dress is available in older sizes. Dry clean recommended to keep this dress looking its best. 100% polyester. |,|$29.00$|,||,|ISOBELLA-CHLOE-GIRLS-RUFFLE-DRESS-KAREN-BROWN|,|$URL$isobella-chloe-girls-ruffle-dress-karen-brown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-ruffle-dress-in-karen-brown-2.jpg||-||Isobella and Chloe Girls Ruffle Winter Coat in Blue|,|A cute winter coat she can wear all season long, this style was created by Isobella and Chloe. The coat offers a classic collar and a row of large buttons that run down the front. The relaxed fit is comfortable and warm and dressed up with a rosette and ruffle. The coat is skirted with ruffles on the hem. 100% Polyester. Hand Wash in Cold Water. Hang to Dry. |,|$31.50$|,||,|ISOBELLA-AND-CHLOE-GIRLS-RUFFLE-WINTER-COAT-BLUE|,|$URL$isobella-and-chloe-girls-ruffle-winter-coat-blue.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-ruffle-winter-coat-in-blue-1.jpg||-||Isobella and Chloe Girls Special Occasion Dress in Black (12Mos, 2T & 4T)|,|Designer Isobella and Chloe designed this new girls dress as a part of the new fall and winter collection. This dress features a solid bodice with cap sleeves and an empire waistline. A hidden zipper runs up the back and flower accents are set off to one side of her waist. The skirt is covered with a sheer overlay. This overlay is dressed with stripes that are both solid black and created with elegant lace. This dress matches the Drop Waist Dress for Girls in Black Lace for a gorgeous sister match. Polyester/Nylon/Spandex Blend. Dry Clean Only. |,|$36.75$|,||,|ISOBELLA-AND-CHLOE-GIRLS-SPECIAL-OCCASION-DRESS-BLACK|,|$URL$isobella-and-chloe-girls-special-occasion-dress-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-special-occasion-dress-in-black-1.jpg||-||Isobella and Chloe Girls Special Occasion Dress in Monet|,|Matching her older sisters dress, this new arrival from Isobella and Chloe is absolutely gorgeous. Cap sleeves frame the neckline while a zipper closes the back. The empire waist is adorned with a waving ruffle and a single flower. The soft velvet fabric coordinates perfectly with the more structured skirt. A final ruffle wraps around the hemline to complete the look. Polyester/Spandex Blend. Dry Clean Only. |,|$36.75$|,||,|ISOBELLA-AND-CHLOE-GIRLS-SPECIAL-OCCASION-DRESS-MONET|,|$URL$isobella-and-chloe-girls-special-occasion-dress-monet.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-special-occasion-dress-in-monet-1.jpg||-||Isobella and Chloe Girls Tunic Dress Pant Set in Red (3T, 4)|,|^|In a true red, this new designer outfit from Isobella & Chloe is a comfortable design she will love to wear! The tunic features fabric flowers decorating the neckline and a button keyhole on the back. The skirt opens in shape and is dressed with ruffles from waist to the fun hem. A solid pair of leggings is worn beneath this tunic to add warmth. Cotton/Spandex Blend. Hand Wash in Cold Water. Hang to Dry.SIZE 3T & 4 AVAILABLE.  ^||,|$31.50$|,||,|ISOBELLA-AND-CHLOE-GIRLS-TUNIC-DRESS-PANT-SET-RED|,|$URL$isobella-and-chloe-girls-tunic-dress-pant-set-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-tunic-dress-pant-set-in-red-1.jpg||-||Isobella and Chloe Girls Tutu Dress Red Polka Dot|,|Matching several other new arrivals from Isobella and Chloe, this new little girls dress is too cute! The black and white striped bodice has a diagonal stripe that changes direction. The long sleeve top boasts of a single button keyhole back and a fitted shape. This skirt of this dress features sheer grey ruffles that ruffle around her legs in three tiers. Large cherry red polka dots cover the tulle and add a splash of color. Polyester blend, hand wash this dress and line dry. |,|$24.33$|,||,|ISOBELLA-CHLOE-GIRLS-TUTU-DRESS-RED-POLKA-DOT|,|$URL$isobella-chloe-girls-tutu-dress-red-polka-dot.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-tutu-dress-red-polka-dot-2.jpg||-||Isobella and Chloe Girls Twirl Dress in Bella Bow|,|Suited for a fairy princess, this new designer little girls dress from Isobella and Chloe is a beautiful creation that will be adored at first sight! The empire bodice features cap sleeves and a sweet sequin decoration that accents the front. A hidden zipper runs up the back while three fabric flowers sit on the waist. The skirt is created with layers of sheer fabric in various colors. The fairy hemline is a magical design. 100% Polyester. Dry Clean Only. |,|$36.75$|,||,|ISOBELLA-AND-CHLOE-GIRLS-TWIRL-DRESS-BELLA-BOW|,|$URL$isobella-and-chloe-girls-twirl-dress-bella-bow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-twirl-dress-in-bella-bow-1.jpg||-||Isobella and Chloe Girls Two Piece Swimsuit (14)|,|^|From Isobella and Chloe, this designer bikini for girls is sure to be a favorite choice whether she is at the beach or pool. Dark blue covers this suit while the bandeaux top is cinched in the center and covered with waving ruffles. A matching flower sits upon the top while its twin is found on the coordinating bottoms. The same whimsical waves skirt around the bottoms. Be sure to find the other adorable suits available from their ""Tidal Wave"" collection. (1) SIZE 14 ONLY REMAINING.  ^||,|$23.00$|,||,|ISOBELLA-CHLOE-GIRLS-TWO-PIECE-SWIMSUIT|,|$URL$isobella-chloe-girls-two-piece-swimsuit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-two-piece-swimsuit-1.jpg||-||Isobella and Chloe Harmony Tunic and Pant for Little Girls|,|Too sweet to pass up, the Harmony outfits from Isobella and Chloe's fall 2013 collection are sure to go fast. This little girls tunic with pant is available from infant sizes to 4T. The bodice is voered with a brown and candy pink leopard print that is unique and trendy. The long sleves are striped with the same pink and bost of wide ruffle cuffs. Two rosettes sit on her pink wayst while the greay skirt is styled in an A line shape and finished with a double ruffle hem. Matching striped pants pair beneath iwth a comfortable fabric and wide ruffle hem. Matches perfectly to the two older styles available for her sisters, making the perfect family photo! Polyester blend, hand wash this dress and line dry. |,|$24.00$|,||,|ISOBELLA-CHLOE-HARMONY-TUNIC-PANT-LITTLE-GIRLS|,|$URL$isobella-chloe-harmony-tunic-pant-little-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-harmony-tunic-and-pant-for-little-girls-2.jpg||-||Isobella and Chloe Holiday Dress for Girls in Reese (6 & 8)|,|^|Standing apart from the rest, this unique designer dress for girls is from Isobella and Chloe. The dress features a single flower accent found just beneath the wide neckline. Quaint cap sleeves are a darling touch while the drop waist bodice is cut for a fitted look. The skirt is introduced with a twist of fabric and is dressed with ruffles galore! The dress is fully lined for her comfort. 100% Polyester. Dry Clean Only.SIZE 6 & 8 REMAINING. ^||,|$43.50$|,||,|ISOBELLA-AND-CHLOE-HOLIDAY-DRESS-GIRLS-RESE|,|$URL$isobella-and-chloe-holiday-dress-girls-rese.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-holiday-dress-for-girls-in-reese-1.jpg||-||Isobella and Chloe Holiday Dress for Girls in Silver|,|A holiday dress for little girls, this fabulous designer creation is from Isobella and Chloe. The bodice is covered with a rose pattern and features cap sleeves. The neckline is cut for a wider style while a hidden zipper runs up the back. The waistline has a small sparkling accent. The skirt is divided into three tiers of sheer layers. This beautiful dress is also available in younger sizes and in a red and black color while supplies last. 100% Polyester. Dry Clean Only. |,|$39.75$|,||,|ISOBELLA-AND-CHLOE-HOLIDAY-DRESS-GIRLS-SILVER|,|$URL$isobella-and-chloe-holiday-dress-girls-silver.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-holiday-dress-for-girls-in-silver-17.jpg||-||Isobella and Chloe Holiday Dress for Infants in Silver (12Mos & 24Mos)|,|^|Isobella and Chloe has created this darling infant dress to match her older sister's gown ""Isobella and Chloe Holiday Dress for Girls in Silver."" The dress features a ribbon flower texture that covers the bodice. Her neckline is framed by the adorable cap sleeves and a hidden zipper runs up the back. Two tulle flowers sit upon the waist and are decorated with beaded centers. A tulle tie creates a bow on her back. The skirt is layered with grey and black tulle finished in angled hems. This dress is identical to the older style except for smaller embellishments that are not safe for the younger girls! The dress is created in 100% polyester and is fully lined. Dry clean this dress for best results! ONE EACH SIZE 12 MOS & 24 MOS LEFT.  ^||,|$36.75$|,||,|ISOBELLA-AND-CHLOE-HOLIDAY-DRESS-INFANTS-SILVER|,|$URL$isobella-and-chloe-holiday-dress-infants-silver.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-holiday-dress-for-infant-in-silver-7.jpg||-||Isobella and Chloe Iceland Grey Faux Fur Jacket for Girls (Size 2T)|,|^|Soft and cozy, this new girls jacket comes from Isobella and Chloe. The grey faux fur covering the outside waves in texture while a grey satin accents a high waist. Two clear buttons close the front while a large chiffon and satin rosette sits on her right side. Made with polyester, not meant to be a winter coat. Dry clean only. (1) 2T LEFT. ^||,|$24.00$|,||,|ISOBELLA-CHLOE-ICELAND-GREY-FAUX-FUR-JACKET-GIRLS|,|$URL$isobella-chloe-iceland-grey-faux-fur-jacket-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-iceland-grey-faux-fur-jacket-for-girls-16.jpg||-||Isobella and Chloe Jazz Cat Girls Rosette Headband|,|^|Matching her new Jazz Cat dress or outfit, this girls headband is adorable! The trio of rosettes are made with grey and brown satin and a cream chiffon while the headband is wrapped with a charcoal knit. The flowers measure roughly 4"" in length. ^||,|$4.00$|,||,|ISOBELLA-CHLOE-JAZZ-CAT-GIRLS-ROSETTE-HEADBAND|,|$URL$isobella-chloe-jazz-cat-girls-rosette-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-jazz-cat-girls-rosette-headband-12.jpg||-||Isobella and Chloe Jersey Girl Tunic and Capri in Magenta|,|Vibrant and young, this fabulous girls outfit from Isobella and Chloe fits her to a tee. The sleeveless tunic offers her a racer back cut and a draping fit. The neckline scoops in the front while pleats fall down and open the shape. A large pocket is found on both dyes, covered with the same pink and grey stripes and accented with a single bow. Solid, bright pink leggings are paired with the dress to complete this amazing summer look. |,|$29.00$|,||,|ISOBELLA-CHLOE-JERSEY-GIRL-TUNIC-CAPRI-MAGENTA|,|$URL$isobella-chloe-jersey-girl-tunic-capri-magenta.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-jersey-girl-tunic-and-capri-in-magenta-1.jpg||-||Isobella and Chloe Knit Girls Dress in Magenta (5 & 6X)|,|^|A perfect match to the younger ""Jersey Girl"" outfit that has just arrived, this casual girls dress comes from Isobella and Chloe. The fabric is soft and comfortable while covered with light grey and a bright pink. The racer back cut falls in a scoop neckline on the front. The dress falls to a shark bite hemline that has a relaxed fit thanks to the pleating at the neckline. The sides of the dress have long pockets with bows at the top. The vibrant colors are sure to stand out in the bright summer sun.SIZE 5 & 6X REMAINING.  ^||,|$36.00$|,||,|ISOBELLA-CHLOE-KNIT-GIRLS-DRESS-MAGENTA|,|$URL$isobella-chloe-knit-girls-dress-magenta.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-knit-girls-dress-in-magenta-1.jpg||-||Isobella and Chloe Little Girls Dress Harmony Stripes (Size 3T)|,|^|Matching her sweet sister's outfit, this new dress from Isobella and Chloe is part of the ""Harmony"" patterns. The zipper that runs up the back of the dress gives an easy and sure fit while her long sleeves finish with wide cuffs. Trendy fuchsia leopard spots pounce on the bodice while two rosettes sit off centered at the waist. Her A line skirt alternates between brown and fuchsia stripe ruffles. Polyester blend, hand wash this dress and line dry. ONE SIZE 3T LEFT.  ^||,|$32.40$|,||,|ISOBELLA-CHLOE-LITTLE-GIRLS-DRESS-HARMONY-STRIPES|,|$URL$isobella-chloe-little-girls-dress-harmony-stripes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-little-girls-dress-harmony-stripes-3.jpg||-||Isobella and Chloe Little Girls Hawaiian Dress in Plumeria|,|Matching the Plumeria pant set, this new Isobella and Chloe dress is one she will certainly adore. The dress is styled to hit just near her knee and is created with comfortable fabric, complete with lining. The empire waist bodice has pleating falling from her neckline and a hidden zipper running up the back. A darling flower sits upon the waist and introduces the draping effect of the skirt. This style is defined perfectly with layers of pretty ruffles. The skirt offers an A line fit. Cotton/Spandex Blend. Hand Wash in Cold Water. Hang to Dry. |,|$34.50$|,||,|ISOBELLA-AND-CHLOE-LITTLE-GIRLS-HAWAIIAN-DRESS-PLUMERIA|,|$URL$isobella-and-chloe-little-girls-hawaiian-dress-plumeria.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-little-girls-hawaiian-dress-in-plumeria-1.jpg||-||Isobella and Chloe Little Girls Red Pant Set with Flower|,|^|Isobella & Chloe has created this new ""Dallas Doll"" tunic and pant set for your little girl's fall and winter closet. The true red is a great color for the season while the long sleeves keep her arms safe from the chilly air. A whimsical flower is found upon the front of the top with a stem that goes to the waistline and finishes with a bow. The tunic is finished with alternating layers of sheer ruffles in white and red. Matching solid leggings are found beneath. Cotton/Spandex Blend. Hand Wash in Cold Water. Hang to Dry. ^||,|$34.50$|,||,|ISOBELLA-AND-CHLOE-LITTLE-GIRLS-RED-PANT-SET-FLOWER|,|$URL$isobella-and-chloe-little-girls-red-pant-set-flower.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-little-girls-red-pant-set-with-flower-1.jpg||-||Isobella and Chloe Long Sleeve Girls Dress Holland Gray Dots|,|Sure to be her favorite school day dress, this new grey dress comes from designer Isobella and Chloe. The empire bodice boasts of a faux layered look as a zipper runs up the back. The shape opens in the skirt offering plenty of extra fabric to twirl and sway with her movement. The hemline is layered with multiple fabrics in ruffled tiers while lacey ivory flowers sit just above. The small dot print comes from the mesh overlay that covers the majority of the dress. Made with cotton blend. Line dry and hand wash. |,|$29.33$|,||,|ISOBELLA-CHLOE-LONG-SLEEVE-GIRLS-DRESS-HOLLAND-GRAY-DOTS|,|$URL$isobella-chloe-long-sleeve-girls-dress-holland-gray-dots.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-long-sleeve-girls-dress-holland-gray-dots-2.jpg||-||Isobella and Chloe Misty Heather Girls Dress (4 & 5)|,|^|A new arrival from the fabulous Isobella and Chloe, this new girls dress is sure to fill her summer days with fun. The bodice of the dress boasts of an oversized fabric bow that is skewed and off set to one side. The sleeveless neckline is layered with the stripes. The skirt falls in a handkerchief hemline that is sure to delight your darling daughter. The extra fabric of the skirt encourages her playful twirls and hops as the fabric sways gracefully around her energetic legs. SIZE 4 AND 5 ONLY REMAINING.  ^||,|$29.00$|,||,|ISOBELLA-CHLOE-MISTY-HEATHER-GIRLS-DRESS|,|$URL$isobella-chloe-misty-heather-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-misty-heather-girls-dress-1.jpg||-||Isobella and Chloe Neverland Cap Sleeve Ruffle Dress in Black - 2T|,|^|A fancy new design from loved Isobella and Chloe, this little girls dress is sure to welcome many compliments this coming holiday season. The empire bodice offers a wide square neckline and cute ruffled cap sleeves. Two quaint flowers are found on her waist while gradient shades of tulle tier down the skirt. Touches of sparkles and matching flowers fall down the ruffled waves. Pairs perfectly with her sisters Black Sleeveless Neverland Dress for Girls for unforgettable family photos and celebrations. Made with 100% polyester, hand wash this dress and line dry. SIZE 2T ONLY LEFT.  ^||,|$24.00$|,||,|ISOBELLA-CHLOE-NEVERLAND-CAP-SLEEVE-RUFFLE-DRESS-BLACK|,|$URL$isobella-chloe-neverland-cap-sleeve-ruffle-dress-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-neverland-cap-sleeve-ruffle-dress-in-black-2.jpg||-||Isobella and Chloe Pant Set for Girls in Hawaiian Plumeria|,|A beautiful design, this new girls tunic set is from Isobella and Chloe. The tunic features long sleeves and an empire waist. Slight pleating falls from the neckline and a button closes the keyhole on the back. The skirt falls in fun tiers in rich magenta. Alternating fabric ruffles accent the draping style. Matching pants are worn beneath with the same ruffles on the hem. Cotton/Spandex Blend. Hand Wash in Cold Water. Hang to Dry. |,|$31.50$|,||,|ISOBELLA-AND-CHLOE-PANT-SET-GIRLS-HAWAIIAN-PLUMERIA|,|$URL$isobella-and-chloe-pant-set-girls-hawaiian-plumeria.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-pant-set-for-girls-in-hawaiian-plumeria-1.jpg||-||Isobella and Chloe Peach and Cream Soft Headband|,|^|Created to match the ""Isobella and Chloe Fancy Little Girls Outfit"", this new designer accessory from Isobella and Chloe completes the darling look. The stretch headband is made with the same coral peach shade that is sure to take the summer by storm while it stretches to comfortably fit her head. The decoration is a flower made with several layers in ivory and coral peach tulle. A trio of gems is found at the center. ^||,|$9.00$|,||,|ISOBELLA-CHLOE-PEACH-CREAM-SOFT-HEADBAND|,|$URL$isobella-chloe-peach-cream-soft-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-peach-and-cream-soft-headband-1.jpg||-||Isobella and Chloe Pink Princess Pant Set with Rose|,|For your girly girl, this new pink tunic and pant is from Isobella and Chloe. The pale pink top offers long sleeves, a wide neckline, and pleating that falls from the neck. A keyhole is also found on the back while an oversized sheer flower sits on the front. The tutu inspired skirt with two different types of ruffled layers that create a dreamy effect! Solid candy pink leggings are worn beneath to finish the look. Cotton/Spandex Blend. Hand Wash in Cold Water. Hang to Dry. |,|$31.50$|,||,|ISOBELLA-AND-CHLOE-PINK-PRICESS-PANT-SET-ROSE|,|$URL$isobella-and-chloe-pink-pricess-pant-set-rose.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-pink-pricess-pant-set-with-rose-1.jpg||-||Isobella and Chloe Polka Dot Ruffle Pant Set (18 Mos, 3T)|,|^|An eye-catching design perfect for the start of school, this new little girls tunic and pant is from designer Isobella and Chloe. A scoop neckline styles the bodice along with a keyhole on the back. Long sleeves offer a touch of warmth while a ruffle sits upon the waistline. A Flower accent is also found on her waist with a round center. The hanky style of the skirt is finished with a ruffle while matching pants are worn beneath. Polyester Blend. Hand Wash in Cold Water. Hang to Dry. SIZE 18 MOS AND 3T ONLY LEFT.  ^||,|$34.50$|,||,|ISOBELLA-AND-CHLOE-POLKA-DOT-RUFFLE-PANT-SET|,|$URL$isobella-and-chloe-polka-dot-ruffle-pant-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-polka-dot-ruffle-pant-set-1.jpg||-||Isobella and Chloe Raspberry Girls Summer Dress (12 Mos)|,|^|This new girls dress from designer Isobella and Chloe is a part of their ""Sweet Caroline"" collection. The piece offers her a sleeveless neckline that is trimmed with quaint ribbons of ruffled fabric while three flowers sit upon a sheer bed under the right shoulder. The tie dye pattern is a rosy pink. The skirt is started with the sheer flower lace ruffled around and followed with several tiers. The pink and white tulle blend together beautifully and finished in a volume hemline that sways around her legs elegantly. SIZE 12 MOS ONLY LEFT.  ^||,|$29.00$|,||,|ISOBELLA-CHLOE-RASPBERRY-GIRLS-SUMMER-DRESS|,|$URL$isobella-chloe-raspberry-girls-summer-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-raspberry-girls-summer-dress-1.jpg||-||Isobella and Chloe Red Christmas Dress for Girls (9 Mos)|,|^|A baby girls dress that is gorgeous, this new design from Isobella and Chloe is a classical style that is loved by all. The dress features a hidden zipper and a ruffle wave accenting the waist. Puffy cap sleeves frame the neckline and a flower sits off centered. The skirt has an elegant, structured shape that is perfect for Christmas photos and celebrations! Polyester/Spandex Blend. Dry Clean Only. (1) 9 MOS ONLY LEFT. ^||,|$49.00$|,||,|ISOBELLA-AND-CHLOE-RED-CHRISTMAS-DRESS-GIRLS|,|$URL$isobella-and-chloe-red-christmas-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-red-christmas-dress-for-girls-1.jpg||-||Isobella and Chloe Red Star Flower Headband|,|A fun creation that suits her summer style, this red star flower headband is from Isobella and Chloe. The headband itself is covered with classic red fabric. The flowers are in red and white with rounded centers. Beads of black and white give the flowers a star quality. |,|$8.00$|,||,|ISOBELLA-CHLOE-RED-STAR-FLOWER-HEADBAND|,|$URL$isobella-chloe-red-star-flower-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-red-star-flower-headband-11.jpg||-||Isobella and Chloe Rosette Headband in Black|,|^|Created as the perfect match to ""Isobella & Chloe Little Girls Dress"" in black gingham, this sweet headband is a must have! The wrapped headband is thin and dainty as it sits easily upon her head. The oversized black gingham rosette sits off center while a few touches of tulle add the perfect level of texture. ^||,|$9.00$|,||,|ISOBELLA-CHLOE-ROSETTE-HEADBAND-BLACK|,|$URL$isobella-chloe-rosette-headband-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-rosette-headband-in-black-1.jpg||-||Isobella and Chloe Sleeveless Drop Waist Dress for Girls (4, 5 & 6X)|,|^|New from designer Isobella and Chloe, this fabulous girls dress is a part of their fall and winter 2013 collection. ""Karen"" is made from both rich color and rich fabric, making this a fall must have! The drop waist bodice is structured for a great fitted style and boasts of its textured tweed-like fabric. A bow sits upon the waist while the skirt flairs out a bit with its dark brown taffeta. A dress is fully lined and closed by a zipper that runs up the back. Dry clean recommended to keep this dress looking its best. 100% polyester. SIZE 4, 5 & 6X LEFT.  ^||,|$32.00$|,||,|ISOBELLA-CHLOE-SLEEVELESS-DROPWAIST-DRESS-GIRLS|,|$URL$isobella-chloe-sleeveless-dropwaist-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-sleeveless-drop-waist-dress-for-girls-3.jpg||-||Isobella and Chloe Special Occasion Girls Dress|,|A colorful creation, this new little girls dress comes from the creative Isobella and Chloe brand. The drop waist bodice is cut for a fitted look. The back is fastened with a single button keyhole while three stripes run across in pink, blue, and green. The large, oversized flower is layered in pinks with a sparkling blue center. The tutu inspired skirt fills this dress with so much fun. The tulle ruffles have a great volume and are layered to fade from a pink, to mint, to blue. |,|$29.00$|,||,|ISOBELLA-CHLOE-SPECIAL-OCCASION-GIRLS-DRESS|,|$URL$isobella-chloe-special-occasion-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-special-occasion-girls-dress-1.jpg||-||Isobella and Chloe Sunday Picnic Black and White Dress ( 4 )|,|^|Created in a unique style, this designer girls dress is newly available from Isobella and Chloe. The sweet dress is perfect for just about any celebration that she might have this summer. The bodice has an empire waist and is wrapped with ruffles. The V shaped neckline is created with a double ruffle and finds a small privacy panel in the front. The back is closed with a hidden zipper while a bow is tied for her own fit. The skirt opens in shape and is covered with the sheer overlay textured with dots. The white hemline accents the grey and is ruffled to match the bodice. SIZE 4 ONLY LEFT. ^||,|$39.00$|,||,|ISOBELLA-CHLOE-SUNDAY-PICNIC-BLACK-WHITE-DRESS|,|$URL$isobella-chloe-sunday-picnic-black-white-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-sunday-picnic-black-and-white-dress-1.jpg||-||Isobella and Chloe Tulle Soft Band in Magenta|,|^|A soft fabulous headband, this Isobella and Chloe accessory matches the ""Bon Voyage"" collection. The band stretches to fit around her head while the magenta tulle flowers are lined up and finished with sparkling centers. Set the flowers off center by a touch to make a polished look for any event or photos! ^||,|$9.00$|,||,|ISOBELLA-CHLOE-TULLE-SOFT-BAND-MAGENTA|,|$URL$isobella-chloe-tulle-soft-band-magenta.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-tulle-soft-band-in-magenta-1.jpg||-||Isobella and Chloe Tutti Frutti Girls Party Dress|,|^|This gorgeous new girls dress comes from Isobella and Chloe as a part of their ""Tutti Frutti"" collection. The bodice is fastened with a hidden zipper in the back and styled with a sleeveless neckline. A small touch of color is found in the trio of stripes that run horizontal. The tulle skirt is a sweet dream like confectioner's sugar as it falls down in lovely tiers. The skirt is introduce with an oversized flower that is layered in pink. The same pink is found on the top layer of the skirt while blending to mint green and a cool blue. ^||,|$29.00$|,||,|ISOBELLA-CHLOE-TUTTI-FRUTTI-GIRLS-PARTY-DRESS|,|$URL$isobella-chloe-tutti-frutti-girls-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-tutti-frutti-girls-party-dress-1.jpg||-||Isobella and Chloe Tutti Frutti Headband|,|^|Matching the new fabulous dresses from the ""Tutti Frutti"" collection, this designer girls headband is created by Isobella and Chloe. The thin headband is wrapped in pink and placed easily on her head. A single decoration sits off to one side colored in pink tulle. The large size of the flower adds to its cuteness while a touch of sparkle is found in the blue gem center. ^||,|$9.00$|,||,|ISOBELLA-CHLOE-TUTTI-FRUTTI-HEADBAND|,|$URL$isobella-chloe-tutti-frutti-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-tutti-frutti-headband-1.jpg||-||Isobella and Chloe Tutu Capri Outfit|,|^|A fun magenta blend, this new designer girls outfit from Isobella and Chloe is a set that is easy to fall in love with. The dreamy light straps frame the neckline that is accented with a group of layered flowers that sit on the front. The top is covered with a tulle overlay that allows the lining beneath to peak through. Countless tiers of ruffles frost the hemline gracefully. The matching pants are paired beneath and finished with ruffles to match! This little girls set is from the ""Bon Voyage"" collection. ^||,|$29.00$|,||,|ISOBELLA-CHLOE-TUTU-CAPRI-OUTFIT|,|$URL$isobella-chloe-tutu-capri-outfit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-tutu-capri-outfit-1.jpg||-||Isobella and Chloe Velour Girls Fancy Coat in Black (Size 5 & 6)|,|^|A design that is sure to add a chic style to her beautiful dresses, this fancy girls coat comes from Isobella and Chloe. The black velour look is warm and soft and is dressed up with a ruffled collar. The ruffles fall down the front and wrap around the hem. Sparkling buttons close up the front and two pockets sit just above the hem. Made with a polyester blend. Hand wash cold, line dry. SIZE 5 & 6 LEFT.  ^||,|$24.00$|,||,|ISOBELLA-CHLOE-VELOUR-GIRLS-FANCY-COAT-BLACK|,|$URL$isobella-chloe-velour-girls-fancy-coat-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-velour-girls-fancy-coat-in-black-39.jpg||-||Isobella and Chloe Velvet Pant Set for Girls in Violet|,|A winter outfit she will love wearing, this new creation from Isobella and Chloe is a dream. The deep plum velvet is the perfect seasonal color and boasts of elegance. The empire bodice is finished with cap sleeves, a pleated neckline, and two rosettes. The tunic opens in shape from the waist and is finished with a cute ruffle. Matching leggings come with the tunic and are paired underneath. 100% Polyester. Dry Clean Only. |,|$36.75$|,||,|ISOBELLA-AND-CHLOE-VELVET-PANT-SET-GIRLS-VIOLET|,|$URL$isobella-and-chloe-velvet-pant-set-girls-violet.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-velvet-pant-set-for-girls-in-violet-17.jpg||-||Isobella and Chloe White Chiffon Girls Headband|,|^|The glorious chiffon rosette sits on the thin girls headband with a jeweled center for a little shine. The headband pairs well with the Isobella and Chloe Flowers Girls Dress in White Ruffles. Perfect for a summer beach photo too.ONE LEFT.  ^||,|$9.00$|,||,|ISOBELLA-AND-CHLOE-WHITE-CHIFFON-GIRLS-HEADBAND|,|$URL$isobella-and-chloe-white-chiffon-girls-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-white-chiffon-girls-headband-1.jpg||-||Isobella and Chloe White Dress with Sequins Enchanted (Size 2T)|,|^|A truly enchanted design, this girls summer dress is from the well loved brand Isobella and Chloe. The empire bodice is covered with a sheer overlay that is dressed in dazzling sequins. A layered flower is placed at her waistline while a thin tie becomes a bow on her back. The tiered skirt blends the solid white and the glittering sheer ruffles brilliantly! This designer girls dress is perfect for weddings, recitals, birthdays, and summer parties! ALL SOLD OUT 11/29/14. ^||,|$29.00$|,||,|ISOBELLA-CHLOE-WHITE-DRESS-SEQUINS-ENCHANTED|,|$URL$isobella-chloe-white-dress-sequins-enchanted.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-white-dress-with-sequins-enchanted-1.jpg||-||Isobella and Chloe Winter Coat for Girls in Red Claire|,|A style that is perfect all winter long, this holiday red coat for girls is from Isobella and Chloe. The coat is warm and classy with the cute collar and the large buttons that close the front. A touch of ruffles in the rosette adornment matches the skirting hemline. Whether she is all dressed up or just running errands during the day, this is the perfect go to coat! 100% Polyester. Hand Wash in Cold Water. Hang to Dry. |,|$31.50$|,||,|ISOBELLA-AND-CHLOE-WINTER-COAT-GIRLS-RED-CLAIRE|,|$URL$isobella-and-chloe-winter-coat-girls-red-claire.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-winter-coat-for-girls-in-red-claire-1.jpg||-||Isobella and Chloe Winter Ruffle Coat for Girls in Gray and Pink|,|A sugary sweet design, this Isobella & Chloe winter coat for girls will become her favorite coat for the season. The soft grey is covered in a pink print that accents the faux fur found on the cuffs and collar. The pink faux fur features subtle spots. Three ruffles dance around the hemline while the large buttons close the front. 100% Polyester. Hand Wash in Cold Water. Hang to Dry. |,|$43.50$|,||,|ISOBELLA-CHLOE-WINTER-RUFFLE-COAT-GIRLS-GRAY-PINK|,|$URL$isobella-chloe-winter-ruffle-coat-girls-gray-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-winter-ruffle-coat-for-girls-in-gray-and-pink-1.jpg||-||Jak & Peppar Fray For You Tween Button Down Top|,|Designed by Jak & Peppar, this button down top is created for layering with her new free spirited outfits. The olive green that covers this top is an earthy tone that compliments nearly every new piece in their debut collection. The front is dressed with a touch of red stripes that are thin to resemble the railroad inspiration. A collar and a touch of frayed edges on her shoulders complete this look. A row of buttons sits upon the front while the back is opened with a touch of pleating. Cotton/Spandex Blend. Machine Wash in Cold Water. Tumble Dry in Low Heat. |,|$36.75$|,||,|JAK-PEPPAR-FRAY-YOU-TWEEN-BUTTON-DOWN-TOP|,|$URL$jak-peppar-fray-you-tween-button-down-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-peppar-fray-for-you-tween-button-down-top-preorder-1.jpg||-||Jak & Peppar Gertrude Head Wrap for Tweens in Vanilla|,|An accessory designed to go with many of the new arrivals, this fabulous creation from designer Jak and Peppar will finish her outfit off on the right note. The ivory headband features a flower print with a touch of yellow. A small twist styles the front. The headband stretches with a touch of elastic that is found at the back. |,|$18.00$|,||,|JAK-PEPPAR-GERTRUDE-HEAD-WRAP-TWEENS-VANILLA|,|$URL$jak-peppar-gertrude-head-wrap-tweens-vanilla.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-peppar-gertrude-head-wrap-for-tweens-in-vanilla-preorder-1.jpg||-||Jak & Peppar Girls Infinity Scarf in Burnt Red (Size Large 7-16)|,|^|An accessory she will love, this new infinity scarf for tweens is from Jak and Peppar. The scarf boasts of its rich red and ivory colors that is produced by the tie dye effect. The fabric is comfortable and has a fun texture. This red compliments most any new arrival from the Jak and Peppar fall collection. ONLY Hand Wash Cold Separately with Mild Detergent or soap, No Bleach, Line Dry. ONE LARGE REMAINING. ^||,|$28.50$|,||,|JAK-PEPPAR-GIRLS-INFINITY-SCARF-BURNT-RED|,|$URL$jak-peppar-girls-infinity-scarf-burnt-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-peppar-girls-infinity-scarf-in-burnt-red-preorder-7.jpg||-||Jak & Peppar Head Wrap for Tweens in Ivory (Size Large 7-16)|,|^|A gorgeous accessory, this new headband from Jak and Peppar matches perfectly to many of the new arrivals in their debut collection. The headband is a waving shape and boasts of the bead and sequin accents that run across the front. The back of the headband stretches for a custom and comfortable fit. SIZE LARGE 7-16 AVAILABLE.  ^||,|$19.50$|,||,|JAK-PEPPAR-HEAD-WRAP-TWEENS-IVORY|,|$URL$jak-peppar-head-wrap-tweens-ivory.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-peppar-head-wrap-for-tweens-in-ivory-preorder-1.jpg||-||Jak & Peppar Hi Low Tunic for Girls Joplin Red|,|An inspired design, this new tween trendy top comes from Jak and Peppar, a new brand just released for Fall 2014 from the creators of Mustard Pie. The top has a rich texture from the raw fiber fabric. The vanilla color is a cool blend with the rustic colors that dress the unique pattern on the front. This sleeveless top is perfect to layer with any of the new jackets from Jak & Peppar. Cotton/Rayon Blend. Machine Wash in Cold Water. Hang to Dry. |,|$36.75$|,||,|JAK-PEPPAR-HI-LOW-TUNIC-GIRLS-JOPLIN-RED|,|$URL$jak-peppar-hi-low-tunic-girls-joplin-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-peppar-hi-low-tunic-for-girls-joplin-red-preorder-1.jpg||-||Jak & Peppar Red Hudson Tween Dress|,|A lovely creation for tween girls, this new dress comes from Jak & Peppar. The Dress features a blouson bodice created by the stretch waist. Long sleeves offer warmth while the red fabric is dressed with a flower pattern. The skirt is finished with a straight hem. 100% Rayon. Machine Wash in Cold Water. Hang to Dry. |,|$43.50$|,||,|JAK-PEPPAR-RED-HUDSON-TWEEN-DRESS|,|$URL$jak-peppar-red-hudson-tween-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-peppar-red-hudson-tween-dress-preorder-1.jpg||-||Jak & Peppar Tween Dress Field of My Dreams|,|For your free spirited tween, this new Jak and Peppar dress is a gorgeous arrival. This brand is filled with styles that blend a trendy, earthy tone with a truly feminine look. The black dress offers her a casual fit bodice with long sleeves. Touches of mustard, red, and olive create the embroidered pattern that we find running down her long sleeves and down the center of the bodice. The straight skirt is easy to pair with leggings if desired. 100% Cotton. Machine Wash in Cold Water. Hang to Dry. |,|$51.75$|,||,|JAK-PEPPAR-TWEEN-DRESS-FIELD-OF-MY-DREAMS|,|$URL$jak-peppar-tween-dress-field-of-my-dreams.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-peppar-tween-dress-field-of-my-dreams-preorder-1.jpg||-||Jak & Peppar Tween Fur Vest with Plaid Lining|,|From Jak and Peppar, this new tween vest is a fabulous layer to add to her new tunics and dresses from their debut fall collection. The vest is covered with a rustic faux fur. The cropped shape is complimentary and looks beautiful with many different styles. A touch of faux fur is the perfect way to complete an outfit during the fall and winter season and this vest is sure to be a hit! The vest is lined in plaid. Acrylic/Polyester Blend. Dry Clean Only. |,|$36.75$|,||,|JAK-PEPPAR-TWEEN-FUR-VEST-PLAID-LINING|,|$URL$jak-peppar-tween-fur-vest-plaid-lining.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-peppar-tween-fur-vest-with-plaid-lining-preorder-1.jpg||-||Jak & Peppar Tween Girl Leggings in Olive (Size 14 & 16)|,|^|Layering beneath the new dresses and tunics, these Jak and Peppar leggings are a must have item for the fall and winter season! The soft olive green is a unique shade that matches many of the fabrics found within the collection. A touch of stitching creates X's down the outer side of both legs. The stretch fit is comfortable and easy to pair with boots! SIZE 14 & 16 LEFT. ^||,|$28.50$|,||,|JAK-PEPPAR-TWEEN-GIRL-LEGGINGS-OLIVE|,|$URL$jak-peppar-tween-girl-leggings-olive.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-peppar-tween-girl-leggings-in-olive-preorder-1.jpg||-||Jak & Peppar Tween Gypsy Tunic in Red|,|From Jak & Peppar, this new tween top is sure to be one of her favorites to wear this season. The top features a fun floral print on the top and an empire waist created with a touch of lace. A small frame of pleats is found next to the buttons that run down the center of the shirt. The long sleeves are a thin red stripe. Roll up the sleeves and secure them with strip of fabric and a button. Cotton/Polyester/Rayon Blend. Machine Wash in Cold Water. Hang to Dry. |,|$28.50$|,||,|JAK-PEPPAR-TWEEN-GYSPY-TUNIC-RED|,|$URL$jak-peppar-tween-gyspy-tunic-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-peppar-tween-gyspy-tunic-in-red-preorder-1.jpg||-||Jak & Peppar Tween Jean Vest Dark Wash|,|The Rock N Shop Vest from designer Jak and Peppar is a style that she will love to pair over all of the tunics and dresses from their fall collection. The wash of this tween jean jacket is a medium shade, offering a classic look. The front of the vest is closed with metal snaps. A cute collar is framed with the raw edges of the sleeveless cut off. A touch of ivory lace is found on the front pockets. A pleated ruffle accents the back hemline with shape. Cotton/Spandex. Hand or machine wash in cold water. Tumble dry on low. |,|$49.50$|,||,|JAK-PEPPAR-TWEEN-JEAN-VEST-DARK-WASH|,|$URL$jak-peppar-tween-jean-vest-dark-wash.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-peppar-tween-jean-vest-dark-wash-preorder-1.jpg||-||Jak & Peppar Tween Skinny Jeans Dark Wash|,|Jak and Peppar is a new brand just released this fall of 2014! These dark wash skinny jeans are a staple item that every tween wardrobe should old! The jeans are brilliant quality and are styled in the trendy skinny leg. Slight stretch is allowed by the fabric while there are two pockets on the front and the back. Belt loops wrap around her waist while a zipper and button secure the fit. These jeans will look great with any new top and are perfect for showing off her boots! Cotton/Spandex Blend. Machine Wash in Cold Water. Tumble Dry on Low. |,|$51.75$|,||,|JAK-PEPPAR-TWEEN-SKINNY-JEANS-DARK-WASH|,|$URL$jak-peppar-tween-skinny-jeans-dark-wash.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-peppar-tween-skinny-jeans-dark-wash-preorder-1.jpg||-||Jak & Peppar Tween Skinny Pants in Mustard Corduroy|,|A new design that she will instantly adore, these fabulous mustard pants for tweens was created by Jak & Peppar, a new brand from the creators of Mustard Pie. The pants feature a trendy skinny leg and a bold shade of yellow that is sure to fill the season. Traditional back pockets are offered on these skinnies while the corduroy fabric is a warm texture that compliments the free spirit that fills their collection. Pair these skinnies with boots and any of the new tops for a one of a kind outfit. Cotton/Spandex. Hand or machine wash in cold water. Hang to dry. |,|$49.50$|,||,|JAK-PEPPAR-TWEEN-SKINNY-PANTS-MUSTARD-CORDUROY|,|$URL$jak-peppar-tween-skinny-pants-mustard-corduroy.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-peppar-tween-skinny-pants-in-mustard-corduroy-preorder-1.jpg||-||Jak & Peppar Tween Tunic in Red Jezabel (Size 12 & 16)|,|^|Looking fabulous with her new leggings or favorite jeans, this tunic for tween girls is a creation by the newly released Jak and Peppar line by the creators of Mustard Pie. The top is created in a layered look. The bottom layer offers her striped long sleeves and a comfortable, easy to wear fabric. A large applique sits upon the front and has false beaded straps that reach up to her shoulders. The tie dye fabric that falls beneath the flower is a blend of reds and earthy tones. Cotton/Polyester. ONLY Hand Wash Cold Separately with Mild Detergent or soap, No Bleach, Line Dry.ONE EACH SIZE 12 & 16 ONLY LEFT. ^||,|$48.00$|,||,|JAK-PEPPAR-TWEEN-TUNIC-RED-JEZABEL|,|$URL$jak-peppar-tween-tunic-red-jezabel.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-peppar-tween-tunic-in-red-jezabel-preorder-1.jpg||-||Jak & Peppar Yellow Leggings for Girls|,|In bold mustard yellow, these Jak and Peppar leggings are sure to pull out that rich tone from many of the new arrivals in their debut collection. The fabric has slight stretch and is textured with touches of stitching the is found on the outer side of both legs. Pair these leggings beneath her dresses and tunics and for a complete outfit, don't forget her fall boots! Cotton/Spandex. Hand or machine wash in cold water. Hang to dry. |,|$28.50$|,||,|JAK-PEPPAR-YELLOW-LEGGINGS-GIRLS|,|$URL$jak-peppar-yellow-leggings-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-peppar-yellow-leggings-for-girls-preorder-7.jpg||-||Jak and Peppar Able Jacket for Girls in Navy Bean|,|^|A fantastic statement jacket for this fall, this design is from the popular new brand Jak & Peppar. Truly a unique style, this jacket is mostly blue in color with oatmeal colored stripes. The metal buttons are dressed with red overlapping buttonholes to give it a vintage look. The back of this jacket is sewn with a pleated ruffle starting at the small of her back. The same red as the button loops are accented with the elbow patched sleeves. Cotton blend. Hand or machine wash in cold water. Hang to dry. ALL SOLD OUT 12/9/14. ^||,|$49.50$|,||,|JAK-AND-PEPPAR-ABLE-JACKET-GIRLS-NAVY-BEAN|,|$URL$jak-and-peppar-able-jacket-girls-navy-bean.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-able-jacket-for-girls-in-navy-bean-1.jpg||-||Jak and Peppar Adelle Peasant Top for Girls in Navy (Size 12)|,|^|This classic peasant style top is from new designer Jak & Peppar. A navy printed fabric makes up the majority of this top with pink white and blue accents. The front of the bodice is smocked with green embroidery and a tiny button. It's flowy fit will keep it nice and comfortable this fall. Layer with a vest or jacket and some skinny jeans and she will be good to go! 100% Rayon. Hand or Machine wash in cold water. Hang to dry. ONE SIZE 12 LEFT. ^||,|$36.75$|,||,|JAK-AND-PEPPAR-ADELLE-PEASANT-TOP-GIRLS-BLACK|,|$URL$jak-and-peppar-adelle-peasant-top-girls-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-adelle-peasant-top-for-girls-in-black-22.jpg||-||Jak and Peppar Basic Leggings for Girls in Burnt Red (16)|,|^|A previously sold out style in many other colors, these Jak and Peppar leggings are sure to pull out that rich tone from many of the new arrivals in their debut collection. The fabric has slight stretch and is textured with touches of stitching the is found on the outer side of both legs. Pair these leggings beneath her dresses and tunics and for a complete outfit, don't forget her fall boots! Cotton/Spandex. Hand or machine wash in cold water. Hang to dry. ONE SIZE 16 LEFT.  ^||,|$35.70$|,||,|JAK-AND-PEPPAR-BASIC-LEGGINGS-GIRLS-BURNT-RED|,|$URL$jak-and-peppar-basic-leggings-girls-burnt-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-basic-leggings-for-girls-in-burnt-red-1.jpg||-||Jak and Peppar Burnt Red Head Wrap Stevie|,|A gorgeous accessory, this new head wrap from Jak and Peppar matches perfectly to many of the new arrivals in their debut collection. The headband is a rolled fabric style and boasts of the large braided knot across the front. The coloring is a burnt red tie dye with a good combination of small ivory details. The back of the headband stretches for a custom and comfortable fit. |,|$18.00$|,||,|JAK-AND-PEPPAR-BURNT-RED-HEAD-WRAP-STEVIE|,|$URL$jak-and-peppar-burnt-red-head-wrap-stevie.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-burnt-red-head-wrap-stevie-1.jpg||-||Jak and Peppar Chloe Girls Peasant Top Black|,|An honored part of their debut collection, this new Jak and Peppar top is a classic style. The black fabric is covered with a hippie inspired flower print that introduces small hints of colors found throughout the collection. The slit neckline is closed with two red ties. The peasant style offers a relaxed fit and long sleeves finished with a touch of elastic. 100% Rayon. Hand or Machine wash in cold water. Hang to dry. |,|$36.75$|,||,|JAK-PEPPAR-CHLOE-GIRLS-PEASANT-TOP-BLACK|,|$URL$jak-peppar-chloe-girls-peasant-top-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-chloe-girls-peasant-top-black-preorder-1.jpg||-||Jak and Peppar Farrah Peasant Blouse for Tweens|,|A sweet new design, this tween top from Jak and Peppar is a lovely look for the fall season. The deep red fabric is a rich shade, perfect for the season, while the light weight fabric is comfortable to wear. The bodice of the top is covered with pleats and styled with touches of ivory. Three buttons sit on the front of the top while the fit opens from the empire waist. A ruffle finishes the hemline and long sleeves have a quaint ruffle cuff. 100% Cotton. Hand or machine wash in cold water. Hang to dry. |,|$36.75$|,||,|JAK-PEPPAR-FARRAH-PEASANT-BLOUSE-TWEENS|,|$URL$jak-peppar-farrah-peasant-blouse-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-farrah-peasant-blouse-for-tweens-preorder-1.jpg||-||Jak and Peppar Garden Print Laney Skirt|,| |,|$49.50$|,||,|JAK-PEPPAR-GARDEN-PRINT-LANEY-SKIRT|,|$URL$jak-peppar-garden-print-laney-skirt.html|,|||-||Jak and Peppar Girls Basic Leggings in Navy Bean (14, 16)|,|^|A previously sold out style in many other colors, these Jak and Peppar leggings are sure to pull out that rich tone from many of the new arrivals in their debut collection. The fabric has slight stretch and is textured with touches of stitching the is found on the outer side of both legs. Pair these leggings beneath her dresses and tunics and for a complete outfit, don't forget her fall boots! Cotton/Spandex. Hand or machine wash in cold water. Hang to dry. SIZE 14 & 16 ONLY LEFT. ^||,|$28.50$|,||,|JAK-AND-PEPPAR-GIRLS-BASIC-LEGGINGS-NAVY-BEAN|,|$URL$jak-and-peppar-girls-basic-leggings-navy-bean.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-girls-basic-leggings-in-navy-bean-17.jpg||-||Jak and Peppar Girls Bell Bottom Jeans Patchwork Theory (Size 14 & 16)|,|^|A popular new arrival bring back nostalgic thoughts for mom, these bell bottom pants from Jak and Peppar are in high demand! A Medium wash covers the majority of the jeans. Darling patches down the bell style accent these pants and add a lighter wash to contrast. A large benefit of the comfortable fit is the ease in which they layer with her fabulous fall tunics and jackets. Cotton/Spandex. Hand or machine wash in cold water. Hang to dry. SIZE 14 & 16 LEFT.  ^||,|$51.75$|,||,|JAK-AND-PEPPAR-GIRLS-BELL-BOTTOM-JEANS-PATCHWORK-THEORY|,|$URL$jak-and-peppar-girls-bell-bottom-jeans-patchwork-theory.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-girls-bell-bottom-jeans-patchwork-theory-1.jpg||-||Jak and Peppar Girls Dark Wash Jeans Destroyed Skinnies|,|Jak & Peppar is a new brand just released this fall of 2014! These dark wash skinny jeans are a staple item that every tween wardrobe should hold. The jeans are brilliant quality and are styled in the trendy skinny leg and distressed denim. Slight stretch is allowed by the fabric while there are two pockets on the front and the back. Belt loops wrap around her waist while a zipper and button secure the fit. These jeans will look great with any new top and are perfect for showing off her boots! Cotton/Spandex Blend. Machine Wash in Cold Water. Tumble Dry on Low. |,|$51.75$|,||,|JAK-AND-PEPPAR-GIRLS-DARK-WASH-JEANS-DESTROYED-SKINNIES|,|$URL$jak-and-peppar-girls-dark-wash-jeans-destroyed-skinnies.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-girls-dark-wash-jeans-destroyed-skinnies-1.jpg||-||Jak and Peppar Girls Head Wrap in Vanilla Braided (Size MD 2T-6X)|,|^|A gorgeous accessory, this new head wrap from Jak and Peppar matches perfectly to many of the new arrivals in their debut collection. The headband is a rolled fabric style and boasts of the large braided knot across the front. The coloring is an ivory fabric with a good combination of small earth tone motifs. The back of the headband stretches for a custom and comfortable fit. SIZE MEDIUM 2T-6X ONLY LEFT.  ^||,|$18.00$|,||,|JAK-AND-PEPPAR-GIRLS-HEAD-WRAP-VANILLA-BRAIDED|,|$URL$jak-and-peppar-girls-head-wrap-vanilla-braided.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-girls-head-wrap-in-vanilla-braided-1.jpg||-||Jak and Peppar Girls Hi Low Top in Dazed Red (12)|,|^|Jak & Peppar has created this new designer top to go with the fabulous new creations in the debut collection this fall. The top is covered with a tie dye pattern. The deep red is the perfect fall color while the front boasts of a single scoop pocket. The shirt is finished with a hi-low hemline. 100% Cotton. ONLY Hand Wash Cold Separately with Mild Detergent or soap, No Bleach, Line Dry.SIZE 12 LEFT.  ^||,|$33.00$|,||,|JAK-PEPPAR-GIRLS-HI-LOW-TOP-DAZED-RED|,|$URL$jak-peppar-girls-hi-low-top-dazed-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-girls-hi-low-top-in-dazed-red-preorder-1.jpg||-||Jak and Peppar Girls Jacket in Olive Crochet (8, 14, 16)|,|^|From the brand new designer Jak & Peppar, this tween jean jacket is a must have fall fashion. The ""Crochet Me Love"" Jacket is a simple design with that bohemian feeling that the rest of the collection conveys. The olive color has lace detailing around the neckline, the snap enclosure down the front, and the wrists. The lace pockets give it a nice touch while the inner lining is a fun floral pattern. The floral pattern also shows with matching elbow patches. This neutral green will match anything in this new collection! Cotton/Spandex Blend. Hand or Machine wash on Cold. No Bleach. ^||,|$51.75$|,||,|JAK-AND-PEPPAR-GIRLS-JACKET-OLIVE-CROCHET|,|$URL$jak-and-peppar-girls-jacket-olive-crochet.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-girls-jacket-in-olive-crochet-2.jpg||-||Jak and Peppar Girls Leggings in Olive Janey|,|A lightweight yet warm layering option, these designer leggings come from Jak & Peppar. Made with a gray and olive thermal fabric, they're sure to keep her warm this fall. An elastic waist and slight stretch keep them comfortable on her skin. A dark olive colored lace accents the ankle of these leggings, with brown wooden buttons as a detail. Wear these under any of her skirts or dresses to get the look! Cotton/Spandex. Hand or machine wash in cold water. Hang to dry. |,|$28.50$|,||,|JAK-AND-PEPPAR-GIRLS-LEGGINGS-OLIVE-JANEY|,|$URL$jak-and-peppar-girls-leggings-olive-janey.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-girls-leggings-in-olive-janey-17.jpg||-||Jak and Peppar Girls Skinnies in Medium Wash Peppar Boyfriend|,|Jak & Peppar is the designer of these classic skinny jeans. The medium wash skinny jeans are a staple item that every tween wardrobe should hold. The jeans are brilliant quality and are styled in the wider boyfriend skinny leg and distressed denim. Slight stretch is allowed by the fabric while there are two pockets on the front and the back. Belt loops wrap around her waist while a zipper and button secure the fit. These jeans will look great with any new top and are perfect for showing off her boots! Cotton/Spandex Blend. Machine Wash in Cold Water. Tumble Dry on Low. |,|$51.75$|,||,|JAK-AND-PEPPAR-GIRLS-SKINNIES-MEDIUM-WASH-PEPPAR-BOYFRIEND|,|$URL$jak-and-peppar-girls-skinnies-medium-wash-peppar-boyfriend.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-girls-skinnies-in-medium-wash-peppar-boyfriend-1.jpg||-||Jak and Peppar Girls Skinnies in Olive with Patch|,|A popular new arrival that looks fabulous beneath the tunics and dresses, these skinnies from Jak and Peppar are in high demand! The olive tone is found throughout the introductory collection by Jak & Peppar. Darling patches accent these prep school skinnies and add other earthy shades to match all of the fabulous pieces. A large benefit of the comfortable fit is the ease in which they layer with her fabulous fall boots or beloved flats! Due to the high popularity of this new brand, quantities are limited so be sure to purchase her size before it disappears! Cotton/Spandex. Hand or machine wash in cold water. Hang to dry. |,|$51.75$|,||,|JAK-PEPPAR-GIRLS-SKINNIES-OLIVE-PATCH|,|$URL$jak-peppar-girls-skinnies-olive-patch.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-girls-skinnies-in-olive-with-patch-preorder-1.jpg||-||Jak and Peppar Girls Skinny Corduroys in Red|,|A must have creation, these new tween skinny pants are from the trendy new designer Jak and Peppar. The pants boast of their rich red shade that compliments almost every new top from their fall collection. The corduroy fabric is a popular choice for the season while the skinny leg pairs beautifully with her boots! The skinnies offer her back pockets and a traditional zipper and button to fasten the waistline. Cotton/Spandex. Hand or machine wash in cold water. Hang to dry. |,|$49.50$|,||,|JAK-PEPPAR-GIRLS-SKINNY-CORDUROYS-RED|,|$URL$jak-peppar-girls-skinny-corduroys-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-girls-skinny-corduroys-in-red-preorder-1.jpg||-||Jak and Peppar Girls Tunic in Charcoal Vanilla Faithfully Yours (Size 10)|,|^|This ""Faithfully Yours"" tunic comes from new designer Jak & Peppar in all of it's vintage inspired glory. The light charcoal thermal fabric makes up the majority of this top with long sleeves and a loose, flowing look. The front of the bodice is accented with the vanilla crocheted lace fabric we see throughout the whole collection. The visible hems give it a frayed look while further down the bodice there are more patches of lace as if it was torn apart and put back together. Cotton blend. Hand or machine wash in cold water. Hang to dry. ONE SIZE 10 ONLY LEFT.  ^||,|$36.75$|,||,|JAK-AND-PEPPAR-GIRLS-TUNIC-CHARCOAL-VANILLA-FAITHFULLY-YOURS|,|$URL$jak-and-peppar-girls-tunic-charcoal-vanilla-faithfully-yours.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-girls-tunic-in-charcoal-vanilla-faithfully-yours-22.jpg||-||Jak and Peppar Head Wrap for Girls in Dazed Red (Size MD 2T-6X)|,|^|A gorgeous accessory, this new head wrap from Jak and Peppar matches perfectly to many of the new arrivals in their debut collection. The headband is a rolled fabric style and boasts of the large braided knot across the front. The coloring is a burnt red tie dye with a good combination of ivory fabric. The back of the headband stretches for a custom and comfortable fit. ONE SIZE MD 2T-6X LEFT.  ^||,|$18.00$|,||,|JAK-AND-PEPPAR-HEAD-WRAP-GIRLS-DAZED-RED|,|$URL$jak-and-peppar-head-wrap-girls-dazed-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-head-wrap-for-girls-in-dazed-red-6.jpg||-||Jak and Peppar Hickman Girls Denim Jacket|,|From the brand new designer Jak & Peppar, this tween jean jacket is a must have fall fashion! The Hickman Jacket is a darling design with the free spirit that fills the rest of the collection. The medium wash has slight touches of fading found on the back along with a dream catcher screen print. At the center of the back hemline there is a touch of elastic that gives a flattering shape. The ivory long sleeves are speckled with raw fibers and match perfectly to the cozy hood. The draw strings belonging to the hood are long and dressed with beads at the end. There are two pockets on the front and a row of snaps that close. Cotton/Spandex Blend. Machine Wash in Cold Water. Tumble Dry on Low Heat. |,|$64.50$|,||,|JAK-PEPPAR-HICKMAN-GIRLS-DENIM-JACKET|,|$URL$jak-peppar-hickman-girls-denim-jacket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-hickman-girls-denim-jacket-preorder-1.jpg||-||Jak and Peppar High Low Tunic for Girls Joplin Charcoal|,|A most-loved design from their debut collection, this new trendy top comes from Jak and Peppar and is in high demand! The top has a rich texture from the raw fiber fabric. The gray color is a cool blend with the rustic colors that accompany the unique pattern on the front, while the back is a thin patterned fabric with a hi-lo hem. This sleeveless top is perfect to layer with any of the new jackets from Jak & Peppar. Cotton/Rayon Blend. Machine Wash in Cold Water. Hang to Dry. |,|$36.75$|,||,|JAK-AND-PEPPAR-HIGH-LOW-TUNIC-GIRLS-JOPLIN-CHARCOAL|,|$URL$jak-and-peppar-high-low-tunic-girls-joplin-charcoal.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-high-low-tunic-for-girls-joplin-charcoal-1.jpg||-||Jak and Peppar Hudson Dress for Girls in Dazed Red|,|She is sure to love this new dress from designer Jak & Peppar. The red tie dye dress is created with a lighter fabric making it a comfortable dress to wear year-round. Pair leggings or chic boots beneath this dress for a trendy look. ONLY Hand Wash Cold, Separately with Mild Detergent or soap. No Bleach. Line Dry. |,|$43.50$|,||,|JAK-AND-PEPPAR-HUDSON-DRESS-GIRLS-DAZED-RED|,|$URL$jak-and-peppar-hudson-dress-girls-dazed-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-hudson-dress-for-girls-in-dazed-red-1.jpg||-||Jak and Peppar Ivory Dress for Tweens with Flowers|,|A casual tween dress, this new creation is from the Jak and Peppar brand, a new release from the makers of Mustard Pie. The ivory dress is covered with a fun flower print in rustic shades. The bodice is long sleeve and has a blouson fit. The skirt is cut for a classic shape finished in a straight hem. To complete the look pair the dress with a jean vest and cute boots! 100% Rayon. Hand or machine wash in cold water. Hang to dry. |,|$43.50$|,||,|JAK-PEPPAR-IVORY-DRESS-TWEENS-FLOWERS|,|$URL$jak-peppar-ivory-dress-tweens-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-ivory-dress-for-tweens-with-flowers-preorder-1.jpg||-||Jak and Peppar Ivory Ophelia Blouse for Tweens|,|Jak & Peppar is a new line from the creators of Mustard Pie. This new tween top comes from their debut collection. The top boasts of an illusion neckline in a sheer dot print and a layer of crochet lace with long sleeves beneath. The casual fit of this top is comfortable for all day wear. Another accent of lace is found dancing at the hemline. Rayon/Cotton Blend. Machine Wash in Cold Water. Hang to Dry. |,|$36.75$|,||,|JAK-PEPPAR-IVORY-OPHELIA-BLOUSE-TWEENS|,|$URL$jak-peppar-ivory-ophelia-blouse-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-ivory-ophelia-blouse-for-tweens-1.jpg||-||Jak and Peppar Janey Leggings for Girls in Charcoal (Size 10)|,|^|A lightweight yet warm layering option, these designer leggings come from Jak & Peppar. Made with a light gray thermal fabric, they're sure to keep her warm this fall. An elastic waist and slight stretch keep them comfortable on her skin. An oatmeal colored lace accents the ankle of these leggings, with brown wooden buttons as a detail. Wear these under any of her skirts or dresses to get the look! Cotton/Spandex. Hand or machine wash in cold water. Hang to dry. ONE SIZE 10 ONLY LEFT.  ^||,|$28.50$|,||,|JAK-AND-PEPPAR-JANEY-LEGGINGS-GIRLS-CHARCOAL|,|$URL$jak-and-peppar-janey-leggings-girls-charcoal.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-janey-leggings-for-girls-in-charcoal-17.jpg||-||Jak and Peppar Joan of Arc Peplum in Charcoal (10)|,|^|Certainly a beautiful look, this new tween tunic from Jak and Peppar is created in earthy hues and is the perfect every day look. The body of the tunic is a thin charcoal stripe that is alternated with ivory and finished with a raw edge. Soft ivory crochet lace creates comfortable sheer sleeves to match the darling peplum skirt. Cotton/Polyester. Hand or machine wash in cold water. Hang to dry. (1) SIZE 10 ONLY REMAINING. ^||,|$49.00$|,||,|JAK-PEPPAR-JOAN-OF-ARC-PEPLUM-CHARCOAL|,|$URL$jak-peppar-joan-of-arc-peplum-charcoal.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-joan-of-arc-peplum-in-charcoal-preorder-10.jpg||-||Jak and Peppar Leggings for Girls in Vanilla Janey (16)|,|^|A lightweight yet warm layering option, these designer leggings come from Jak & Peppar. Made with a vanilla thermal fabric, they're sure to keep her warm this fall. An elastic waist and slight stretch keep them comfortable on her skin. An oatmeal colored lace accents the ankle of these leggings, with brown wooden buttons as a detail. Wear these under any of her skirts or dresses to get the look! Cotton/Spandex. Hand or machine wash in cold water. Hang to dry. ONE SIZE 16 LEFT.  ^||,|$28.50$|,||,|JAK-AND-PEPPAR-LEGGINGS-GIRLS-VANILLA-JANEY|,|$URL$jak-and-peppar-leggings-girls-vanilla-janey.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-leggings-for-girls-in-vanilla-janey-17.jpg||-||Jak and Peppar Maxi Skirt for Girls in Vanilla Woodstock|,|^|Jak & Peppar brings you this beautiful retro inspired maxi skirt. The vanilla crocheted lace fabric is slightly sheer with it's open knit look, while a lining covers underneath to the knee. Three tiers of lace give it a pieced together look with exposed seams. The thick smocked waist makes it nice and comfortable. Pair with a peasant or peplum top to get this vintage look. Cotton/Polyester. Hand or machine wash in cold water. Hang to dry. ALL SOLD OUT 12/14/14. ^||,|$44.25$|,||,|JAK-AND-PEPPAR-MAXI-SKIRT-GIRLS-VANILLA-WOODSTOCK|,|$URL$jak-and-peppar-maxi-skirt-girls-vanilla-woodstock.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-maxi-skirt-for-girls-in-vanilla-woodstock-1.jpg||-||Jak and Peppar Navy Head Wrap for Tweens Gertrude|,|An accessory designed to go with many of the new arrivals, this headband is from designer Jak & Peppar. The navy blue headband features a tie-dyed print with a touch ivory. A small twist styles the front. The headband stretches with a bit of elastic that is found at the back. ONLY Hand Wash Cold Separately with Mild Detergent or soap, No Bleach, Line Dry. |,|$18.00$|,||,|JAK-AND-PEPPAR-NAVY-HEAD-WRAP-TWEENS-GERTRUDE|,|$URL$jak-and-peppar-navy-head-wrap-tweens-gertrude.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-navy-head-wrap-for-tweens-gertrude-1.jpg||-||Jak and Peppar Peasant Top for Girls in Vanilla (Size 14)|,|^|Part of their debut collection this fall, this new Jak & Peppar top for tweens is a piece she will surely love all fall and winter long. The vanilla fabric boasts of its relaxed fit, light weight, and crepe texture. The neckline is dressed with a embroidered pattern that is also found on the skirt of this tunic. The long sleeves have a peasant bell shape. The cut of this style is perfectly complimented by her skinny pants. 100% Cotton. Machine Wash in Cold Water. Hang to Dry. (1) SIZE 14 LEFT. ^||,|$36.75$|,||,|JAK-PEPPAR-PEASANT-TOP-GIRLS-VANILLA|,|$URL$jak-peppar-peasant-top-girls-vanilla.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-peasant-top-for-girls-in-vanilla-preorder-1.jpg||-||Jak and Peppar Railroad Skirt for Girls in Red Gertie|,|A retro inspired style that all of her friends will envy, this skirt is from new designer Jak & Peppar. A thick elastic waistband is the accenting piece of this skirt, while the 4 metal buttons and crocheted lace notions taking center stage. The red railroad striped fabric is a classic style, holding it's shape with it's thicker weight. Earth toned fabric wraps around the back of the waistband. Pair with any of the peasant tops to complete the look. Cotton blend. Hand or machine wash in cold water. Hang to dry. |,|$40.50$|,||,|JAK-AND-PEPPAR-RAILROAD-SKIRT-GIRLS-RED-GERTIE|,|$URL$jak-and-peppar-railroad-skirt-girls-red-gertie.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-railroad-skirt-for-girls-in-red-gertie-22.jpg||-||Jak and Peppar Red Headband for Tweens Gertrude|,|Matching all of the new arrivals in their debut collection, this tween hair accessory comes from Jak & Peppar. The headband is a red tie dye coloring. A small twisted loop is found at the front of the headband for an understated style that compliments her outfit without stealing the show. A touch of elastic on the back is used to provide the stretch fit! |,|$18.00$|,||,|JAK-PEPPAR-RED-HEADBAND-TWEENS-GERTRUDE|,|$URL$jak-peppar-red-headband-tweens-gertrude.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-red-headband-for-tweens-gertrude-preorder-1.jpg||-||Jak and Peppar Rock on Raglan Girls Top with Peace Sign (Size 16)|,|^|A sister style to the Faithfully Yours tunic, this ""Rock On"" raglan top is a little bohemian's dream. Made of mostly charcoal and oatmeal colored thermal fabric, this will be a nice layering piece for the cooler months. A large lace peace sign applique is the star of this top. Pair it with any of the items in this new collection and she will be set for fall! Cotton blend. Hand or machine wash in cold water. Hang to dry.(1) 16 LEFT. ^||,|$33.00$|,||,|JAK-AND-PEPPAR-ROCK-RAGLAN-GIRLS-TOP-PEACE-SIGN|,|$URL$jak-and-peppar-rock-raglan-girls-top-peace-sign.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-rock-on-raglan-girls-top-with-peace-sign-1.jpg||-||Jak and Peppar Skinny Jeans for Girls in Dazed Pep School (Size 8)|,|^|These retro chic skinny jeans are a must have this season from designer Jak & Peppar. These acid wash skinny jeans are brilliant quality and are styled in the trendy skinny leg and dark dyed accent stripes. Slight stretch is allowed by the fabric while there are two pockets on the front and the back. Belt loops wrap around her waist while a zipper and button secure the fit. These jeans will look great with any new top and are perfect for showing off her boots! Cotton/Spandex Blend. Machine Wash in Cold Water. Tumble Dry on Low. ONE SIZE 8 ONLY LEFT. ^||,|$51.75$|,||,|JAK-AND-PEPPAR-SKINNY-JEANS-GIRLS-DAZED-PEP-SCHOOL|,|$URL$jak-and-peppar-skinny-jeans-girls-dazed-pep-school.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-skinny-jeans-for-girls-in-dazed-pep-school-1.jpg||-||Jak and Peppar Skirt for Tweens in Vanilla Burlap Laney (8)|,|^|A truly transitional piece, this skirt comes from designer Jak & Peppar. A thick rouched waistline makes this skirt as comfortable as can be, while the flowing fabric gives it lots of movement. The cognac colored fabric is accented with ivory crocheted lace details, while underneath is a layer of a detailed feather shaped fabric. As pictured, this skirt can be layered over one of her favorite henleys as a top too!ONE SIZE 8 ONLY LEFT. ^||,|$49.50$|,||,|JAK-AND-PEPPAR-SKIRT-TWEENS-VANILLA-BURLAP-LANEY|,|$URL$jak-and-peppar-skirt-tweens-vanilla-burlap-laney.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-skirt-for-tweens-in-vanilla-burlap-laney-1.jpg||-||Jak and Peppar Tween Dress Long Sleeve Tie Dye (Size 6, 8 & 16)|,|^|A look she will love all season long, this new dress is from designer Jak and Peppar. The dress is created with a light weight fabric that boasts of its crepe pattern. The dress is covered with navy blue tie dye effect. Her waist has a smocked fit while long sleeves are perfect for the season. Pair adorable leggings or boots beneath this dress for a look her friends will envy. ONLY Hand Wash Cold Separately with Mild Detergent or soap, No Bleach, Line Dry.SIZE 6, 8, & 16 LEFT. ^||,|$43.50$|,||,|JAK-PEPPAR-TWEEN-DRESS-LONG-SLEEVE-TIE-DYE|,|$URL$jak-peppar-tween-dress-long-sleeve-tie-dye.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-tween-dress-long-sleeve-tie-dye-preorder-1.jpg||-||Jak and Peppar Tween Hair Accessory Gertrude Black|,|Created with the same fabric found in other pieces of the collection, this new hair accessory is a part of the fall and winter collection from Jak and Peppar. The headband is styled with a looped twist found in the front while a touch of elastic offers easy stretch. The black fabric is covered with a floral print in natural tones. |,|$18.00$|,||,|JAK-PEPPAR-TWEEN-HAIR-ACCESSORY-GERTRUDE-BLACK|,|$URL$jak-peppar-tween-hair-accessory-gertrude-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-tween-hair-accessory-gertrude-black-preorder-1.jpg||-||Jak and Peppar Tween Skirt in Josefina Black (Size 12, 14 & 16)|,|A beautifully flowing skirt with lots of movement, this Jak & Peppar design is from their debut collection. A dark black lightweight fabric with mostly green and red motif prints make up the skirt. An elastic waistband makes it nice and comfortable, while the hanky hem keeps her on trend. Pair with some leggings and boots to complete the look. 100% Rayon. Hand or Machine wash on cold. No bleach. |,|$36.75$|,||,|JAK-AND-PEPPAR-TWEEN-SKIRT-JOSEFINA-BLACK|,|$URL$jak-and-peppar-tween-skirt-josefina-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-tween-skirt-in-josefina-black-1.jpg||-||Jak and Peppar Tween Top in Burnt Red Giselle Peplum (Size 8 & 16)|,|^|A look she will love all season long, this new top is from designer Jak & Peppar. The top is created with a light weight fabric that boasts of its crepe pattern. The dress is covered with a burnt red tie dye effect. Her waist has a smocked peplum fit while long sleeves are perfect for the season. Pair adorable leggings or jeans beneath this top for a look her friends will envy. ONLY Hand Wash Cold Separately with Mild Detergent or soap, No Bleach, Line Dry. SIZE 8 & 16 ONLY LEFT.  ^||,|$29.25$|,||,|JAK-AND-PEPPAR-TWEEN-TOP-BURNT-RED-GISELLE-PEPLUM|,|$URL$jak-and-peppar-tween-top-burnt-red-giselle-peplum.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-tween-top-in-burnt-red-giselle-peplum-1.jpg||-||Jak and Peppar Tween Vest in Navy Bean Railroad|,|^|This button down ""Fray for You"" vest comes from new designer Jak & Peppar. With a somewhat boyish style, this collared vest is a great layering piece. Mostly olive in color, this vest has a navy railroad striped fabric bib on the bodice. The sleeveless style has frayed edges to give it that cut off sleeve look. Cotton/Spandex Blend. Machine Wash in Cold Water. Tumble Dry in Low Heat. ^||,|$36.75$|,||,|JAK-AND-PEPPAR-TWEEN-VEST-NAVY-BEAN-RAILROAD|,|$URL$jak-and-peppar-tween-vest-navy-bean-railroad.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-tween-vest-in-navy-bean-railroad-1.jpg||-||Jak and Peppar Woodstock Girls Maxi Skirt in Red (Size 16)|,|^|Jak & Peppar brings you this beautiful retro inspired maxi skirt. The burnt red crocheted lace fabric is slightly sheer with it's open knit look, while a lining covers underneath to the knee. Three tiers of lace give it a pieced together look with exposed seams. The thick smocked waist makes it nice and comfortable. Pair with a peasant or peplum top to get this vintage look. Cotton/Polyester. Hand or machine wash in cold water. Hang to dry. ONE SIZE 16 ONLY LEFT. ^||,|$44.25$|,||,|JAK-AND-PEPPAR-WOODSTOCK-GIRLS-MAXI-SKIRT-RED|,|$URL$jak-and-peppar-woodstock-girls-maxi-skirt-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-woodstock-girls-maxi-skirt-in-red-1.jpg||-||Jefferies Socks Girls Black Tights with Sparkling Gems|,|With a small touch of sparkle, these new black girls tights from Jefferies Socks will pair beautifully with any outfit. The pantyhose boasts of a stretch fit and small diamond like gems scattered about. Made with a stretch nylon blend, machine washable. |,|$9.00$|,||,|JEFFERIES-SOCKS-GIRLS-BLACK-TIGHTS-GEMS|,|$URL$jefferies-socks-girls-black-tights-gems.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jefferies-socks-girls-black-tights-with-sparkling-gems-13.jpg||-||Jefferies Socks Girls Ivory Tights with Sparkling Gems|,|Designer Jefferies Socks is now offering this creamy ivory tights for girls. The pantyhose boast of the traditional stretch fit while sparkling diamond like gems are sporadically placed about to add just a touch of shine. The perfect finish for her new dress! Stretch nylon blend; Machine wash gentle. |,|$9.00$|,||,|JEFFERIES-SOCKS-GIRLS-IVORY-TIGHTS-SPARKLING-GEMS|,|$URL$jefferies-socks-girls-ivory-tights-sparkling-gems.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jefferies-socks-girls-ivory-tights-with-sparkling-gems-12.jpg||-||Jefferies Socks Girls White Tights with Sparkling Gems|,|^|Delightful and gorgeous, these new girls tights from designer Jefferies Socks will cap off her new outfit beautifully! The tights boast of a classic stretch fit and are covered with small diamond like gems. Machine washable, stretch nylon blend. SIZE 8-10 ONLY LEFT.  ^||,|$9.00$|,||,|JEFFERIES-SOCKS-GIRLS-WHITE-TIGHTS-SPARKLING-GEMS|,|$URL$jefferies-socks-girls-white-tights-sparkling-gems.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jefferies-socks-girls-white-tights-with-sparkling-gems-13.jpg||-||Jefferies Socks Infant and Toddler White Tights|,|^|Made in the USA by Jefferies socks, these little girls tights come in infant and toddler sizes. The nylon and and spandex blend provide the classic fit and look. Traditionally paired with holiday and birthday dresses and adorable patent leather shoes. Machine washable. SIZE 6-18 MOS ONLY LEFT.  ^||,|$7.00$|,||,|JEFFERIES-SOCKS-INFANT-TODDLER-WHITE-TIGHTS|,|$URL$jefferies-socks-infant-toddler-white-tights.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jefferies-socks-infant-and-toddler-white-tights-11.jpg||-||Jefferies Socks Ivory Infant and Tights|,|New from Jefferies Socks, these ivory tights are the perfect small touch for any special occasion. Pairs beautifully with dress and patent leather shoes, these tights are made in the USA from nylon and lycra. Machine washable, tumble dry. |,|$7.00$|,||,|JEFFERIES-SOCKS-IVORY-INFANT-TODDLER-TIGHTS|,|$URL$jefferies-socks-ivory-infant-toddler-tights.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jefferies-socks-ivory-infant-and-toddler-tights-13.jpg||-||Joyfolie Brown Suede Boot for Girls|,|Darling new girls boots, this fancy style is from designer Joyfolie. The light brown suede is soft to the touch and is sure to coordinate with many pieces in her fall wardrobe. These boots are styled with a rounded toe and a small heel. A light pink ribbon laces up the top of the front and ties into a large bow. A zipper is found on the inner side of both boots for an easy fit! |,|$92.00$|,||,|JOYFOLIE-BROWN-SUEDE-BOOT-GIRLS|,|$URL$joyfolie-brown-suede-boot-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-brown-suede-boot-for-girls-1.jpg||-||Joyfolie Cabria Boots in Charcoal Gray|,|Arriving just in time for the cooler months are these beautiful boots from Joyfolie. These sophisticated boots feature silver and leather cap toe with a asymmetrical bow. The body of the boot is durable charcoal gray micro suede with a wood wrapped heel.They zip up the back for ease of use. A matching hair clip accompanies each pair. |,|$98.00$|,||,|JOYFOLIE-CABRIA-BOOTS-CHARCOAL-GRAY|,|$URL$joyfolie-cabria-boots-charcoal-gray.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-cabria-boots-in-charcoal-gray-1.jpg||-||Joyfolie Designer Girls Ruffle Jacket Spencer ( 3, 5 & 6 )|,|^|An adorable new piece of clothing, this girls jacket comes from fabulous designer Joyfolie. The jacket is a light ivory with visible raw fibers in the fabric. A few pin tucks create a fitted shape on the front while a row of sparkling buttons lines the front. A ruffle falls from the neckline and runs around the hemline. This jacket is sure to look fabulous with her Joyfolie shoes! Polyester/Cotton/Spandex Blend. Machine Wash in Cold Water. Hang to Dry. SIZE 3 AND 5 ONLY LEFT. ^||,|$68.00$|,||,|JOYFOLIE-DESIGNER-GIRLS-RUFFLE-JACKET-SPENCER|,|$URL$joyfolie-designer-girls-ruffle-jacket-spencer.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-designer-girls-ruffle-jacket-spencer-6.jpg||-||Joyfolie Girls Glitter Shoes Midnight Blue|,|Joyfolie is now offering these sweet special occasion shoes for girls. Created in their Maya style, the shoes boast of an ankle t-strap in the same glittering midnight blue that creates the body. A small grouping of flowers sits upon the toe of the shoe. The rubber outer sole offers a great grip. The flat, rounded toe look of this shoe makes it easy to pair with any fancy girls dress! |,|$66.00$|,||,|JOYFOLIE-GIRLS-GLITTER-SHOES-MIDNIGHT-BLUE|,|$URL$joyfolie-girls-glitter-shoes-midnight-blue.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-girls-glitter-shoes-midnight-blue-1.jpg||-||Joyfolie Girls Loafer Flats Rosie in Sequins ( 6 & 8 )|,|^|A dressy take on the comfortable Rosie loafer, these little girl shoes come from Joyfolie. The shoes boast of a ribbed fabric lining the inner sole and also lines the top of the shoe. The loafer is covered with rose gold sequins. Set off to the side of both toes we find a pink chiffon flower complete with green felt leaves. Use these shoes to bring an elegant sparkle to her every day outfits! A peach hair flower comes with the pair making accessorizing a breeze! SIZE 6 AND 8 REMAINING. ^||,|$49.99$|,||,|JOYFOLIE-GIRLS-LOAFER-FLATS-ROSIE-SEQUINS|,|$URL$joyfolie-girls-loafer-flats-rosie-sequins.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-girls-loafer-flats-rosie-in-sequins-1.jpg||-||Joyfolie Glitter Flats for Girls in Pink Londyn|,|New from Joyfolie, these beautiful flats are sure to add that special touch to any of her spring and summer outfits! The cotton candy pink is covered with iridescent glitter that catches every bit of light that comes its way. The t-strap is attached to a velcro ankle strap for a secure fit. A beaded burst of gold is found placed upon the tow of the shoe. A matching pink glitter hair bow accompanies each pair. A subtle heel is found on the rubber sole. |,|$49.99$|,||,|JOYFOLIE-GLITTER-FLATS-GIRLS-PINK-LONDYN|,|$URL$joyfolie-glitter-flats-girls-pink-londyn.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-glitter-flats-for-girls-in-pink-londyn-1.jpg||-||Joyfolie Glitter Sandals for Girls in Naomi Black|,|A dressy shoe perfect for your daughter, this new arrival comes from Joyfolie. The sandal is finished with a peep toe while the dressed with a elegant double bow. A Velcro strap secures around her ankle and is accented with two studs. The t-strap runs along the top of her foot. The black shoe is covered with glitter and catches the light. |,|$52.99$|,||,|JOYFOLIE-GLITTER-SANDALS-GIRLS-NAOMI-BLACK|,|$URL$joyfolie-glitter-sandals-girls-naomi-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-glitter-sandals-for-girls-in-naomi-black-12.jpg||-||Joyfolie Gold Lilly Peep Toe Girls Flats|,|A shoe she will adore wearing, this new girls flat from Joyfolie is filled with an understated elegance. The faux leather is a rich shimmer champagne that has a gorgeous gleam. The peep toes are accented with a layered circle bloom and two felt leaves. The center of the flowers are accented with a trio of beads. These shoes are accompanied by a matching clip. They are the perfect choice to accent her every day wardrobe or match her special occasion dresses. |,|$60.00$|,||,|JOYFOLIE-GOLD-LILLY-PEEP-TOE-GIRLS-FLATS|,|$URL$joyfolie-gold-lilly-peep-toe-girls-flats.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-gold-lilly-peep-toe-girls-flats-1.jpg||-||Joyfolie Josefine Dress for Girls in Blush|,|A gorgeous addition to their holiday collection, this beautiful dress comes from Joyfolie. This dress features beautifully textured lace in a subdued shade of blush pink. Underneath peeks out a full skirt in matching blush tulle. The bodice is a fitted style with a zipper up the back. 100% Cotton. Wash and line dry inside out. Hand wash only. |,|$68.00$|,||,|JOYFOLIE-JOSEPHINE-DRESS-GIRLS-BLUSH|,|$URL$joyfolie-josephine-dress-girls-blush.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-josefine-dress-for-girls-in-blush-1.jpg||-||Joyfolie Josefine Dress for Girls in Red (3, 7 & 8)|,|A gorgeous addition to their holiday collection, this beautiful dress comes from Joyfolie. This dress features beautifully textured lace in a vibrant shade of red. Underneath peeks out a full skirt in tan tulle. The bodice is a fitted style with a zipper up the back. 100% Cotton. Wash and line dry inside out. Hand wash only. |,|$68.00$|,||,|JOYFOLIE-JOSEPHINE-DRESS-GIRLS-RED|,|$URL$joyfolie-josephine-dress-girls-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-josefine-dress-for-girls-in-red-1.jpg||-||Joyfolie Lacey Boot for Girls in Rose|,|New from Joyfolie, these girls boots are a sweet design to compliment her boutique dresses and outfits. The boats are a soft ivory rose and boast of the lacey, floral overlay. The rounded toe is a classic look while a slight heel is added. The front of the top of this boat is laced with a wide dusty rose ribbon that is finished into a bow! |,|$92.00$|,||,|JOYFOLIE-LACEY-BOOT-GIRLS-ROSE|,|$URL$joyfolie-lacey-boot-girls-rose.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-lacey-boot-for-girls-in-rose-1.jpg||-||Joyfolie Lilac Isabell Wedge|,|A sweet shade sure to be a gorgeous compliment to her spring and summer dresses, these new little girls shoes are from the famous Joyfolie brand. The light mauve lilac stands apart from other shoes while the light produces an elegant sheen. The toe of the shoe is dressed with a chiffon and tulle flower. A single thin strap wraps around her ankles secured by a classic buckle. The wedge heel is wrapped in bright silver glitter. The bottom sole is a lined rubber for grip while the inside sole is a comfortable neutral fabric. Each pair is accompanied by a sweet hair bow clip. |,|$49.99$|,||,|JOYFOLIE-LILAC-ISABELL-WEDGE|,|$URL$joyfolie-lilac-isabell-wedge.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-lilac-isabell-wedge-1.jpg||-||Joyfolie Little Girls Flats Isis Blue Shoes ( 4 & 11 )|,|^|Don't you step on her blue suede shoes! She is sure to treasure these new Joyfolie flats. The sky blue suede is soft and glamorous, perfect for your tiffany princess. A t-strap runs up the top of her foot to attach to the velcro ankle strap. The toe of the foot is decorated with a structured bow complete with two angled tails. The bow is covered in beautiful blue sequins. The rubber sole has a slight heel. These shoes are accompanied by a matching blue glitter hair bow. ONE EACH SIZE 4 AND 11.  ^||,|$49.99$|,||,|JOYFOLIE-LITTLE-GIRLS-FLATS-ISIS-BLUE|,|$URL$joyfolie-little-girls-flats-isis-blue.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-little-girls-flats-isis-blue-shoes-1.jpg||-||Joyfolie Little Girls Holiday Shoes Red Revaline (Size 2)|,|^|A darling creation, this new dress shoe for girls comes from the fabulous Joyfolie. The holiday red covers the entire shoe while a single ankle strap is secured around her waist. The strap is accented with a buckle and fastened with easy to use Velcro. The shoe is finished with a peep to that is adorned by a large, hand turned rosette. The shoe is lined in gold and offers a rubber outer sole. SIZE 2 ONLY LEFT.  ^||,|$49.99$|,||,|JOYFOLIE-LITLE-GIRLS-HOLIDAY-SHOES-RED-REVALINE|,|$URL$joyfolie-litle-girls-holiday-shoes-red-revaline.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-litle-girls-holiday-shoes-red-revaline-17.jpg||-||Joyfolie Little Girls Lime Lyric Shoe (Size 10)|,|^|Truly unique, this new pair of shoes from Joyfolie are sure to be sweet as a melody. The closed toe t-strap features a Velcro strap around her ankle and a vibrant orange flower that sits atop her foot. The lime printed canvas is coated for its protection and the bottom sole is made with rubber. (1) SIZE 10 AVAILABLE. ^||,|$39.00$|,||,|JOYFOLIE-LITTLE-GIRLS-LIME-LYRIC-SHOE|,|$URL$joyfolie-little-girls-lime-lyric-shoe.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-little-girls-lime-lyric-shoe-13.jpg||-||Joyfolie Mika Wedge for Girls in Polka Dot Olive|,|An adorable new arrival from designer Joyfolie, these little girl wedges are the perfect choice to coordinate with her fun summer outfits. The olive shoe is covered in white polka dots and boasts of a spiral ankle strap that is secured with Velcro. The tow of both feet is dressed with a purple bloom complete with felt leaves. The wedge of the shoe is cork while the rubber outer sole grips with her steps. The shoes come with a matching hair accessory. |,|$49.99$|,||,|JOYFOLIE-MIKA-WEDGE-GIRLS-POLKA-DOT-OLIVE|,|$URL$joyfolie-mika-wedge-girls-polka-dot-olive.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-mika-wedge-for-girls-in-polka-dot-olive-17.jpg||-||Joyfolie Miriam Shoes in Glitter Fuchsia (4, 6 & 12)|,|Perfect for any young girl who loves pink and glitter, these new mary jane flats are a true prize from Joyfolie. The rich fuchsia glitter wraps completely around the shoe. The ankle strap is secured with a classic buckle. The inside is lined with a ribbed fabric in mint. The toe of the show is dressed with a double bow. A sweet chiffon flower clip accompanies the pair. |,|$49.99$|,||,|JOYFOLIE-MIRIAM-TODDLER-SHOES-GLITTER-FUCHSIA|,|$URL$joyfolie-miriam-toddler-shoes-glitter-fuchsia.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-miriam-toddler-shoes-in-glitter-fuchsia-1.jpg||-||Joyfolie Red Holiday Shoes for Girls in Naomi|,|In bold holiday red, these new Naomi girls shoes have arrived from designer Joyfolie. Joyfolie is an inspiring brand that fills their designs with love and dreams. This adorable shoe features a t-strap that velcros around her ankle and is adorned with two rounded studs. The peep toe is finished with a lux double bow. The glitter finish of the shoe compliments her new holiday dress with ease! |,|$52.99$|,||,|JOYFOLIE-RED-HOLIDAY-SHOES-GIRLS-NAOMI|,|$URL$joyfolie-red-holiday-shoes-girls-naomi.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-red-holiday-shoes-for-girls-in-naomi-1.jpg||-||Joyfolie Sasha Girls Boots in Brown|,|New for the fall season, these Joyfolie boots for girls are sure to be instantly adored! The brown boots are created with eco friendly vegan leather. A touch of gathers are found just above the top of her foot and a large bow sits just beneath. The rounded toe is a truly adorable look! These boots are lined and secured with a zipper that is found on the inner side of both boots. |,|$112.00$|,||,|JOYFOLIE-SASHA-GIRLS-BOOTS-BROWN|,|$URL$joyfolie-sasha-girls-boots-brown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-sasha-girls-boots-in-brown-1.jpg||-||Joyfolie Silver Naomi Girls Fancy Shoe|,|^|Glittering their way to the top, the fabulous ""Naomi"" style by Joyfolie is sure to be a big hit for the holiday season. These silver shoes are covered in glitter and feature a t strap that is secured by Velcro around her ankle. The toe of this sandal is covered with a double bow while styled in the peep toe look. This shoe is available in other colors while supplies last! ^||,|$52.99$|,||,|JOYFOLIE-SILVER-NAOMI-GIRLS-FANCY-SHOE|,|$URL$joyfolie-silver-naomi-girls-fancy-shoe.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-silver-naomi-girls-fancy-shoe-1.jpg||-||Joyfolie Sloan Grey Girls Designer Fall Boots|,|A truly inspired design, the Joyfolie Sloan boots are a beautiful creation from their new collection. The light grey suede is accented with touches of deep fading found both at her heel and her toe. With an army inspiration we find rows of accents lining up the front of the boot complete with large metal studs. Pull up the side zipper and she's ready to go! These boots make any outfit even more fabulous than before! |,|$102.00$|,||,|JOYFOLIE-SLOAN-GREY-GIRLS-DESIGNER-FALL-BOOTS|,|$URL$joyfolie-sloan-grey-girls-designer-fall-boots.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-sloan-grey-girls-designer-fall-boots-1.jpg||-||Joyfolie Valeria Ballet Fancy in Blush|,|New from Joyfolie, these beautiful flats are sure to add that special touch to any of her special occasion outfits. The blush pink is a shiny satin that catches the light with every step. The ankle strap strap is attached to the back for a secure fit. A glitter burst of gold is found placed upon the large bow on the front by the peep toe. A matching hair bow accompanies each pair. |,|$68.00$|,||,|JOYFOLIE-VALERIA-BALLET-FLATS-BLUSH|,|$URL$joyfolie-valeria-ballet-flats-blush.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-valeria-ballet-fancy-in-blush-1.jpg||-||Joyfolie Valeria Ballet Fancy in Red|,|New from Joyfolie, these beautiful flats are sure to add that special touch to any of her special occasion outfits. The true red coloring is a shiny satin that catches the light with every step. The ankle strap strap is attached to the back for a secure fit. A glitter burst of gold is found placed upon the large bow on the front by the peep toe. A matching hair bow accompanies each pair. |,|$68.00$|,||,|JOYFOLIE-VALERIA-BALLET-FLATS-RED|,|$URL$joyfolie-valeria-ballet-flats-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-valeria-ballet-fancy-in-red-1.jpg||-||Kamara Black Leather Ballet Slippers with Flower|,|^|With a velvet and rhinestone flower on the toe, these girls handmade black ballet slippers are so elegant! Perfect for her holiday outfit, adjustable drawstring, elastic instep, ribbon to tie. Ballet slipper sizes range from infant size 4 to girls size 4. These shoes run small, please order up TWO sizes. ^||,|$38.00$|,||,|KAMARA-BLACK-BALLET-SLIPPERS|,|http://www.labellaflorachildrensboutique.com/kamara-black-ballet-slippers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kamara-black-leather-ballet-slippers-with-flower-13.jpg||-||Kamara Girls Gold Ballet Slippers with Rosette|,|^|Ivory Satin rosettes trimmed in gold adorn the toe of these handmade gold leather ballet slippers from Kamara. Adjustable drawstring, elastic instep and a matching satin ribbon to tie. How adorable! Ballet slipper sizes range from infant size 4 to girls size 4. These shoes run small, please order up TWO sizes. ^||,|$38.00$|,||,|KAMARA-GILS-GOLD-BALLET-SLIPPERS-ROSETTE|,|$URL$kamara-gils-gold-ballet-slippers-rosette.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kamara-girls-gold-ballet-slippers-with-rosette-13.jpg||-||Kamara Girls Silver Ballet Slippers|,|^|Large floral accents make these handmade leather girls ballet slippers sparkle. In silver leather, with an adjustable drawstring, ribbon tie, and elastic instep strap. Ballet slipper sizes range from infant size 4 to girls size 4. These shoes run small, please order up TWO sizes. ^||,|$38.00$|,||,|KAMARA-GIRLS-SILVER-BALLET-SLIPPERS|,|http://www.labellaflorachildrensboutique.com/kamara-girls-silver-ballet-slippers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kamara-girls-silver-ballet-slippers-13.jpg||-||Kamara Gold Girls Leather Ballet Slippers (Size 6 & 8; Runs Very Small)|,|^|Beaded butterflies adorn the toes on these handmade golden leather ballet slippers by Kamara. Adjustable drawstring, elastic instep, and ribbon to tie. So elegant! These shoes run small, please order up TWO sizes. (1) SIZE 6 AND SIZE 8 LEFT.  ^||,|$29.00$|,||,|KAMARA-GOLD-BALLET-SLIPPERS|,|http://www.labellaflorachildrensboutique.com/kamara-gold-ballet-slippers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kamara-gold-girls-leather-ballet-slippers-13.jpg||-||Kamara Leather Ivory Ballet Slippers|,|^|This ivory leather ballet slipper with ivory satin rosette coordinates beautifully with many of her special dresses. The finishing touch! Ballet slipper sizes range from infant size 4 to girls size 4. These shoes run small, please order up TWO sizes. ^||,|$38.00$|,||,|KAMARA-IVORY-LEATHER-BALLET-SLIPPERS|,|$URL$kamara-ivory-leather-ballet-slippers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kamara-leather-ivory-ballet-slippers-12.jpg||-||Kamara Pink Floral Accent Ballerina Slippers|,|^|Handmade of pretty pink leather, these girls ballet slippers by Kamara are so cute. Adjustable drawstring, ribbon tie, floral accent, elastic inset strap. Ballet slipper sizes range from infant size 4 to girls size 4. These shoes run small, please order up TWO sizes. ^||,|$38.00$|,||,|KAMARA-PINK-BALLET-SLIPPERS|,|http://www.labellaflorachildrensboutique.com/kamara-pink-ballet-slippers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kamara-pink-floral-accent-ballerina-slippers-13.jpg||-||Kamara Red Girls Leather Ballet Slippers|,|^|Handmade of leather, these girls ballet slippers have a ribbon rosette on the toe, and elastic strap on the instep and ribbon ties. Match her Christmas outfit with these red slippers. Cute! Ballet slipper sizes range from infant size 4 to girls size 4. These shoes run small, please order up TWO sizes. ^||,|$38.00$|,||,|KAMARA-RED-BALLET-SLIPPERS|,|http://www.labellaflorachildrensboutique.com/kamara-red-ballet-slippers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kamara-red-girls-leather-ballet-slippers-13.jpg||-||Kamara White Leather Ballet Slippers|,|^|A satiny ribbon rosette trims the toes of these girls white leather ballet slippers by Kamara. Elastic instep strap for fit, ribbon ties go around the ankle. Available in babys size 4 to big girls size 4. Wear with her summer favorites or to dance class! Ballet slipper sizes range from infant size 4 to girls size 4. These shoes run small, please order up TWO sizes. ^||,|$38.00$|,||,|KAMARA-WHITE-BALLET-SLIPPERS|,|$URL$kamara-white-ballet-slippers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kamara-white-leather-ballet-slippers-13.jpg||-||Kate Mack Aqua Girls Cirque De Soleil Tunic Set (4, 6X)|,|^|Matching several of the new arrivals by Kate Mack, this girls tunic outfit is just darling. The long top offers her a racer back fit. The unique shape of the hemline is dress for success with fun tulle ruffles. A single rose is found near the neckline. Solid leggings are worn beneath and offer an easy elastic waist and gathered hemlines. ONE EACH SIZE 4 & 6X ONLY LEFT.  ^||,|$49.00$|,||,|KATE-MACK-AQUA-GIRLS-CIRQUE-DE-SOLEIL-TUNIC-SET|,|$URL$kate-mack-aqua-girls-cirque-de-soleil-tunic-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-aqua-girls-cirque-de-soleil-tunic-set-1.jpg||-||Kate Mack Cirque De Soleil Pink Sequin Girls Dress|,|^|This Kate Mack dress is a real gem and is filled with the circus fun that is inherent in the ""Cirque De Soleil"" collection. The sleeveless dress is covered with sequins that reflect every ray of light as she moves. A single flower is found near the neckline to add more texture. The fabric lining is striped and helps create the comfort of this casual, fabulous look. ^||,|$39.00$|,||,|KATE-MACK-CIRQUE-DE-SOLEIL-PINK-SEQUIN-GIRLS-DRESS|,|$URL$kate-mack-cirque-de-soleil-pink-sequin-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-cirque-de-soleil-pink-sequin-girls-dress-1.jpg||-||Kate Mack Cirque De Soleil Pink Tunic and Capri - 12 Mos & 4T|,|^|A cute little girls outfit created by designer Kate Mack, this wonderful infant and toddler set is a winner! The sweet pink stripes race the empire bodice, accenting the straight neckline and thin straps. A single flower is found on the top while the tiered skirt is created with fairy ruffles. Matching striped capris are paired beneath to complete this look. (1) EACH SIZE 12 MOS AND 4T LEFT.  ^||,|$39.00$|,||,|KATE-MACK-CIRQUE-DE-SOLEIL-PINK-TUNIC-CAPRI|,|$URL$kate-mack-cirque-de-soleil-pink-tunic-capri.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-cirque-de-soleil-pink-tunic-and-capri-1.jpg||-||Kate Mack Designer Girls Holiday Dress Pink and Gray|,|A gorgeous designer girls dress, this new arrival is from Kate Mack. The grey bodice offers her a drop waist and long sleeves. A hidden zipper runs up the back while two pin tucks offer a more structured shape for the front. The flower duet found on the neckline is made from sweet tulle and a sparkling center. The matching skirt is layered in grey and pink tulle ruffles. The asymmetrical hemline is a unique finish! Cotton/Polyester/Spandex. Place inside mesh laundry bag and machine wash cold. Hang to dry. |,|$55.50$|,||,|KATE-MACK-DESIGNER-GIRLS-HOLIDAY-DRESS-PINK-GRAY|,|$URL$kate-mack-designer-girls-holiday-dress-pink-gray.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-designer-girls-holiday-dress-pink-and-gray-preorder-6.jpg||-||Kate Mack Designer Skirt and Top for Girls Hearts|,|From designer Kate Mack, this new girls outfit is a great addition to her school wardrobe. The pale pink top features long sleeves and a chocolate heart print. The shirts shape is created with the draw strings that gather both sides near the hemline and finished with a bow. The top is paired with a brown skirt. This skirt opens to a full circle shape and boasts of large fabric ruffle rosettes covering the bottom. A bow is found at the center of each flower. |,|$69.00$|,||,|KATE-MACK-DESIGNER-SKIRT-TOP-GIRLS-HEARTS|,|$URL$kate-mack-designer-skirt-top-girls-hearts.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-designer-skirt-and-top-for-girls-hearts-1.jpg||-||Kate Mack Designer Winter Vest for Girls Green|,|Designer Kate Mack is now offering this cute winter vest for girls as a part of their fall and winter collection. The vest is a bright lime green that stands out from the colors of the season. The puffy style is a classic look while a touch of ruffles is a unique twist. Her hands find their home in the front side pockets while a zipper closes the front. 100% Polyester. Machine wash cold. Tumble dry on low. |,|$49.50$|,||,|KATE-MACK-DESIGNER-WINTER-VEST-GIRLS-GREEN|,|$URL$kate-mack-designer-winter-vest-girls-green.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-designer-winter-vest-for-girls-green-1.jpg||-||Kate Mack Eau So French Girls Tutu Dress|,|Created by Kate Mack, this darling dress will make many lasting memories. The short sleeved bodice boasts of a darling large bow just beneath the neckline. Red and white stripes wrap from front to back. The white skirt has a layer of tulle on top. Two red stripes on the hem finish the look. |,|$46.50$|,||,|KATE-MACK-EAU-SO-FRENCH-GIRLS-TUTU-DRESS|,|$URL$kate-mack-eau-so-french-girls-tutu-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-eau-so-french-girls-tutu-dress-2.jpg||-||Kate Mack Eau So French Maxi Dress (5, 6, 7)|,|^|Kate Mack is now offering this wonderful casual dress perfect for your next family vacation. The sleeveless dress has a large hole at the back of the neckline while the fun red and white stripes fall down through the long skirt. The maxi length is always a big hit and a touch of black at the bottom adds a unique finish. SIZE 5, 6 & 7 ONLY REMAINING.  ^||,|$36.75$|,||,|KATE-MACK-EAU-SO-FRENCH-MAXI-DRESS|,|$URL$kate-mack-eau-so-french-maxi-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-eau-so-french-maxi-dress-3.jpg||-||Kate Mack Girls Dress in Flower Print|,|In a modern print and style, this new designer dress for girls comes from Kate Mack. The drop waist dress is covered in flowers with a small touch of pink found at the center. The long sleeves are striped in white and black while a pink belt is worn around the waist. The skirt has a scallop look in alternating black and white. The dress is fastened in the back and is made from a comfortable fabric she can wear all day long without a care. Cotton/Polyester/Spandex. Hand wash in cold water. Hang to dry. |,|$49.50$|,||,|KATE-MACK-GIRLS-DRESS-FLOWER-PRINT|,|$URL$kate-mack-girls-dress-flower-print.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-girls-dress-in-flower-print-preorder-10.jpg||-||Kate Mack Girls Faux Fur Vest in Snow Leopard Print|,|Created to compliment her new Kate Mack outfits, this fabulous faux fur vest for girls is a must have piece for winter! The snow leopard print is a cool grey and makes it easy to pair with several different styles. The vest is lined in a silver polyester that keeps her layers from bunching. Two silver ruffles wrap around the front while a large bow sits just beneath the neckline. The vest is closed with hidden fasteners. Faux Fur/Acrylic/Polyester. Dry clean only. |,|$48.00$|,||,|KATE-MACK-GIRLS-FAUX-FUR-VEST-SNOW-LEOPARD-PRINT|,|$URL$kate-mack-girls-faux-fur-vest-snow-leopard-print.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-girls-faux-fur-vest-in-snow-leopard-print-23.jpg||-||Kate Mack Girls Maxi Dress Cirque De Soleil (4, 5 & 8)|,|^|Kate Mack especially made this beautiful dress for her casual vacation days. The long piece falls with thin stripes in a delicate mix of shades. The high low hemline is wrapped with three ruffles to match the cap sleeves. A single flower is found near the wide neckline. A couple bands run across her back. This dress has a pull over fit and is as comfortable as can be! SIZE 4, 5 & 8 ONLY LEFT.  ^||,|$39.00$|,||,|KATE-MACK-GIRLS-MAXI-DRESS-CIRQUE-DE-SOLEIL|,|$URL$kate-mack-girls-maxi-dress-cirque-de-soleil.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-girls-maxi-dress-cirque-de-soleil-1.jpg||-||Kate Mack Girls Maxi Dress in Garden Stripe|,|^|Blending a popular trend with a new style, this fabulous girls dress comes from Kate Mack in their ""Garden Stripe"" collection. The dress features a soft fabric that has a slight stretch in it. The scoop neckline boasts of a racer back style that welcomes warm sun rays. Three cute flowers are found just below the neck to match the fun thin stripes. The hem is skewed to the right, standing apart from all other summer dresses. ^||,|$36.00$|,||,|KATE-MACK-GIRLS-MAXI-DRESS-GARDEN-STRIPE|,|$URL$kate-mack-girls-maxi-dress-garden-stripe.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-girls-maxi-dress-in-garden-stripe-1.jpg||-||Kate Mack Girls Once Piece Swimsuit with Tutu Skirt|,|^|From the ""Paradise Palms"" collection by designer Kate Mack, this fabulous one-piece suit is sure to be a favorite. The pink top has thin straps while a single flower is found near the straight neckline. Pink sequins sprinkle themselves down the bodice. A fairy skirt of ruffles wraps around the hem. Nylon/Spandex Blend. Hand wash in cold water and lay flat to dry. ^||,|$54.00$|,||,|KATE-MACK-GIRLS-ONCE-PIECE-SWIMSUIT-TUTU-SKIRT|,|$URL$kate-mack-girls-once-piece-swimsuit-tutu-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-girls-once-piece-swimsuit-with-tutu-skirt-8.jpg||-||Kate Mack Girls Puffer Vest in Pink|,|A casual piece of girls outerwear for the coming season, this new winter vest is from Kate Mack. The vests boasts of a bright lime lining and zipper that runs up the front. The collar and zipper line are accented with quaint ruffles. The puffer vest is a classic style and has two front pockets. This vest is designed for a more fitted look. 100% Polyester. Machine wash cold. Tumble dry on low. |,|$49.50$|,||,|KATE-MACK-DESIGNER-WINTER-VEST-GIRLS-PINK|,|$URL$kate-mack-designer-winter-vest-girls-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-girls-puffer-vest-in-pink-1.jpg||-||Kate Mack Girls Sequin Top in Zebra Print|,|^|This new top from designer Kate Mack is a fabulous piece that she will love to wear to school! The black top boasts of long sleeves and a comfortable fabric that allows slight stretch in fit. The front is covered with a zebra animal print created by black and silver sequins. This top matches the new pleather shorts and jeggings that are also available from Kate Mack's ""Wild Princess"" collection. Polyester/Spandex/Rayon Blend. Hand Wash in Cold Water. Lay Flat to Dry. ^||,|$34.50$|,||,|KATE-MACK-GIRLS-SEQUIN-TOP-ZEBRA-PRINT|,|$URL$kate-mack-girls-sequin-top-zebra-print.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-girls-sequin-top-in-zebra-print-preorder-1.jpg||-||Kate Mack Girls Striped Tee with Tulle Skirt (4, 5)|,|^|An outfit sure to receive many compliments, this girls top and skirt come from fabulous Kate Mack. The striped top features long sleeves with slight gathers near both cuffs and a trio of fabric flowers off centered near the neckline. The accompanying skirt is a deep navy blue and adds character with the tiers of blue tulle ruffles that wrap around the skirt from waist the hemline. matching flowers also embelish the skirt. Top is created with a cotton polyester blend, the skirt: cotton-polyblend with a 100% polyester ruffle. Machine wash and tumble dry on low. SIZE 4 AND (1) 5 ONLY LEFT.  ^||,|$39.33$|,||,|KATE-MACK-GIRLS-STRIPED-TEE-TULLE-SKIRT|,|$URL$kate-mack-girls-striped-tee-tulle-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-girls-striped-tee-with-tulle-skirt-3.jpg||-||Kate Mack Girls Tee and Long Skirt in Lilac Lace (Size 6)|,|^|Sure to make all of her friends envious, this beautiful new outfit comes from loved designer Kate mack. The long sleeve lilac top boasts of a delicate lace print while a touch of sparkle is added to the front with gems. Gathers add a splace of character to the cuffs of her long sleeves. Paired with a beautiful long skirt with a stretch fit waist and tiers of handkerchief tulle layers that fall from waist to hem. Top: Made with cotton blend. Machine wash cold, line dry. Skirt: Made with cotton blend. Machine wash cold, line dry. ONE SIZE 6 LEFT.  ^||,|$38.33$|,||,|KATE-MACK-GIRLS-TEE-LONG-SKIRT-LILAC-LACE|,|$URL$kate-mack-girls-tee-long-skirt-lilac-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-girls-tee-and-long-skirt-in-lilac-lace-2.jpg||-||Kate Mack Girls Tunic and Legging Puppy Love|,|A cute new outfit for your darling daughter, this tunic and legging set is filled with a Parisian feel from Kate Mack. The tunic features a sweet puppy screen print upon the front. The long sleeves are covered in thin stripes to match the accent on her neckline. This top is finished with two layers of sheer ruffles in polka dot and black. Matching leggings are worn beneath and compliment the top perfectly. Cotton/Polyester/Spandex. Place garment inside out in mesh a laundry bag and machine wash cold. Hang to dry. |,|$61.50$|,||,|KATE-MACK-GIRLS-TUNIC-LEGGING-PUPPY-LOVE|,|$URL$kate-mack-girls-tunic-legging-puppy-love.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-girls-tunic-and-legging-puppy-love-17.jpg||-||Kate Mack Girls Winter Coat Polar Perfection Gray|,|Designed by Kate Mack, this new girls winter coat is a fun piece she can wear to any event. The charcoal grey fabric is comfortable to wear and is sure to keep her warm. The collar is dressed with sweet felt flowers in cream, grey, black and red. The same colors adorn the hemline. The structured shape is created with two pin tucks. A matching hat is available while quantities last! 100% Polyester. Machine wash cold inside out. Tumble dry on low. |,|$66.00$|,||,|KATE-MACK-GIRLS-WINTER-COAT-POLAR-PERFECTION-GRAY|,|$URL$kate-mack-girls-winter-coat-polar-perfection-gray.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-girls-winter-coat-polar-perfection-gray-1.jpg||-||Kate Mack Grey Pretty Kitty Ruffle Dress (Size 4 & 6)|,|^|From designer Kate Mack for the fall and winter season, this girls dress comes from their collection ""Pretty Kitty."" The long sleeve bodice is solid light grey and offers a hidden zipper that closes up the back. A subtle touch of color is added through the sparkling gems that dance just beneath the neckline. The fun, unique skirt is draped with sheer grey ruffles with a striped look. Made with a cotton blend and accented with 100% polyester ruffles. Machine wash and hang to dry. SIZE 4 & 6 REMAINING.  ^||,|$34.33$|,||,|KATE-MACK-GREY-PRETTY-KITTY-RUFFLE-DRESS|,|$URL$kate-mack-grey-pretty-kitty-ruffle-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-grey-pretty-kitty-ruffle-dress-2.jpg||-||Kate Mack Heavenly Roses Tunic with Shorts|,|A truly fabulous casual look from Kate Mack, this little girls outfit is darling! The fitted bodice is covered with flowers while wide ruffle tiers fall from the empire waist. Matching pink shorts are worn beneath. |,|$49.00$|,||,|KATE-MACK-HEAVENLY-ROSES-TUNIC-LEGGING|,|$URL$kate-mack-heavenly-roses-tunic-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-heavenly-roses-tunic-with-shorts-2.jpg||-||Kate Mack Infant Bikini Seaside Petals (6 Mos)|,|^|New from the ""Seaside Collection"" by well known and well loved designer Kate Mack, this baby bikini is made to match several other creations for your family vacations. The bikini top is covered with navy and white petals arranged in stripes and offers thin, white stripes. The matching navy bottoms boast only of the single row of petals adorning the front of her waist. ONE 6 MOS ONLY LEFT.  ^||,|$19.00$|,||,|KATE-MACK-INFANT-TODDLER-BIKINI-SEASIDE-PETALS|,|$URL$kate-mack-infant-toddler-bikini-seaside-petals.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-infant-and-toddler-bikini-seaside-petals-13.jpg||-||Kate Mack Little Girls Ruffle Halter Top Bikini|,|Made for fun in the sun, this Kate Mack bikini is sure to see many days of warm weather. The candy colored dots create the bandeau top. Two sweet ruffles are attached for the perfect texture. The bottoms match and are accented only by a two ties in either side of her hips. Nylon/Spandex Blend. Hand wash in cold water and lay flat to dry. |,|$46.00$|,||,|KATE-MACK-LITTLE-GIRLS-RUFFLE-HALTER-TOP-BIKINI|,|$URL$kate-mack-little-girls-ruffle-halter-top-bikini.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-little-girls-ruffle-halter-top-bikini-8.jpg||-||Kate Mack Little Girls Sequin Top Bikini in Aqua|,|In true Elsa style, this girls swimsuit comes from designer Kate Mack. The top wraps around in a triangle shape and offers thin straps. The front is dressed with a brilliant sprinkling of sequins along the ice blue colored fabric. The ruffles that run around the bottoms match in color and are simply sweet. Match to her sisters with the other darling styles! Nylon/Spandex Blend. Hand wash in cold water and lay flat to dry. |,|$52.00$|,||,|KATE-MACK-LITTLE-GIRLS-SEQUIN-TOP-BIKINI-AQUA|,|$URL$kate-mack-little-girls-sequin-top-bikini-aqua.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-little-girls-sequin-top-bikini-in-aqua-8.jpg||-||Kate Mack Monte Carlo Navy Blue Girls Dress|,|An effortless cruise look, this new girls dress comes from Kate Mack. The bodice features a thin stripe print and a relaxed racer back neckline. The skirt is covered with white ruffles trimmed in navy thread that fall beautifully from the waist to the hem. A single bow is found attached to the neck. Made with cotton blend. Machine wash cold, tumble dry low. |,|$49.00$|,||,|KATE-MACK-MONTE-CARLO-NAVY-BLUE-GIRLS-DRESS|,|$URL$kate-mack-monte-carlo-navy-blue-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-monte-carlo-navy-blue-girls-dress-1.jpg||-||Kate Mack Monte Carlo Skirt Set (Size 5 & 6)|,|^|One of the cutest outfits of the season, this new Kate Mack design is a fabulously casual look. A sleeveless top features an elegant lady and her dog accented with small pops of color. The navy stripes race up her back and on her shoulders. A sweet matching skirt boasts of fun ruffles that fall into an uneven hemline. Made with cotton blend. Machine wash cold, tumble dry low. SIZE 5 AND 6 ONLY REMAINING.  ^||,|$59.00$|,||,|KATE-MACK-MONTE-CARLO-SKIRT-SET|,|$URL$kate-mack-monte-carlo-skirt-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-monte-carlo-skirt-set-1.jpg||-||Kate Mack Navy Blue Girls Romper|,|A fun design from one of our top brands, Kate Mack, she is sure to love this romper. The thin straps tie in a bow on the top of her shoulders while the neckline is decorated with ruffles. A drawstring waist adds shape while comfy pockets are found just beneath. The navy and white stripes continue down to the hem of both legs. Made with cotton blend. Machine wash cold, tumble dry low. |,|$42.00$|,||,|KATE-MACK-NAVY-BLUE-GIRLS-ROMPER|,|$URL$kate-mack-navy-blue-girls-romper.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-navy-blue-girls-romper-1.jpg||-||Kate Mack Navy Blue Striped Girls Leggings|,|^|Easy to pair beneath her favorite skirts and dresses, Kate Mack is now offering the navy striped leggings to match pieces from the ""Poodle in Paris"" collection. The leggings are made with a fabric that allows stretch for the classic, fitted look. The navy blue is striped by white from the elastic waist to the hem of both legs. Legging is created with a cotton polyester blend. Machine wash and tumble dry on low. ^||,|$8.33$|,||,|KATE-MACK-NAVY-BLUE-STRIPED-GIRLS-LEGGINGS|,|$URL$kate-mack-navy-blue-striped-girls-leggings.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-navy-blue-striped-girls-leggings-2.jpg||-||Kate Mack Paradise Palms Chiffon Swim Coverup|,|^|The ""Paradise Palms"" collection by Kate Mack is filled with a fun inspiration. The cotton candy colors blend together with it's palm tree inspired print. The chiffon cover up is flowy and sweet, perfect for her days lounging by the pool or on the beach. Match it with the suits for cute sister pairs! ^||,|$52.00$|,||,|KATE-MACK-PARADISE-PALMS-CHIFFON-SWIM-COVERUP|,|$URL$kate-mack-paradise-palms-chiffon-swim-coverup.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-paradise-palms-chiffon-swim-coverup-11.jpg||-||Kate Mack Paradise Palms Skirt Set|,|Dazzling in pink, this cute new outfit comes from Kate Mack. A fun sequined palm tree motif dresses the front of the tank top. A hi-lo hemline keeps her on trend with the big girls. The fun skirt has a layer of matching tulle and an exposed seam. She'll be twirling around the room in this fancy look! |,|$86.00$|,||,|KATE-MACK-PARADISE-PALMS-SKIRT-SET|,|$URL$kate-mack-paradise-palms-skirt-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-paradise-palms-skirt-set-17.jpg||-||Kate Mack Party Dress for Girls with Sequins Zebra|,|^|For your fashionable daughter, this new girls party dress from Kate Mack is from their ""Wild Princess"" collection. The dress is cut for a fitted look with a straight hemline. The long sleeves are solid black, matching the back of the dress. The front is covered with a silver and black sequin design creating a zebra print. There are three buttons that fasten on her back. This dress boasts of an easy and comfortable fit that is filled with style and glitz! Polyester/Spandex/Rayon Blend. Hand Wash in Cold Water. Lay Flat to Dry. ^||,|$46.50$|,||,|KATE-MACK-PARTY-DRESS-GIRLS-SEQUINS-ZEBRA|,|$URL$kate-mack-party-dress-girls-sequins-zebra.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-party-dress-for-girls-with-sequins-zebra-preorder-5.jpg||-||Kate Mack Picnic in Provence Girls Halter Dress ( 4 & 8 )|,|^|From Kate Mack, this dress lends a carefree, fun spirit to all who wear it. The bodice wraps into a V-neckline while the pink gingham ties behind her neck. A matching sash ties around the waist while the skirt opens in shape and ends with a bubble hemline. Made with cotton blend. Machine wash cold, tumble dry low. SIZE 4 AND (1) 8 LEFT.  ^||,|$49.00$|,||,|KATE-MACK-PICNIC-PROVENCE-GIRLS-HALTER-DRESS|,|$URL$kate-mack-picnic-provence-girls-halter-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-picnic-in-provence-girls-halter-dress-1.jpg||-||Kate Mack Picnic in Provence Short Set|,|A darling outfit, this new arrival from designer Kate Mack is decorated just in her favorite style! The solid white tank is dress in bows in pastel gingham. Matching shorts fasten with a button and feature belt loops and ruffled tiers at the hem. Made with cotton blend. Machine wash cold, tumble dry low. |,|$49.00$|,||,|KATE-MACK-PICNIC-PROVENCE-SHORT-SET|,|$URL$kate-mack-picnic-provence-short-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-picnic-in-provence-short-set-1.jpg||-||Kate Mack Pinwheel Petals Baby Girls Bikini in Pink (3 Mos)|,|^|With a contagious spirit, this new baby girls bikini comes from designer Kate mack. The pink bikini top boasts of thin straps, a straight shape, and a pinwheel flower made with petals in alternating colors. The matching bottoms are skirted with matching petals dangling from her waist. Matches perfectly to her older sisters one piece ""Pinwheel Petals"" swimsuit. 3 MOS ONLY REMAINING. ^||,|$19.00$|,||,|KATE-MACK-PINWHEEL-PETALS-BABY-GIRLS-BIKINI-PINK|,|$URL$kate-mack-pinwheel-petals-baby-girls-bikini-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-pinwheel-petals-baby-girls-bikini-in-pink-12.jpg||-||Kate Mack Pleather Jeggings for Girls in Black|,|Made in popular pleather, these new jeggings from Kate Mack area brilliant creation that will go with most any top and tunic she owns. The pants have slight stretch and offer her five pockets. Two of these pockets are found on the back. Sparkling gem accents are found on the front for a special touch. The skinny shape is perfect for pairing with boots. A zipper and button are ease to fasten for fit while belt loops run around the waist. Polyester/Polyurethane Blend. Hand Wash in Cold Water. Hang to Dry. |,|$36.75$|,||,|KATE-MACK-PLEATHER-JEGGINGS-GIRLS-BLACK|,|$URL$kate-mack-pleather-jeggings-girls-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-pleather-jeggings-for-girls-in-black-1.jpg||-||Kate Mack Pleather Shorts for Girls Black|,|A trendy new arrival, this design by Kate Mack is a must have piece! These pleather shorts for girls are in solid, jet black which allows them to be paired with many different tops. The shorts are dressed with a shimmering button and a zipper to close the fit. Belt loops are found on the waist while the front pockets are trimmed in ruffles. Three pleather ruffles wrap around the hem of both legs and traditional back pockets are found on these shorts. Polyester/Polyurethane Blend. Hand Wash in Cold Water. Hang to Dry. |,|$34.50$|,||,|KATE-MACK-PLEATHER-SHORTS-GIRLS-BLACK-PLEATHER|,|$URL$kate-mack-pleather-shorts-girls-black-pleather.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-pleather-shorts-for-girls-black-preorder-7.jpg||-||Kate Mack Red and White Tutu Set|,|Dazzling in red, this cute new outfit comes from Kate Mack. The thin stripes are a timeless look while the bodice features a racerback fit. A large bow is found just beneath the neckline. The fun skirt has a layer of matching tulle and a pop of red at the hemline. Matching striped leggings are paired beneath to finish this look! |,|$57.00$|,||,|KATE-MACK-RED-WHITE-TUTU-SET|,|$URL$kate-mack-red-white-tutu-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-red-and-white-tutu-set-3.jpg||-||Kate Mack Red Holiday Coat for Girls|,|In time for the coming winter season, this new girls winter coat is from designer Kate Mack. The coat is created in a rich red, a popular and fabulous color for coats! This coat adds a pop of color to the monotone scenery of winter. The collar and hemline are dressed with matching flower cut outs. Some sparkling accents are found at the center of these flowers. Hidden buttons close the front while two pin tucks create the shape. While quantities last, a matching hat can also be found in Kate Mack's fall and winter collection. 100% Polyester. Machine wash inside out in cold water. Tumble dry on low. |,|$66.00$|,||,|KATE-MACK-RED-HOLIDAY-COAT-GIRLS|,|$URL$kate-mack-red-holiday-coat-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-red-holiday-coat-for-girls-preorder-12.jpg||-||Kate Mack Red Infant Regatta Girls Bikini |,|^|Fitted with this unique sailor spirit, her water fun will be endless courtesy of designer Kate Mack. The thin strapped bodice features a unique large bow that covers the front with its pleated sides and wide white middle. The accompanying bottoms are made with a solid red and boast of the red and white striped skirting around the waist. SIZE 6 MONTH AND 9 MONTH AVAILABLE  ^||,|$19.00$|,||,|KATE-MACK-RED-REGATTA-INFANT-GIRLS-BIKINI|,|$URL$kate-mack-red-regatta-infant-girls-bikini.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-red-infant-regatta-girls-bikini-12.jpg||-||Kate Mack Ruffle Dress for Girls in Blue Stripes|,|From designer Kate Mack, this new girls dress is a beautiful creation that she is sure to love. The blue and white stripes are inspired by Paris while a sweet ruffle graces the wide neckline. A large bow is found just beneath the neck as well. The back of the dress is fastened with a row of buttons. The skirt is covered with matching ruffles that fall from the drop waistline down to her hem. Cotton/Spandex/Polyester. Machine wash cold inside out. Tumble dry on low. |,|$57.00$|,||,|KATE-MACK-RUFFLE-DRESS-GIRLS-BLACK-STRIPES|,|$URL$kate-mack-ruffle-dress-girls-black-stripes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-ruffle-dress-for-girls-in-black-stripes-preorder-11.jpg||-||Kate Mack Strike A Pose Girls Sequin Party Dress (Size 5)|,|^|From one of my personal favorite collections to arrive this year from Kate Mack, this girls party dress is stunning! The solid grey dress offers buttons to close the back and a sharkbite hem. This straight shape is great to pair with a fashion belt, and is flattering to her slender shape. The long sleeves are covered with sequins in peacock colors, adding glitz. Made with a polyester blend. Hand wash cold, line dry. SIZE 5 REMAINING.  ^||,|$39.00$|,||,|KATE-MACK-STRIKE-POSE-GIRLS-SEQUIN-PARTY-DRESS|,|$URL$kate-mack-strike-pose-girls-sequin-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-strike-a-pose-girls-sequin-party-dress-2.jpg||-||Kate Mack Swan Lake Girls Dress|,|^|A sweet dress for a sweet girl, this new arrival is part of Kate Mack's ""Swan Lake"" collection. The drop waist bodice is pale pink and has a sleeveless neckline. The skirt is dressed with tiers of tulle plums introduced by large satin bow. Large sequins create the graceful swan that sits on the front. ^||,|$49.50$|,||,|KATE-MACK-SWAN-LAKE-GIRLS-DRESS|,|$URL$kate-mack-swan-lake-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-swan-lake-girls-dress-2.jpg||-||Kate Mack Tahitian Sunset Dress with Sequin (10, 12 & 14)|,|Adorable in cut and color, this new Kate Mack dress matches several of the new arrivals. The sleeveless neckline offers a comfortable racer back. The coral and yellow blend beautifully within this collection and creates a unique animal print accented with sequins. The hem is finished with a skewed angle that sets it apart from all the rest! |,|$39.00$|,||,|KATE-MACK-TAHITIAN-SUNSET-DRESS-SEQUIN|,|$URL$kate-mack-tahitian-sunset-dress-sequin.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-tahitian-sunset-dress-with-sequin-1.jpg||-||Kate Mack Tulle Tunic and Legging for Little Girls|,|Created by Kate Mack, this new little girls tunic set is a cute outfit that all will compliment! The empire bodice offers long sleeves and is covered with a fun grey and pink polka dot print. Two tulle flowers sit on the neckline complete with shimmering centers. Three buttons fasten on her back for an easy and comfortable fit. The skirt of the tunic is created by layers and layers of sheer tulle in the same grey and pink shades. Striped leggings accompany the tunic to be worn beneath. Cotton/Polyester/Spandex. Place in mesh laundry bag and machine wash cold. Hang to dry. |,|$51.00$|,||,|KATE-MACK-TULLE-TUNIC-LEGGING-LITTLE-GIRLS|,|$URL$kate-mack-tulle-tunic-legging-little-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-tulle-tunic-and-legging-for-little-girls-preorder-11.jpg||-||Kate Mack Up up and Away Frilly Girls Dress|,|A gorgeous designer girls dress, this new arrival is from Kate Mack. The candy colored spotted pattern creates the bodice which offers her a drop waist and a sleeveless style. A hidden zipper runs up the back while two pin tucks offer a more structured shape for the front. The single purple flower found on the neckline is made from sweet tulle. The matching skirt is layered in purple tulle ruffles. The asymmetrical hemline is a unique finish. |,|$69.00$|,||,|KATE-MACK-UP-UP-AND-AWAY-FRILLY-GIRLS-DRESS|,|$URL$kate-mack-up-up-and-away-frilly-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-up-up-and-away-frilly-girls-dress-1.jpg||-||Kate Mack Up Up and Away Ruffle Bikini|,|Made with style and quality, this classic Kate Mack bikini will fill your little girl's eyes with delight. The bottoms are covered in little balloon polka dots and boast only of the row of ruffles that run around her waist. The top matches, covered in little ruffles and finished with a halter strap. The straps are adjustable for her own personal fit. Nylon/Spandex Blend. Hand wash in cold water and lay flat to dry. |,|$52.00$|,||,|KATE-MACK-UP-UP-AND-AWAY-RUFFLE-BIKINI|,|$URL$kate-mack-up-up-and-away-ruffle-bikini.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-up-up-and-away-ruffle-bikini-8.jpg||-||Kate Mack Up Up and Away Tunic Outfit|,|A cute little girls outfit created by designer Kate Mack, this wonderful infant and toddler set is a winner! The sweet candy colored dots create the empire bodice, accenting the shoulder with a tulle flower. The tiered skirt is created with fairy ruffles in purple. Matching purple capris are paired beneath to complete this look. |,|$62.00$|,||,|KATE-MACK-UP-UP-AND-AWAY-TUNIC-OUTFIT|,|$URL$kate-mack-up-up-and-away-tunic-outfit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-up-up-and-away-tunic-outfit-22.jpg||-||Kate Mack Water Sprite Tunic with Shorts ( 9 Mos, 24 Mos & 2T)|,|Light and cheery, this new girls outfit comes from designer Kate Mack. The cute top has a blue empire waist, thin straps, and a single flower on the bodice. The three tiers have cute little flowers in their darling pattern. Solid light blue shorts are worn beneath and a single pink flower is found on both legs. |,|$39.00$|,||,|KATE-MACK-WATER-SPRITE-TUNIC-CAPRI|,|$URL$kate-mack-water-sprite-tunic-capri.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-water-sprite-tunic-with-capri-2.jpg||-||Katie Rose Ashley Girls Bloomer Dress in White|,|Beautiful in white, this new infant girls bloomer dress from Katie Rose will elegantly clothe your baby during the warmer months. The bodice boasts of the Ashley lace design on the front adorned with light pink flowers, short sleeves edged with lace, and a white satin waist that ties in a bow on her back. The bloomers boast only of their flower accents on each leg and a scalloped embroidered lace overlay skirt. Accompanied by a matching cap. Made from 100% cotton; Hand wash; Dry flat. |,|$79.00$|,||,|KATIE-ROSE-ASHLEY-GIRLS-BLOOMER-DRESS-WHITE|,|$URL$katie-rose-ashley-girls-bloomer-dress-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-ashley-girls-bloomer-dress-in-white-25.jpg||-||Katie Rose Baby Flower Girls Dress in Ivory|,|Designed by Katie Rose, this new baby girls gown is absolutely stunning! The empire bodice features 100% cotton and a sweet ivory shade. The waist is adorned with a satin belt that ties into a bow on her back and is covered with small floral blooms on the front. The full circle skirt is inspired by the dreamy tutu style and is created with two layers of matching ivory tulle. The top layer is decorated with an ivory satin hemline. This dress is wonderful for weddings, photographs, Easter, and so much more! 100% cotton. Hand wash and dry flat. |,|$39.00$|,||,|KATIE-ROSE-BABY-FLOWER-GIRL-DRESS-IVORY|,|$URL$katie-rose-baby-flower-girl-dress-ivory.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-baby-flower-girls-dress-in-ivory-1.jpg||-||Katie Rose Baby Girl Ivory Lace Gown with Bonnet|,|So sweet and gorgeous, this new infant girls take home gown from designer Katie Rose is a perfect choice for her first day home. The empire waist bodice features its soft cotton knit, arms edged in lace, and a wide ribbon adorned with lace that wraps around the front and ties in the back. The skirt ends with an elastic hem to keep her cute feet cuddled up and an embroidered mesh overlay with a floral design. Accompanied with a matching mesh bonnet boasting of the same wide ribbon bow to tie in the back. Made with 100% cotton, hand wash. |,|$119.00$|,||,|KATIE-ROSE-GIRLS-TAKE-HOME-SET|,|$URL$katie-rose-girls-take-home-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-baby-girl-ivory-lace-gown-with-bonnet-25.jpg||-||Katie Rose Baby Girl Party Dress in Ivory|,|The perfect ivory dress for any special occasion you might have this summer, this new onesie gown from Katie Rose is a sweet dream. The empire bodice is accented with short, ruffled sleeves and an ivory ribbon that ties in a cute bow at the back of her waist. The classic onesie snaps make this an easy and comfortable fit. Matching ivory tulle creates a skirt and is trimmed with the same satin ribbon. The accompanying lace headband is accented with a darling ivory flower, twin to the bloom that adorns the ribbon tied around her waist. Made with 100% cotton excluding the tulle and accents. Suggested hand wash and air dry. |,|$67.00$|,||,|KATIE-ROSE-BABY-GIRL-PARTY-DRESS-IVORY-GAYLE|,|$URL$katie-rose-baby-girl-party-dress-ivory-gayle.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-baby-girl-party-dress-in-ivory-11.jpg||-||Katie Rose Baby Girls Bloomer Dress and Hat Ivory Sara (6 Mos & 9 Mos)|,|^|New from infant designer Katie Rose, this Sara gown is beautiful. In a soft ivory, the knit bodice features an empire waist adorned with an embroidered flower embellishment that catches light just right and is framed with satin bows. The long sleeves are finished in a sweet lace while a satin tie creates a bow in the back. The bloomer legs finish in an elastic ruffle adorned with bows and a line of changing snaps while the mesh overlay is covered in satin ribbon that falls in lines from the waist down to the scalloped lace hem. A matching hat accompanies the gown, made with 100% cotton. Hand wash. SIZE 6 MONTH AND 9 MONTH REMAINING. ^||,|$86.00$|,||,|KATIE-ROSE-BABY-GIRLS-BLOOMER-DRESS-HAT-IVORY-SARA|,|$URL$katie-rose-baby-girls-bloomer-dress-hat-ivory-sara.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-baby-girls-bloomer-dress-and-hat-ivory-sara-14.jpg||-||Katie Rose Baby Girls Gown in Ivory Joli|,|Truly unforgettable, this new baby take home gown designed by Katie Rose is created to celebrate a very special event! The charming gown features an empire bodice with short puffy sleeves. The waist is accented with embroidery and bows on the front and a sweet satin bow that ties in the back. The long skirt drapes in beautiful ivory cotton while matching lace elegantly drapes over top. The lace features scallop edges and a floral embroidery. Made in the USA. 100% cotton. Hand wash with care and lay flat to dry. |,|$141.00$|,||,|KATIE-ROSE-BABY-GIRLS-GOWN-IVORY-JOLI|,|$URL$katie-rose-baby-girls-gown-ivory-joli.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-baby-girls-gown-in-ivory-joli-1.jpg||-||Katie Rose Baby Hollee Ruffle Socks|,|^|A sweet little accessory for your new addition, these adorable baby socks come from designer Katie Rose. Made to match the ""Hollee"" infant bloomer dress (as well as many of Katie Rose's designs) these little ruffle socks are just too cute. The embroidered lace details hang from the cuffs nearly hiding baby girl's little feet. Ivory satin bows with soft tulle details adorn the top of the cuffs. Made from an oh so soft cotton to be soft and warm on her toes. ^||,|$21.00$|,||,|KATIE-ROSE-BABY-HOLLEE-RUFFLE-SOCKS|,|$URL$katie-rose-baby-hollee-ruffle-socks.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-baby-hollee-ruffle-socks-1.jpg||-||Katie Rose Baby Pink Bloomer Dress Bree|,|From the fabulous Katie Rose comes this stunning baby girls bloomer dress. This would be perfect for a take home gown or for any of baby's dressy occasions. The soft pink cotton bodice has short gathered sleeves. The sleeves have a lace embellishment. A pink tulle skirt flows from a lovely ribbon of leaves and flowers on the empire waist. The tiny flowers have white beaded centers. This embellishment is repeated at the hemline. A satin pink bow rests on her left shoulder and on the leg openings. Pink satin ties are found on the back. Snaps are found at the bottom for ease of diapering. The matching pink hat has a pink satin ribbon on the front. Made from cotton. Hand wash cold, dry flat. |,|$79.00$|,||,|KATIE-ROSE-BABY-BREE-BLOOMER-DRESS|,|$URL$katie-rose-baby-bree-bloomer-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-baby-pink-bloomer-dress-bree-17.jpg||-||Katie Rose Baby Romper Ivory Ashley with Cap|,|Soft ivory cotton and lacey touches make up this new infant romper and cap set from designer Katie Rose. The bodice features shorter sleeves with elastic gathering and ivory lace edges. The waist is adorned by a wide satin ribbon that ties in the back and offers small floral and lace designs on the front. Full snaps and quaint satin bows finish off this adorable piece. Accompanied by a matching cap. 100% cotton, hand wash and lay flat to dry. |,|$72.00$|,||,|KATIE-ROSE-BABY-ROMPER-IVORY-ASHLEY-CAP|,|$URL$katie-rose-baby-romper-ivory-ashley-cap.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-baby-romper-ivory-ashley-with-cap-15.jpg||-||Katie Rose Baby Ruffle Socks in Pink and White|,|Katie Rose brings us a sweet little accessory for your new arrival, adorable ruffled socks. Made to match many of Katie Rose's designs, these pink little ruffle socks are just too cute. The embroidered white lace details hang from the cuff nearly hiding baby girl's little feet. Pink satin bows with soft tulle details adorn the top of the cuffs. Made from an oh-so-soft cotton to be soft and warm on her toes. |,|$21.00$|,||,|KATIE-ROSE-BABY-RUFFLE-SOCKS-PINK-WHITE|,|$URL$katie-rose-baby-ruffle-socks-pink-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-baby-ruffle-socks-in-pink-and-white-1.jpg||-||Katie Rose Cream Infant Romper with Hat (6 Mos)|,|^|Just precious, this baby girls romper is made by design Katie Rose. The bodice is dressed by large lace appliques on the empire waist and offers long sleeves for the cooler months. Sweet bow appliques are accented with faux pearls. A ribbon ties in a bow in back. The legs offer changing snaps that line the inseam and ruffled hem complimented with matching lace and a rosette bow. Matching hat included has another sweet bow. 100% cotton, hand wash with care. Lay flat to dry. ONE SIZE 6 MOS LEFT.  ^||,|$78.00$|,||,|KATIE-ROSE-PAYTON-CREAM-ROMPER-HAT|,|$URL$katie-rose-payton-cream-romper-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-cream-infant-romper-with-hat-12.jpg||-||Katie Rose Designer Infant Outfit in White|,|Such a classic style for baby, this new take me home outfit is from designer Katie Rose. In a bright white, the knit bodice features a kimono style wrap top with crocheted lace details running along the hems. The bodice of the top is adorned with a large lace and pearl applique and a sheer ribbon tied in a bow. The long sleeves will keep her nice and warm while the bloomer pants finish in an elastic ruffle embellished with a bow. A matching hat with crocheted lace detailing accompanies the gown. 100% cotton. Hand wash with care. Lay flat to dry. Made in the USA. |,|$79.00$|,||,|KATIE-ROSE-DESIGNER-INFANT-OUTFIT-WHITE|,|$URL$katie-rose-designer-infant-outfit-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-designer-infant-outfit-in-white-17.jpg||-||Katie Rose Designer Ivory Bloomer Dress with Lace|,|Infant designer Katie Rose brings us this classic style bloomer dress, which is sure to be fawned over. Made of oh so soft cotton to be smooth on baby's skin, this dress has all of the details. A large lace and ivory satin flower is the centerpiece of this dress with satin ribbons and a large pearl and rhinestone broach in the center. The long sleeves are finished in a sweet lace while a satin tie creates a bow in the back. The bloomer legs finish in an elastic ruffle adorned with bows and a line of changing snaps while the two layers of lace overlay falls from the empire waist down to the scalloped hem. A matching lace flower headband accompanies the dress. Made with 100% cotton. Hand wash with care. Made in the USA. |,|$92.00$|,||,|KATIE-ROSE-DESIGNER-IVORY-BLOOMER-DRESS-LACE|,|$URL$katie-rose-designer-ivory-bloomer-dress-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-designer-ivory-bloomer-dress-with-lace-1.jpg||-||Katie Rose Faith Ivory Infant Girls Bloomer Dress and Hat (Newborn)|,|^|A new arrival from designer Katie Rose, this Faith gown is elegant and soft. The ivory knit bodice offers long sleeves and a ribbon wiast adorned with small flowers on their stem and a satin tie in the back. A cinched ivory satin flower and bow sit just below her left shoulder and match the accents found on both legs of the bloomers. The line of snaps make changing easier while the tulle overlay skirt is embroidered with a darling design and finished with a scalloped hem to match the lace on her cuffs. Comes with matching hat. 100% cotton, hand wash only. NEWBORN ONLY REMAINING.  ^||,|$82.00$|,||,|KATIE-ROSE-FAITH-IVORY-INFANT-GIRLS-BLOOMER-DRESS-HAT|,|$URL$katie-rose-faith-ivory-infant-girls-bloomer-dress-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-faith-ivory-infant-girls-bloomer-dress-and-hat-14.jpg||-||Katie Rose Fancy Baby Gown in White Lace|,|Prepared to add gorgeous charm to her memorable first moments, this fabulous baby girls gown comes from Katie Rose. The cotton bodice features a high waistline with a satin tie back bow. Short sleeves are puffy and finished with scalloped lace and cute bows. Fancy embroidery decorates the front. The long skirt falls down elegantly while lacy mesh falls in an overlay. 100% cotton. Hand wash with care and dry flat. |,|$141.00$|,||,|KATIE-ROSE-FANCY-BABY-GOWN-WHITE-LACE|,|$URL$katie-rose-fancy-baby-gown-white-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-fancy-baby-gown-in-white-lace-1.jpg||-||Katie Rose Fancy Layette Gown in White with Hat|,|Take her home in this beautiful new design from Katie Rose. The white bodice is adorned with a pink satin sash with intricate white crochet work over the top with a rosette off to one side. Cotton gown has an elastic hemline . Long sleeves and mesh overlay are embellished with delicate lace. Satin ribbon ties gown at the back. Comes with a matching hat with flower. 100% cotton. Hand wash cold, dry flat. |,|$87.00$|,||,|KATIE-ROSE-FANCY-LAYETTE-GOWN-HAT|,|$URL$katie-rose-fancy-layette-gown-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-fancy-layette-gown-in-white-with-hat-17.jpg||-||Katie Rose Heirloom Christening Gown for Baby Girls|,|Made of oh so soft cotton to be smooth on baby's skin, this Katie Rose christening gown has all of the luxurious details. A large lace and ivory fabric flower is the centerpiece of this dress with satin ribbons and a large pearl and rhinestone broach in the center. The long sleeves are finished in a sweet lace while a satin tie creates a bow in the back. The gorgeous ivory gown is covered with two layers of lace overlay falling from the empire waist down to the scalloped hem. A matching lace bonnet accompanies the gown. Made with 100% cotton. Hand wash with care. Made in the USA. |,|$139.00$|,||,|KATIE-ROSE-HEIRLOOM-CHRISTENING-GOWN-BABY-GIRLS|,|$URL$katie-rose-heirloom-christening-gown-baby-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-heirloom-christening-gown-for-baby-girls-17.jpg||-||Katie Rose Infant Bloomer Dress Ashley Cream|,|Beautiful and charming, this new arrival from Katie Rose is sure to be a hit at any baby shower. The creamy ivory bodice features short sleeves accented by scalloped lace while the wide satin ribbon ties in a bow around the waist and is adorned by lace and light pink flowers on the front. The bloomer skirt snaps for easy diaper changes and is finished by a matching satin bow on both legs. An embroidered mesh boasting of a floral designer overlays her legs while a matching hat caps off the look. 100% cotton, hand wash suggested. |,|$79.00$|,||,|KATIE-ROSE-INFANT-BLOOMER-DRESS-CREAM|,|$URL$katie-rose-infant-bloomer-dress-cream.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-infant-bloomer-dress-ashley-cream-13.jpg||-||Katie Rose Infant Bloomer Dress Ashley Pink (6 Mos)|,|^|Another sweet creation from designer Katie Rose, this Infant Bloomer Dress is a perfect take home outfit or baby shower gift! The soft 100% cotton bodice features short sleeves adorned with scalloped lace and an ivory satin waistband that is trimmed with lace and pink flowers and ties in a bow in the back. The bloomer styled skirt has a matching satin bow on both legs and a gorgeous embroidered overlay. Accompanied by a matching 100% cotton hat, hand wash suggested. SIZE 6 MOS ONLY LEFT.  ^||,|$79.00$|,||,|KATIE-ROSE-INFANT-BLOOMER-DRESS-PINK|,|$URL$katie-rose-infant-bloomer-dress-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-infant-bloomer-dress-ashley-pink-32.jpg||-||Katie Rose Infant Bloomer Dress in Ivory Abby |,|^|From Katie Rose, this darling infant bloomer dress is gorgeous in ivory. The long sleeve bodice helps to keep her warm in the chilly months and offers a classic neckline. A pink ribbon and quaint lace becomes the home of the large pink flower on her empire waist. A pink satin sash ties at the back. An ivory tulle overlay flows from the waist with lace accenting the hemline. Pink satin bows sit prettily above the leg openings with the easy to change snaps hidden on the inseam. The matching headband is of ivory lace and repeats the pink flower from the bodice. Made from cotton. Hand wash cold, dry flat. ONE SIZE 9 MOS LEFT. ^||,|$79.00$|,||,|KATIE-ROSE-INFANT-BLOOMER-DRESS-IVORY-ABBY|,|$URL$katie-rose-infant-bloomer-dress-ivory-abby.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-infant-bloomer-dress-in-ivory-abby-1.jpg||-||Katie Rose Infant Bloomer Dress with Lace Hollee|,|Such a beautiful design from Katie Rose, this infant bloomer dress is one to cherish. Made of oh so soft cotton to be smooth on baby's skin, this dress has all of the details. A large lace and beige flower is the centerpiece of this dress with satin ribbons and a large pearl and rhinestone broach in the center. The long sleeves are finished in a sweet lace while a satin tie creates a bow in the back. The bloomer legs finish in an elastic ruffle adorned with bows and a line of changing snaps while the two layers of lace overlay falls from the empire waist down to the scalloped hem. A matching lace flower headband accompanies the dress. Made with 100% cotton. Hand wash with care. Made in the USA. |,|$92.00$|,||,|KATIE-ROSE-INFANT-BLOOMER-DRESS-LACE-HOLLEE|,|$URL$katie-rose-infant-bloomer-dress-lace-hollee.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-infant-bloomer-dress-with-lace-hollee-1.jpg||-||Katie Rose Infant Girls Dress with Flower (Newborn & 3 Mos)|,|^|She will look as sweet as can be in this pretty infant girls dress by Katie Rose. A super soft cotton bodice will keep her comfortable all day long. Ric rac and satin ribbon adorn the cotton overlay bloomer style dress. The rear satin tie shines with a large pink fabric flower front and center. Easy on with snapped gusset. 100% cotton. Hand wash cold, dry flat. Made in the USA. SIZE NEWBORN AND 3 MONTH REMAIN. ^||,|$78.00$|,||,|KATIE-ROSE-INFANT-GIRLS-DRESS|,|$URL$katie-rose-infant-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-infant-girls-dress-with-flower-1.jpg||-||Katie Rose Infant Gown with Lace Skirt in White|,|Making any day special, this fabulous new infant gown comes from designer Katie Rose. The empire waist bodice boasts of 100% cotton, short puffy sleeves and a satin ribbon that ties around the waist. A embroidered design is found on the front accented with a sweet ribbon rosette. The long skirt offers two tiers of white tulle covered in an elegant floral lace embroidered design. The top tier is finished with a swooping scallop hem. Hand wash and lay flat to dry to keep this dress looking its best! |,|$86.00$|,||,|KATIE-ROSE-INFANT-DRESS-LACE-SKIRT-WHITE|,|$URL$katie-rose-infant-dress-lace-skirt-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-infant-dress-with-lace-skirt-in-white-20.jpg||-||Katie Rose Infant Lace Socks in Pink and Cream|,|These adorable baby socks come from designer Katie Rose in all of their ruffled beauty. Made to match many of Katie Rose's designs, these pink little ruffle socks are just too cute. The embroidered cream lace details hang from the cuff nearly hiding baby girl's little feet. Cream satin bows with soft tulle details adorn the top of the cuffs. Made from an oh-so-soft cotton to be soft and warm on her toes. |,|$21.00$|,||,|KATIE-ROSE-INFANT-LACE-SOCKS-PINK-CREAM|,|$URL$katie-rose-infant-lace-socks-pink-cream.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-infant-lace-socks-in-pink-and-cream-1.jpg||-||Katie Rose Infant Pink Dress with Lace and Legging|,|New from popular infant designer Katie Rose, this new baby girls dress is sure to look fabulous this spring! The sleeveless bodice is a crisp white in soft cotton. A satin ribbon is tied in a bow around her waist while the front is decorated with light pink flowers. The skirt has a pink damask print and a full circle shape. Peeking out from beneath the scallop hemline is a touch of embroidered lace in white. Solid white leggings are paired beneath, boasting only of the single bell hem on both legs. Made with 100% cotton, exclusive of decorations. Hand wash both pieces with care and lay flat to dry. |,|$49.00$|,||,|KATIE-ROSE-INFANT-PINK-DRESS-WITH-LACE-AND-LEGGING|,|$URL$katie-rose-infant-pink-dress-with-lace-and-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-infant-pink-dress-with-lace-and-legging-1.jpg||-||Katie Rose Infant Silk Dress with Pant in Ivory|,|A beautiful creation from Katie Rose for your little one, this vintage inspired dress is simply irresistible. The bodice of ivory cotton boasts of long sleeves with lace trim at the edges. At the waist is a large lacey flower with a pearl and rhinestone broach in the center. Satin ribbons reach around the back to finish off in a bow. An overlay of silk with abstract threaded details is finished off with an underlay of embroidered lace. The matching pants have an elastic waistband and are adorned with matching ivory satin bows just above the hem ruffle. The headband is adorned with a matching lace flower. 100% Cotton pants and top of dress. Overlay is 100% silk. Dry clean only. |,|$109.00$|,||,|KATIE-ROSE-INFANT-SILK-DRESS-PANT-IVORY|,|$URL$katie-rose-infant-silk-dress-pant-ivory.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-infant-silk-dress-with-pant-in-ivory-1.jpg||-||Katie Rose Infant Take Home Outfit White Ashley Romper ( 6 Mos )|,|^|Elegant and quaint, this new infant take home outfit from designer Katie Rose is fit for your new princess. The white romper boasts of an empire waist, short sleeves accented with scalloped lace, and a white satin ribbon around her waist tying in the back. The legs offer a line of snaps for easy changing and are adorned by a small bow on each leg. Accompanied by a matching hat featuring only a satin bow with a flower center. SIZE 6 MOS ONLY LEFT. ^||,|$74.00$|,||,|KATIE-ROSE-INFANT-TAKE-HOME-OUTFIT-ASHLEY|,|$URL$katie-rose-infant-take-home-outfit-ashley.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-infant-take-home-outfit-white-ashley-romper-11.jpg||-||Katie Rose Infant White Lace Dress Jillian with Cap|,|Made from 100% soft cotton, this new infant dress from Katie Rose is sure to please. Perfect for a take me home outfit, this dress features three small satin rosettes set upon the bodice with a lacey background, short sleeves edged in lace, and a ribbon that ties around the waist. Underneath the embroidered floral skirt, the romper offers full snaps and a satin bow on both legs. Accompanied with a matching white cap. Hand wash and lay flat to dry. |,|$79.00$|,||,|KATIE-ROSE-INFANT-WHITE-LACE-DRESS-JILLIAN-CAP|,|$URL$katie-rose-infant-white-lace-dress-jillian-cap.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-infant-white-lace-dress-jillian-with-cap-13.jpg||-||Katie Rose Ivory Baby Blanket for Girls with Lace|,|Whether you are welcoming your sweet new love to the world or simply want show your love again and again, this darling Katie Rose baby blanket is sure to become a cherished possession. The ivory blanket is made from 100% cotton and boasts of the soft touch to her delicate skin. A single corner is embellished by lacy embroidering and quaint ribbon rosettes. Tiny lace flowers come together to create the beautiful hem. Wash with care. |,|$59.00$|,||,|KATIE-ROSE-IVORY-BABY-BLANKET-GIRLS-LACE|,|$URL$katie-rose-ivory-baby-blanket-girls-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-ivory-baby-blanket-for-girls-with-lace-12.jpg||-||Katie Rose Ivory Baby Bloomer Dress with Flowers|,|New from infant designer Katie Rose, this bloomer dress is just darling. In a soft ivory, the knit bodice features an empire waist adorned with floral stitched ribbon and a large satin flower embellishment with a small broach inside. The long sleeves are finished in a sweet lace while a satin tie creates a bow in the back. The bloomer legs finish in an elastic ruffle adorned with bows and a line of changing snaps while the two layers of lace overlay falls from the empire waist down to the scalloped hem. A matching satin flower headband accompanies the gown. Made with 100% cotton. Hand wash with care. Made in the USA. |,|$89.00$|,||,|KATIE-ROSE-IVORY-BABY-BLOOMER-DRESS-FLOWERS|,|$URL$katie-rose-ivory-baby-bloomer-dress-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-ivory-baby-bloomer-dress-with-flowers-16.jpg||-||Katie Rose Ivory Baby Girls Dress|,|A true doll, this new fabulous dress from designer Katie Rose is unbelievably beautiful. The soft ivory shade is found throughout the dress and is elegant. The bodice boasts of a sleeveless neckline and an empire waist. The ivory satin belt ties into a bow on her back while a row of pink and ivory flowers accent the front. The tulle skirt is layered and cut in a full circle shape to add volume and grace. A matching satin ribbon is wrapped around the hemline to tie the piece together. This gorgeous baby gown is perfect for spring or summer and looks lovely at weddings, birthdays, in photographs, and on her first day home from the hospital! 100% cotton. Hand wash and dry flat. |,|$39.00$|,||,|KATIE-ROSE-IVORY-BABY-GIRLS-DRESS|,|$URL$katie-rose-ivory-baby-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-ivory-baby-girls-dress-1.jpg||-||Katie Rose Ivory Lace Baby Girls Dress|,|Designed by Katie Rose, this sweet infant bloomer dress is sure to make a lasting memory. The empire bodice is a soft ivory shade and features puffy short with lace embellished cuffs. The satin ribbon waist ties in a bow on her back and is accented with sweet, quaint flowers. The bloomer pants are comfortable on her delicate skin and offer classic changing snaps. A gorgeous lace skirt falls from the lace and is finished with he same scallop found on the hem. 100% cotton, excluding trim. Hand wash and dry flat. Accompanied by a matching lace headband adorned only by a quaint bow. |,|$79.00$|,||,|KATIE-ROSE-IVORY-LACE-BABY-GIRLS-GOWN|,|$URL$katie-rose-ivory-lace-baby-girls-gown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-ivory-lace-baby-girls-gown-1.jpg||-||Katie Rose Ivory Lace Infant Gown with Hat|,|Designed by Katie Rose, this new infant gown is a stunning choice for a baby's Christening gown. Made in the USA, this gown offers an empire waist bodice completed with lace cuffs on her long sleeves. The waist is embellished with an embroidered lace and small rosettes, all placed upon the thin satin ribbon. The skirt is elegantly long and features an embroidered lace overlay complete with the timeless look of a scallop hemline. The lining underneath finishes with an elastic hemline to help keep her little legs bundled! In 100% cotton excluding decorations. The waist ties in a bow on the back. Hand wash with care and allow to hang dry. Breathtaking! |,|$110.00$|,||,|KATIE-ROSE-CHRISTIE-IVORY-LACE-GOWN-BONNET|,|$URL$katie-rose-christie-ivory-lace-gown-bonnet.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-ivory-lace-infant-gown-with-hat-11.jpg||-||Katie Rose Lace Socks for Baby in White|,|An adorable pair of ruffled socks is just what baby needs, and these come from Katie Rose. Made to match many of Katie Rose's designs, these white little ruffle socks are just too cute. The embroidered white lace details hang from the cuff nearly hiding baby girl's little feet. White satin bows with soft tulle details adorn the top of the cuffs. Made from an oh-so-soft cotton to be soft and warm on her toes. |,|$21.00$|,||,|KATIE-ROSE-LACE-SOCKS-FOR-BABY-WHITE|,|$URL$katie-rose-lace-socks-for-baby-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-lace-socks-for-baby-in-white-1.jpg||-||Katie Rose Leila Infant Girls Bloomer Dress and Hat|,|New from well love infant designer, Katie Rose, this bloomer dress is too adorable! The pink cotton knit bodice offers long sleeves and a satin waist that ties in the back. The bodice is also adorned with lace in the front to add a special and unique touch to the piece. The bloomers are hemmed with an elastic ruffles and offer classic changing snaps to make mom's life a bit easier. The skirt is created with the sweet overlay of tulle accented with a touch of lace that matches the bodice perfectly and an elegant scallop hemline. Paired with a roll brim hat adorned with a satin bow. Machine washable. 100% cotton. |,|$79.00$|,||,|KATIE-ROSE-LEILA-INFANT-GIRLS-BLOOMER-DRESS-HAT|,|$URL$katie-rose-leila-infant-girls-bloomer-dress-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-leila-infant-girls-bloomer-dress-and-hat-32.jpg||-||Katie Rose Lilac Newborn Take Me Home Outfit with Hat (6 Mos)|,|^|One of the most popular pieces designed by Katie Rose, this fabulous infant outfit looks beautiful in her newborn photos! The cotton fabric was selected with her delicate skin in mind. The top offers a wrap style secured with snaps while a ribbon of lace edges the fabric and is also found on the cuffs. A single sweet bow is also found on the top. The matching bottoms also feature ribbons, rosettes and lace trim. A matching hat accompanies the piece to finish the look off from head to toe. 100% cotton excluding decorations. Hand wash with care. ONE 6 MOS ONLY LEFT.  ^||,|$59.00$|,||,|KATIE-ROSE-LILAC-TAKE-ME-HOME-OUTFIT|,|http://www.labellaflorachildrensboutique.com/katie-rose-lilac-take-me-home-outfit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-lilac-newborn-take-me-home-outfit-with-hat-11.jpg||-||Katie Rose Luxury Baby Blanket for Girls with Lace|,|Matching the beautiful heirloom christening gown and bonnet set, this luxurious baby blanket is from Katie Rose. A beautiful ivory color and oh so soft cotton are what this blanket is designed with. The large lace flower and trim detailing mimicks those that are on the other pieces in the collection. A beautiful pearl and rhinestone brooch is the centerpiece of these details. Made with 100% cotton. Hand wash with care. Made in the USA. This blanket measures 34 inches long and 25 inches wide. |,|$62.00$|,||,|KATIE-ROSE-LUXURY-BABY-BLANKET-GIRLS-LACE|,|$URL$katie-rose-luxury-baby-blanket-girls-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-luxury-baby-blanket-for-girls-with-lace-1.jpg||-||Katie Rose Newborn Take Home Gown for Girls Pink Leila|,|^|Another fabulous and elegant design by Katie Rose, this baby girls' take home gown will help celebrate her debut. The pink bodice is made with 100% cotton and boasts of lace trimmed cuffs and a Lelia lace design adorning the waist. A thin satin ribbon ties in a bow at the back of her waist while the skirt is finished with an elastic hem. The mesh overlay is embroidered with sweet flowers and finishes in a scallop hem. Accompanied by a matching lined bonnet. Hand wash with care. SIZE NEWBORN AND 3 MOS ONLY LEFT.  ^||,|$99.00$|,||,|KATIE-ROSE-NEWBORN-TAKE-HOME-GOWN-BONNET-PINK-LELIA|,|$URL$katie-rose-newborn-take-home-gown-bonnet-pink-lelia.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-newborn-take-home-gown-for-girls-pink-leila-14.jpg||-||Katie Rose Pink Baby Blanket with White Lace Detail|,|^|She can never have too many soft blankets! New from Katie Rose, this pale pink baby blanket is made from 100% cotton and is made in the USA. The simple blanket features with flower lace trimming all around and one corner detailed with lace and a white satin bow. Roughly 36"" X 26"". ^||,|$59.00$|,||,|KATIE-ROSE-PINK-WHITE-LACE-BLANKET|,|$URL$katie-rose-pink-white-lace-blanket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-pink-baby-blanket-with-white-lace-detail-11.jpg||-||Katie Rose Pink Baby Girl Romper and Hat|,|Bring your sweet baby girl home from the hospital in this adorable pink romper and matching hat. This darling outfit is made of soft knit cotton in the USA by designer Katie Rose. Lace and ribbons adorn the wrists and ankles. Beautiful detailing delights the empire waist with lace, ribbons, and pearl centered rosettes. An elegant ribbon bow ties in the back of this adorable romper. Matching hat features the same accents and completes this stunning look. This item is hand washable only. |,|$78.00$|,||,|KATIE-ROSE-PINK-ROMPER|,|$URL$katie-rose-pink-romper.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-pink-baby-girl-romper-and-hat-25.jpg||-||Katie Rose Pink Bloomer Dress for Baby Girls in Long Sleeve|,|How stunning is this adorable infant bloomer dress by the fabulous infant designer, Katie Rose? The soft pink cotton bodice has long sleeves to help keep her warm and cozy on her first ride home. The elegant pink tulle skirt flows from the empire waist. The tulle is adorned with a ribbon of flowers and leaves. Waist is tied with a simple pink satin bow in the back. Snaps line the inseam for an easy change. The adorable infant hat will keep baby warm. Made from 100% cotton. Hand wash cold, dry flat. |,|$79.00$|,||,|KATIE-ROSE-PINK-BLOOMER-DRESS-BABY-GIRLS-LONG-SLEEVE|,|$URL$katie-rose-pink-bloomer-dress-baby-girls-long-sleeve.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-pink-bloomer-dress-for-baby-girls-in-long-sleeve-2.jpg||-||Katie Rose Pink Cotton Girls Blanket Ivory Trim|,|^|Bordered all around with sweet IVORY lace, this baby blanket by Katie Rose is made of 2 layers of soft knit cotton. A bow with a rosette trims one corner. About 36"" by 26 "". Hand washable. A great baby girl gift. ^||,|$56.00$|,||,|KATIE-ROSE-PINK-COTTON-BLANKET|,|http://www.labellaflorachildrensboutique.com/katie-rose-pink-cotton-blanket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-pink-cotton-girls-blanket-ivory-trim-25.jpg||-||Katie Rose Pink Eyelet Infant Dress and Legging|,|An adorable new spring arrival, this fabulous baby girls dress from designer Katie Rose is one you cannot resist. The empire bodice offers her a soft cotton that allows slight stretch in its fit. The sleeveless cut welcomes the warm sunshine while a wide pink satin ribbon ties around the waist decorated with a large flower. The skirt features a light pink fabric that boasts of a white layer just beneath. The hem is cut in a scallop shape with an eyelet design. Matching leggings are paired beneath with a bow dressing the bell hem. 100% cotton. Hand wash cold, lay flat to dry. |,|$49.00$|,||,|KATIE-ROSE-PINK-EYELET-INFANT-DRESS-LEGGING|,|$URL$katie-rose-pink-eyelet-infant-dress-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-pink-eyelet-infant-dress-and-legging-1.jpg||-||Katie Rose Pink Lace Infant Dress Ashley|,|With long sleeves to fend off the chilly air, this new baby girls dress comes from the sweet Katie Rose. The light baby pink is complimented with ivory scalloped trimmings found on the cuffs and framing the satin waist. The waist ties in a bow at her back while the bloomer bottoms boast of the lace skirt overlay. Accompanied with a matching hat, made with 100% cotton, hand wash for best results. |,|$79.00$|,||,|KATIE-ROSE-PINK-LACE-INFANT-DRESS-ASHLEY|,|$URL$katie-rose-pink-lace-infant-dress-ashley.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-pink-lace-infant-dress-ashley-32.jpg||-||Katie Rose Pink Lace Infant Gown with Bonnet|,|Brought to us by infant designer Katie Rose, this gorgeously detailed baby gown is truly timeless. The long sleeved bodice is made from 100% cotton to be smooth on baby's skin. Tiny lace details surround the wrists while the empire waist is accented with a satin ribbon and a cluster of ribbon rosettes. A layer of embroidered lace covers the gown and gathers at the bottom with another satin ribbon and rosette detail sitting off center. The inside of the gown is lined to create a wipable surface for easy diaper cleanups. A matching bonnet completes the look. 100% Cotton. Hand wash in cold water. Hang or lay flat to dry. Made in the USA. |,|$92.00$|,||,|KATIE-ROSE-PINK-LACE-INFANT-GOWN-BONNET|,|$URL$katie-rose-pink-lace-infant-gown-bonnet.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-pink-lace-infant-gown-with-bonnet-11.jpg||-||Katie Rose Pink Leila Lace Baby Romper with Bonnet|,|^|Another beautiful creation from Katie Rose, this baby romper in pink comes with a delightful matching bonnet. The soft pink romper boasts of short gathered sleeves and a lace applique on the bodice. Small pink flowers with beaded pearl centers bloom on the lace applique and on the legs. Lace accents are also found on the sleeves and leg openings. Satin ties finish the back. Snaps are located at the bottom. The matching bonnet is lined in pink and has a lovely overlay of lace, as well as lace trim around her face. The bonnet ties with ribbons under her chin and gathers at the back with another ribbon. 100% cotton. Hand wash cold, lay flat to dry. ONE SIZE 9MOS LEFT.  ^||,|$86.00$|,||,|KATIE-ROSE-PINK-LEILA-LACE-BABY-ROMPER-BONNET|,|$URL$katie-rose-pink-leila-lace-baby-romper-bonnet.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-pink-leila-lace-baby-romper-with-bonnet-32.jpg||-||Katie Rose Pink Newborn Take Me Home Outfit|,|Designed by the loved Katie Rose, this baby girls outfit is one of our top sellers! The wrap style top is made from 100% cotton and is embellished with sweet lace. The front is secured with a snap and is dressed with a single satin bow. Matching pink cotton pants are worn beneath finished with an elastic hem and offering the same great comfort in fit. A single ribbon rosette is found on each leg. The outfit comes with a sweet matching hat! Hand wash all pieces with care and lay flat to dry. |,|$77.00$|,||,|KATIE-ROSE-PINK-NEWBORN-OUTFIT|,|http://www.labellaflorachildrensboutique.com/katie-rose-pink-newborn-outfit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-pink-newborn-take-me-home-outfit-32.jpg||-||Katie Rose Pure White Baby Blanket with Lace|,|^|Made to match several different Katie Rose outfits, this new white blanket is simplistic and beautiful! The 36"" X 26"" blanket features white flower lace trimmings around its edges and a single corner adorned with lace and a small white satin bow. ^||,|$59.00$|,||,|KATIE-ROSE-PURE-WHITE-BABY-BLANKET-LACE|,|$URL$katie-rose-pure-white-baby-blanket-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-pure-white-baby-blanket-with-lace-12.jpg||-||Katie Rose Sara Bloomer Dress with Hat in White ( 6 Mos )|,|^|A beautiful creation from Katie Rose for your little one, this baby doll bloomer dress is simply irresistable. The bodice of white cotton boasts of long sleeves with lace trim at the edges. At the waist is a white lace applique flanked by two white satin bows. Satin strings reach around the back to finish off in a bow. An overlay of mesh in a satiny rose pattern is a masterpiece. The bloomers underneath the overlay have elastic at the ankles and are adorned with matching white satin bows just above the hem ruffle. Snaps on the bloomers make for ease of diapering. The matching hat is adorned with a satin bow on the flap. Made from 100% cotton, exclusive of overlay. Hand wash cold, dry flat. ONE SIZE 6 MONTH REMAINS. ^||,|$86.00$|,||,|KATIE-ROSE-BABY-DOLL-SARA-BLOOMER-DRESS-HAT|,|$URL$katie-rose-baby-doll-sara-bloomer-dress-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-baby-doll-sara-bloomer-dress-with-hat-14.jpg||-||Katie Rose Sleeveless Pink Romper for Baby Girls (Newborn & 9 Mos)|,|^|New from Katie Rose, this sweet romper dresses your young daughter with beauty. The sleeveless bodice boasts of the white embroidering that accents the waist as a white satin bow ties in the back. The legs fall in the same sweet light pink and finish with an elastic ruffle hem completed with lace and bows. The legs offer mom classic changing snaps. A matching lace headband also comes with the romper. Made with 100% cotton for her delicate skin. Hand wash and lay flat to dry. SIZE NEWBORN AND 9 MOS ON LEFT. ^||,|$49.00$|,||,|KATIE-ROSE-SLEEVELESS-PINK-ROMPER-BABY-GIRLS|,|$URL$katie-rose-sleeveless-pink-romper-baby-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-sleeveless-pink-romper-for-baby-girls-1.jpg||-||Katie Rose Sophia Lace White Christening Gown for Baby Girls|,|Gorgeous with every small detail, this new girls christening gown comes from designer Katie Rose. The white knit bodice boasts of its gathered short sleeves ending with a wide lace trim to match her accented waist that ties in a bow on her back. Embroidered mesh falls with grace over the skirt, gaining a more intricate design as you reach the scallop hemline. A matching bonnet accompanies the beautiful dress. Made with 100% cotton. Hand wash and lay flat to dry. |,|$141.00$|,||,|KATIE-ROSE-SOPHIA-LACE-WHITE-CHRISTENING-GOWN-BABY-GIRLS|,|$URL$katie-rose-sophia-lace-white-christening-gown-baby-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-sophia-lace-white-christening-gown-for-baby-girls-14.jpg||-||Katie Rose Take Me Home Outfit Vintage Lace|,|Designed by the loved Katie Rose, this baby girls outfit is always a top seller. The wrap style top is made from 100% cotton and is embellished with soft cream lace. The kimono style top is secured with a snap and is dressed with a single lace flower. Matching cream cotton pants are worn beneath finished with an elastic hem and offering the same great comfort in fit. A single satin bow is found on each leg atop the lace ruffle. This take me home outfit comes with an adorable matching hat! Hand wash all pieces with care and lay flat to dry. Made with 100% cotton. Made in the USA. |,|$84.00$|,||,|KATIE-ROSE-TAKE-ME-HOME-OUTFIT-VINTAGE-LACE|,|$URL$katie-rose-take-me-home-outfit-vintage-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-take-me-home-outfit-vintage-lace-18.jpg||-||Katie Rose White Baby Dress Special Occasion|,|New from designer Katie Rose, this baby bloomer dress is simply breathtaking. The cotton bodice is adorned with light pink ribbon with a delicate crochet overlay and matching rosette slightly off center. Soft, white tulle flows over the top of the bloomers with matching accent crochet-work and accent ribbons on each leg. A pink ribbon sash ties at the back. Hidden snap closures between the legs. The matching white lace headband with over-sized flower tops of this dress nicely. 100% cotton. Hand wash cold, dry flat. |,|$86.00$|,||,|KATIE-ROSE-WHITE-BABY-DRESS-SPECIAL-OCCASION|,|$URL$katie-rose-white-baby-dress-special-occasion.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-white-baby-dress-special-occasion-14.jpg||-||Katie Rose White Lace Infant Gown and Bonnet|,|^|Pure white elegance, this gorgeous infant gown is now offered from designer Katie Rose. Soft white cotton is adorned with lace embellishments on the empire bodice. The satin waist ties in a bow on the back and we also find sweet rosettes on the front. The outstanding embroidered lace skirt is finished with a scallop hem and fully lined. The lining is finished with an elastic hemline to help keep her little feet bundled. The gown comes with an accompanying sheer lace bonnet that is tied to secure the fit. This white baby girls gown is perfect for her christening or newborn photos! 100% cotton. Hand wash delicately and lay flat to dry. SIZE 3 MOS ONLY LEFT.  ^||,|$99.00$|,||,|KATIE-ROSE-WHITE-LACE-INFANT-GOWN-HAT|,|$URL$katie-rose-white-lace-infant-gown-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-white-lace-infant-gown-and-bonnet-14.jpg||-||Katie Rose White Rose Bud Infant Dress (Size 6 Mos & 9 Mos)|,|^|A precious new baby girls dress sure to dazzle, this new arrival from designer Katie Rose is a real dream. The empire bodice boasts of puffy short sleeves finished with embroidered roses on the cuff. The pink ribbon waist is tied in a bow on her back and adorned with sweet flowers on the front. The white skirt is layered in white tulle with a matching rose bud hem. This gorgeous piece is accompanied by a matching headband. 100% cotton. Hand wash and dry flat. SIZE 6 MOS & 9 MOS ONLY LEFT. ^||,|$72.00$|,||,|KATIE-ROSE-WHITE-ROSE-BUD-INFANT-DRESS|,|$URL$katie-rose-white-rose-bud-infant-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-white-rose-bud-infant-dress-2.jpg||-||Keep It Gypsy Backpack for Girls in Teal Chevron|,|This Keep It Gypsy girls designer backpack will make a statement wherever she goes. The front flap is adorned with a bright teal silk flower and has tassel details peeking through the hem. The drawstring interior is covered in a blue gingham while the sides and back are made of a soft fuchsia fabric. The front flap is detailed with a bold teal modern chevron print, while under the flap is a pink subdued zebra print. The bottom of the bag and loop up top are made out of a chenille houndstooth. The pink polka dot straps are easily adjustable to any size. |,|$86.00$|,||,|KEEP-IT-GYPSY-BACKPACK-GIRLS-TEAL-CHEVRON|,|$URL$keep-it-gypsy-backpack-girls-teal-chevron.html|,|http://ep.yimg.com/ay/yhst-17102259411242/keep-it-gypsy-backpack-for-girls-in-teal-chevron-1.jpg||-||Keep It Gypsy Birdie Girls Diaper Bag|,|Designed like a messenger bag, this diaper bag from Keep it Gypsy is the perfect size for a short trip. A large flap snaps in the front and is covered with tassle trim and a large orange rosette. Light pink and brown stripe down the front and cover the entire interior. Four large side pockets are found on the inside while the scoop pockets on the outside are made with a green houndstooth print. The back blends different polka dots together to create a long pocket for more storage. The shoulder strap is covered with a brown zebra print. |,|$189.00$|,||,|KEEP-IT-GYPSY-BIRDIE-GIRLS-DIAPER-BAG|,|$URL$keep-it-gypsy-birdie-girls-diaper-bag.html|,|http://ep.yimg.com/ay/yhst-17102259411242/keep-it-gypsy-birdie-girls-diaper-bag-1.jpg||-||Keep It Gypsy Boutique Diaper Bag in Sherbet Teal|,|This designer diaper bag comes from Keep it Gypsy in all of it's fun patterned glory. A soft tassel trim runs around the front of the bag while the sherbet orange front (and back) is textured with a padded floral print. A large teal rosette adorns the front. Bright teal swirls are found on the sides and bottom, while the inside is covered in a plastic coated cute heart print to keep it easy to clean. Two large inner pockets as well as one large zippered pocket in a light blue gingham help keep everything organized. |,|$189.00$|,||,|KEEP-IT-GYPSY-BOUTIQUE-DIAPER-BAG-SHERBET-TEAL|,|$URL$keep-it-gypsy-boutique-diaper-bag-sherbet-teal.html|,|http://ep.yimg.com/ay/yhst-17102259411242/keep-it-gypsy-boutique-diaper-bag-in-sherbet-teal-1.jpg||-||Keep It Gypsy Designer Girls Backpack|,|Complimenting Mom's designer diaper bag, this girls drawstring backpack is from Keep It Gypsy. The front flap is adorned with a dazzling fuchsia flower and has tassel details peeking through the hem. The drawstring interior is covered in cutesy colored hearts while the sides and back are made of a fuchsia burlap. The front flap and bottom of the backpack are detailed with a bold orange modern floral print. The straps are easily adjustable to any size. |,|$86.00$|,||,|KEEP-IT-GYPSY-DESIGNER-GIRLS-BACKPACK|,|$URL$keep-it-gypsy-designer-girls-backpack.html|,|http://ep.yimg.com/ay/yhst-17102259411242/keep-it-gypsy-designer-girls-backpack-1.jpg||-||Keep It Gypsy Designer Girls Backpack in Pink Floral|,|This girls boutique backpack from Keep It Gypsy will surely be her favorite! The front flap is adorned with a satin teal flower and has tassel details peeking through the hem. The drawstring interior is covered in a lime green gingham while the sides and back are made of a soft fuchsia fabric. The front flap is detailed with a bold modern floral print, while under the flap and around the bottom of the bag are modern pink geometric prints. The orange polka dot straps are easily adjustable to any size. |,|$86.00$|,||,|KEEP-IT-GYPSY-DESIGNER-GIRLS-BACKPACK-PINK-FLORAL|,|$URL$keep-it-gypsy-designer-girls-backpack-pink-floral.html|,|http://ep.yimg.com/ay/yhst-17102259411242/keep-it-gypsy-designer-girls-backpack-in-pink-floral-1.jpg||-||Keep It Gypsy Designer Messenger Diaper Bag|,|Designed from the heart, this messenger diaper bag from Keep it Gypsy is the perfect size for everyday. A large flap snaps in the front and is covered with tassel trim and a large fuchsia rosette. The front flap is covered in a multi paisley print with a pink and white damask underneath. The inside is covered in a subdued green floral print with plastic coating to make it easy to keep clean. Four large side pockets are found on the inside while the scoop pockets on the outside are made with a multi colored floral print. The back shows the same pink damask print as well as a pink leopard print forming two large pockets for more storage. The shoulder strap and bottom is covered with a chenille houndstooth print. |,|$189.00$|,||,|KEEP-IT-GYPSY-DESIGNER-MESSENGER-DIAPER-BAG|,|$URL$keep-it-gypsy-designer-messenger-diaper-bag.html|,|http://ep.yimg.com/ay/yhst-17102259411242/keep-it-gypsy-designer-messenger-diaper-bag-1.jpg||-||Keep It Gypsy Designer Women's Backpack in Soft Lavender|,|Filled with so many different colors, this new designer back pack comes from Keep It Gypsy. The front has a large brown and cream zebra print that is adorned by an oversize lavender rosette. The modern green and fuchsia damask print separates the front zipper pocket and features a large tassel zipper pull. The adjustable straps are a fun sage green chenille striped print. The inside is lined with durable denim. |,|$189.00$|,||,|KEEP-IT-GYPSY-DESIGNER-WOMENS-BACKPACK-SOFT-LAVENDER|,|$URL$keep-it-gypsy-designer-womens-backpack-soft-lavender.html|,|http://ep.yimg.com/ay/yhst-17102259411242/keep-it-gypsy-designer-women-s-backpack-in-soft-lavender-1.jpg||-||Keep It Gypsy Girls Backpack in Pink Leopard|,|This Keep It Gypsy girls designer backpack is truly one of a kind. The front flap is adorned with a dazzling fuchsia flower and has tassel details peeking through the hem. The drawstring interior is covered in a blue gingham while the sides and back are made of an orange diamond stitched print. The front flap is detailed with a bold orange modern floral print, while under the flap is a pink subdued leopard print. The bottom of the bag and loop up top are made out of a chenille houndstooth. The straps are easily adjustable to any size. |,|$86.00$|,||,|KEEP-IT-GYPSY-GIRLS-BACKPACK-PINK-LEOPARD|,|$URL$keep-it-gypsy-girls-backpack-pink-leopard.html|,|http://ep.yimg.com/ay/yhst-17102259411242/keep-it-gypsy-girls-backpack-in-pink-leopard-1.jpg||-||Keep It Gypsy Girls Couture Backpack in Earth Tone|,|This Keep It Gypsy girls couture backpack will stay beautiful for years to come. The front flap is adorned with a dazzling fuchsia flower and has tassel details peeking through the hem. The drawstring interior is covered in a lime green gingham while the sides and back are made of a soft fuchsia fabric. The front flap is detailed with a earth toned modern damask print, while under the flap is a cream and brown soft large zebra print. The bottom of the bag and loop up top are made out of a subdued teal and green floral print. The orange and pink straps are easily adjustable to any size. |,|$86.00$|,||,|KEEP-IT-GYPSY-GIRLS-COUTURE-BACKPACK-EARTH-TONE|,|$URL$keep-it-gypsy-girls-couture-backpack-earth-tone.html|,|http://ep.yimg.com/ay/yhst-17102259411242/keep-it-gypsy-girls-couture-backpack-in-earth-tone-1.jpg||-||Keep It Gypsy Lavender Chenille Diaper Bag|,|Helping mom tote all of the things needed for her darling baby, this designer diaper bag comes from Keep it Gypsy. A fun tassle trim runs around the top of the bag while the lilac front is textured with a short chenille yarn. Bright modern prints are found on the sides creating large pockets. Lime and pink blend on the back in a large giraffe print. Chevron stripes race across the shoulder straps while a bright lime interior is covered with magenta spots. Four large inner pockets help keep everything organized. |,|$189.00$|,||,|KEEP-IT-GYPSY-LAVENDER-CHENILLE-DIAPER-BAG|,|$URL$keep-it-gypsy-lavender-chenille-diaper-bag.html|,|http://ep.yimg.com/ay/yhst-17102259411242/keep-it-gypsy-lavender-chenille-diaper-bag-1.jpg||-||Keep It Gypsy Turquoise and Goldenrod Diaper Bag|,|Hand made with care and style, Keep it Gypsy is now offering this fun designer diaper bag. The large bag features a fun lime, aqua, purple, and pink pattern that stands out on the front. The fun frolicing fringe dangles from the top of the back accented with a single oversized flower. Lime polka dots cover the large side pockets while the back stands out in sunshine yellow. A cool turquoise is textured with a subtle floral and frill print to create both the bottom and the straps. Fun stripes line the inside of the back which hosts four large pockets. |,|$189.00$|,||,|KEEP-IT-GYPSY-TURQUOISE-AND-GOLDENROD-DIAPER-BAG|,|$URL$keep-it-gypsy-turquoise-and-goldenrod-diaper-bag.html|,|http://ep.yimg.com/ay/yhst-17102259411242/keep-it-gypsy-turquoise-and-goldenrod-diaper-bag-1.jpg||-||Keep It Gypsy Unique Women's Backpack in Pink Leopard|,|Keep It Gypsy brings us this beautiful designer women's backpack to make a statement. The front has a soft subdued leopard print that is adorned by an oversize fuchsia rosette. The modern multi colored floral print separates the front zipper pocket and features a large tassel zipper pull. The adjustable straps are a chenille houndstooth print with orange accents. The inside is lined with durable denim. |,|$189.00$|,||,|KEEP-IT-GYPSY-UNIQUE-WOMENS-BACKPACK-PINK-LEOPARD|,|$URL$keep-it-gypsy-unique-womens-backpack-pink-leopard.html|,|http://ep.yimg.com/ay/yhst-17102259411242/keep-it-gypsy-unique-women-s-backpack-in-pink-leopard-1.jpg||-||Kensie Girl Shoes Back to School Boot in Black|,|An ankle boot perfect for the coming school year, this new arrival was designed by Kensie Girl Shoes. The fabulous boots are a solid black leather with white, contrast pick stitching. The boots are fit with a zipper on the inner side and a pull loop at the back of the cuff. The laces that run up the front are used for added style while wrapped with two straps. These black straps fasten on the outer side of the boot with a golden clasp. |,|$39.00$|,||,|KENSIE-GIRL-SHOES-BACK-TO-SCHOOL-BOOT-BLACK|,|$URL$kensie-girl-shoes-back-to-school-boot-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kensie-girl-shoes-back-to-school-boot-in-black-2.jpg||-||KicKee Pant Footed Romper in Flamingo Pink - Newborn|,|^|Matching several of the new arrivals from designer KicKee Pants, this baby romper is sure to be loved. The fabric is soft on her delicate skin while the flamingo pink is a unique shade that stands apart from the rest. Her long sleeves offer flip paw cuffs that protect from accidental scratches. A row of snaps fasten in the front and are followed by a single light pink ruffle. Matching blankets are available to create a one of a kind baby gift. Made with viscose blend. Machine wash cold, tumble dry low. (2) NEWBORN LEFT.  ^||,|$29.00$|,||,|KICKEE-PANT-FOOTED-ROMPER-IN-FLAMINGO-PINK|,|$URL$kickee-pant-footed-romper-in-flamingo-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pant-footed-romper-in-flamingo-pink-1.jpg||-||KicKee Pant Girls Sundress in Peony|,|A friendly welcome to the warmer days, this new sundress was designed by KicKee Pants. The bodice features a smocked fit that allows stretch and comfort. Wide shoulder straps are made from the same fun print. The layers found on the front of the skirt are defined with the quaint ruffle. The soft fabric will follow her every move gracefully! Made with viscose blend. Machine wash cold, tumble dry low. |,|$19.00$|,||,|KICKEE-PANT-GIRLS-SUNDRESS-PEONY|,|$URL$kickee-pant-girls-sundress-peony.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pant-girls-sundress-in-peony-1.jpg||-||Kickee Pants Baby Girl Blanket Winter Rose|,|Created to match several of their new creations, this blanket comes from KicKee Pants. The solid color is a beautiful rose pink, perfect for any newborn baby girl. The blanket is as soft as can be with its bamboo blend fabric. Pair with any rompers, outfits, or gowns with the same fun color to create a memorable baby girls gift. Machine wash on gentle in cold water. Dimensions: 28 in. X 39 in. |,|$22.00$|,||,|KICKEE-PANTS-BABY-GIRL-BLANKET-WINTER-ROSE|,|$URL$kickee-pants-baby-girl-blanket-winter-rose.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-baby-girl-blanket-winter-rose-1.jpg||-||KicKee Pants Baby Girl Footie Glacier Girl|,|A new arrival from designer KicKee Pants this baby girls romper is an adorable piece for the new baby girl in your life. The glacier blue has an artic cool tone and is complimented with rose pink trimmings. The long sleeves help to keep her warm along with the closed feet. The row of snaps that runs up the front is decorated with a ruffle. The rose pink is added as ruffles across the back of the romper and creates small grips on the bottom of her feet. Machine wash on gentle. Bamboo viscose and spandex blend. |,|$39.00$|,||,|KICKEE-PANTS-BABY-GIRL-FOOTIE-GLACIER-GIRL|,|$URL$kickee-pants-baby-girl-footie-glacier-girl.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-baby-girl-footie-glacier-girl-1.jpg||-||Kickee Pants Baby Girl Hat Red Snowflake|,|Filled with Christmas spirit, this beautiful baby girls hat is from KicKee Pants. The brick red fabric is beyond soft and boasts of a flurry of snowflakes. This pattern is found throughout their winter collection, making this the perfect matching accessory. A knot is tied at the top of this hat for a sweet detail that makes the style all its own. |,|$12.00$|,||,|KICKEE-PANTS-BABY-GIRL-HAT-RED-SNOWFLAKE|,|$URL$kickee-pants-baby-girl-hat-red-snowflake.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-baby-girl-hat-red-snowflake-1.jpg||-||Kickee Pants Baby Knot Cap Snow Bird|,|Pairing with several of the new arrivals from KicKee Pants, this infant girls hat is part of their fun winter collection. The light pink hat is lined with a pattern of a skiing bird. The knot tied on the top of the hat is a cute detail while the hem is folded up. The soft fabric used to create all of the wonderful pieces by KicKee Pants is truly luxurious! Bamboo blend fabric. Machine wash on gentle. |,|$12.00$|,||,|KICKEE-PANTS-BABY-KNOT-CAP-SNOW-BIRD|,|$URL$kickee-pants-baby-knot-cap-snow-bird.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-baby-knot-cap-snow-bird-1.jpg||-||KicKee Pants Baby Romper for Girls Ruffled Berry|,|From baby designer KicKee Pants, this new baby girls romper will look adorable on your sweet angel. The rich berry red is trimmed with black around the neckline and cuffs. The front closes with snaps that drop from the neck to her left leg, accompanied with a sweet ruffle to match the hemline. The soft fabric is covered with a flower garland print. KicKee Pants always uses fabric that is delicate on her skin. Made with 95% viscose from bamboo and 5% spandex (lycra). Wash on gentle cycle in cold water. |,|$36.00$|,||,|KICKEE-PANTS-BABY-ROMPER-GIRLS-RUFFLED-BERRY|,|$URL$kickee-pants-baby-romper-girls-ruffled-berry.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-baby-romper-for-girls-ruffled-berry-17.jpg||-||KicKee Pants Baby Ruffle Leggings and Top Winter Stripe|,|KicKee Pants is now offering this darling infant outfit for your baby girl this fall and winter. The long sleeve top is created in a solid berry red shade that is sure to look fabulous in both of the chilly seasons. The top is dressed with three accenting ruffles upon the front. Paired with the long sleeve top we find cute leggings worn beneath. The same soft fabric is covered with a pink stripe. The elastic waist is comfortable for your little girl while three tiers of ruffles are found on the back. Created with viscose from bamboo and spandex. Gentle cycle on cold. |,|$54.00$|,||,|KICKEE-PANTS-BABY-RUFFLE-LEGGINGS-TOP-WINTER-STRIPE|,|$URL$kickee-pants-baby-ruffle-leggings-top-winter-stripe.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-baby-ruffle-leggings-and-top-winter-stripe-1.jpg||-||KicKee Pants Convertible Baby Gown with Hat Winter Berry|,|^|Part of their fall collection, this new baby girls gown comes from designer KicKee Pants. The gown is created in a rich berry shade that is covered with a flower garland print. The neckline and the cuffs are finished with a light pink trim. A ruffle joins the snaps that run down the front to the waist. The snaps beneath where the ruffle ends can be fastened differently to create a romper instead of a gown. This piece comes with a matching knotted hat. Made with a soft viscose blend created from bamboo. Machine washable on the gentle cycle.SIZE NEWBORN ONLY LEFT. ^||,|$48.00$|,||,|KICKEE-PANTS-CONVERTIBLE-BABY-GOWN-HAT-WINTER-BERRY|,|$URL$kickee-pants-convertible-baby-gown-hat-winter-berry.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-convertible-baby-gown-with-hat-winter-berry-17.jpg||-||KicKee Pants Convertible Gown and Hat Meadow Flower Lattice (Size Preemie & Newborn)|,|^|KicKee Pants has created this adorable convertible gown as a part of their spring collection. The lime green is dressed with a flower and lattice print. The bodice has a pink trimmed neckline to match the cuffs found on her long sleeves. A quaint ruffle is found running down the front, adding the perfect touch. The rows of snaps found on the front and the back allow for this piece to be worn as a long gown or as a romper. Bamboo. Gentle cycle in cold. SIZE PREEMIE AND NEWBORN ONLY LEFT. ^||,|$38.00$|,||,|KICKEE-PANTS-CONVERTIBLE-GOWN-HAT-MEADOW-FLOWER-LATTICE|,|$URL$kickee-pants-convertible-gown-hat-meadow-flower-lattice.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-convertible-gown-and-hat-meadow-flower-lattice-1.jpg||-||Kickee Pants Convertible Gown and Hat Warm Mittens|,|Newly created by KicKee Pants, this converter gown is a sweet winter design both mom and baby will love. The gown features a cool blue background dressed with rows of pink winter mittens. The cuffs on the long sleeves boast of a flip paw cuff to protect her skin from fingernail scratches as she sleeps. The back of the neckline is finished with a single button keyhole. A solid pink hat accompanies the gown to complete the look. The snaps on the gown can be fastened two different ways, the second allows the gown to change into a romper. Created from bamboo viscose. Machine wash on cold gentle. |,|$46.00$|,||,|KICKEE-PANTS-CONVERTIBLE-GOWN-HAT-WARM-MITTENS|,|$URL$kickee-pants-convertible-gown-hat-warm-mittens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-convertible-gown-and-hat-warm-mittens-23.jpg||-||KicKee Pants Convertible Gown and Hat Winter Candy|,|A genius design, this new convertible gown from KicKee Pants is two adorable styles wrapped into one piece. The stripes that cover the piece are different shades of pink placed with neutral colors. A matching hat comes with the gown with a knotted top and a folded up brim. The snaps that run down the front of this gown can be fastened a second way to create a romper. The back of the cuffs are finished with a cute ruffle. Viscose blend. Machine wash on gentle. |,|$48.00$|,||,|KICKEE-PANTS-CONVERTIBLE-GOWN-HAT-WINTER-CANDY|,|$URL$kickee-pants-convertible-gown-hat-winter-candy.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-convertible-gown-and-hat-winter-candy-17.jpg||-||KicKee Pants Convertible Gown Pink Daisy and Hat|,|^|Coordinating wonderfully with so many new creations, this KicKee Pants gown is sure to be loved by mom and her baby girl. The two pinks create a sweet daisy print that wraps around in stripes. The snaps that fall down the center are accompanied with a ruffle while the garment can be worn as a gown or romper. A matching hat comes with the gown while the top is finished with a knot. Bamboo. Gentle cycle in cold. SIZE PREEMIE AND NEWBORN ONLY LEFT.  ^||,|$38.00$|,||,|KICKEE-PANTS-CONVERTIBLE-GOWN-PINK-DAISY-HAT|,|$URL$kickee-pants-convertible-gown-pink-daisy-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-convertible-gown-pink-daisy-and-hat-1.jpg||-||KicKee Pants Daisy Romper in Pink|,|^|Making a darling gift, this new romper for infant girls comes from the loved KicKee Pants. This designer is known for their luxuriously soft fabrics and sweet prints. This piece is no differing with its light pink daisy print. The long sleeved piece helps keep her from being chilly while the contrast found on the neckline is mimicked in the ruffles that accent the hemlines and also run down the front with the line of changing snaps. Look for other pieces made in the same sweet fabric. Bamboo. Gentle cycle in cold. NEWBORN AND 6-12 MOS ONLY LEFT.  ^||,|$29.00$|,||,|KICKEE-PANTS-DAISY-ROMPER-PINK|,|$URL$kickee-pants-daisy-romper-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-daisy-romper-in-pink-1.jpg||-||Kickee Pants Designer Baby Girl Outfit Ruffled Snowflake|,|Part of their winter collection, this fabulous KicKee Pants outfit for baby girls is a sweet piece that will receive many compliments. The top is colored in brick and covered with a flurry of snowflakes. A matching ruffle accents the wrap neckline and is found upon the cuffs of the long sleeves. The back has a keyhole slit. Paired with this top we find a solid brick red legging. The waist is a classic elastic stretch allowing for comfort in fit. The back is dressed with three ivory ruffles. Created with a bamboo viscose blend. Machine wash on gentle. |,|$52.00$|,||,|KICKEE-PANTS-DESIGNER-BABY-GIRL-OUTFIT-RUFFLED-SNOWFLAKE|,|$URL$kickee-pants-designer-baby-girl-outfit-ruffled-snowflake.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-designer-baby-girl-outfit-ruffled-snowflake-1.jpg||-||KicKee Pants Designer Infant Top and Leggings Christmas Berry|,|New from KicKee Pants, this fabulous baby girls outfit is both adorable and beyond comfortable for your little one. The top features a fitted top with a wrap neckline and long sleeves. The bottom of the tunic is finished with a skirting ruffle. Beneath this top is a pair of black leggings. The leggings are finished with a small ruffle at the hem of both legs. The waistline has an elastic stretch. Both pieces are made with a bamboo viscose blend that is delicate on her skin. |,|$85.00$|,||,|KICKEE-PANTS-DESIGNER-INFANT-TOP-LEGGINGS-CHRISTMAS-BERRY|,|$URL$kickee-pants-designer-infant-top-leggings-christmas-berry.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-designer-infant-top-and-leggings-christmas-berry-1.jpg||-||KicKee Pants Flamingo Pink Knot Hat|,|The perfect accessory to her new KicKee Pants accessory, this newborn girls hat is sweet. The dark flamingo pink fabric is a solid shade made from fabric that is brilliantly soft. The top of the hat is styled with a knot while the brim is rolled up. Bamboo. Gentle cycle in cold. |,|$9.00$|,||,|KICKEE-PANTS-FLAMINGO-PINK-KNOT-HAT|,|$URL$kickee-pants-flamingo-pink-knot-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-flamingo-pink-knot-hat-1.jpg||-||KicKee Pants Footie for Baby Ruffled Winter Berry|,|A beautiful design that keeps her comfortable and warm as she naps, this new footed romper is from designer KicKee Pants. The romper is created in a rich berry shade that is found on many of the other new arrivals. A light pink contrasting trim is found on the neckline and the cuffs. The changing snaps run down the front with a light pink ruffle. The closed feet of this romper are the perfect added warmth. The back of the romper is decorated with rows of ruffles and small grips are attached to the bottom of both feet. 95% viscose from bamboo, 5% spandex; machine wash cold on the gentle cycle. |,|$39.00$|,||,|KICKEE-PANTS-FOOTIE-BABY-RUFFLED-WINTER-BERRY|,|$URL$kickee-pants-footie-baby-ruffled-winter-berry.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-footie-for-baby-ruffled-winter-berry-1.jpg||-||Kickee Pants Girls Baby Romper Christmas Lights|,|Designer KicKee Pants creates fabulous styles for baby girls with soft fabrics that are kind to her delicate skin. This romper is perfect for the holiday season this coming winter. The ivory fabric is wrapped with whimsical Christmas lights. Light pink trimmings create the ruffles on the hem of both legs and on the cuffs of her long sleeves. The easy changing snaps run from the neckline down to her left leg with a ruffle right beside. The snaps on the back of the romper also have a single quaint ruffle. Created with a bamboo viscose blend. Machine wash on gentle. |,|$38.00$|,||,|KICKEE-PANTS-GIRLS-BABY-ROMPER-CHRISTMAS-LIGHTS|,|$URL$kickee-pants-girls-baby-romper-christmas-lights.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-girls-baby-romper-christmas-lights-1.jpg||-||Kickee Pants Girls Convertible Gown with Hat|,|Striped in beauty, this new designer baby girls gown is from KicKee Pants. The gown is created from an ultra soft fabric that feels luxurious against her gentle skin. The gown offers her long sleeves with flip paw cuffs to keep her safe from scratches. The snaps that fasten closed can be secured to create a romper if desired. A matching pink striped hat accompanies the style and is finished with a knotted top. Bamboo viscose blend, machine washable on gentle cycle. |,|$46.00$|,||,|KICKEE-PANTS-GIRLS-CONVERTIBLE-GOWN-HAT|,|$URL$kickee-pants-girls-convertible-gown-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-girls-convertible-gown-with-hat-42.jpg||-||KicKee Pants Girls Footie in Green Lattice - Newborn|,|^|KicKee Pants is now offering this darling footed romper for infant girls. The adorable lime green blended with light pink is a classic summer style while the lattice print is unique. The row of changing snaps that run down the center are dressed with ruffles. The long sleeves keep her warm while the flip paw cuffs provide protection from scratches. A trio of ruffles wrap around the back of the romper in the sweet pink. Bamboo. Gentle cycle in cold. Only Newborn Left ^||,|$29.00$|,||,|KICKEE-PANTS-GIRLS-FOOTIE-GREEN-LATTICE|,|$URL$kickee-pants-girls-footie-green-lattice.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-girls-footie-in-green-lattice-1.jpg||-||KicKee Pants Girls Maxi Dress in Green Lattice - 2T|,|^|New from KicKee Pants, this fabulous designer maxi dress for toddlers is sure to brighten her spring and summer. The empire bodice features a straight neckline and thin shoulder straps in a light pink. The waist is a matching shade while the lime green lattice print is cute as can be. The skirt opens in shape to dance around her legs with ease. The hem is decorated with a ruffle to finish off this look. Bamboo. Gentle cycle in cold. SIZE 2T REMAINING.  ^||,|$39.00$|,||,|KICKEE-PANTS-GIRLS-MAXI-DRESS-GREEN-LATTICE|,|$URL$kickee-pants-girls-maxi-dress-green-lattice.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-girls-maxi-dress-in-green-lattice-1.jpg||-||KicKee Pants Girls Pajamas Short Sleeve in Pink Polka Dot|,|A sweet style that accompanies her to bed, these new designer pajamas are from KicKee Pants. The short sleeve top is designed for a fitted style that is safer for your darling little girl. Matching skinny pants come with the top and are in the same pink fabric. The light pink is covered with large, pale pink polka dots. Made with viscose blend. Machine wash cold, tumble dry low. |,|$19.00$|,||,|KICKEE-PANTS-GIRLS-PAJAMAS-SHORT-SLEEVE-PINK-POLKA-DOT|,|$URL$kickee-pants-girls-pajamas-short-sleeve-pink-polka-dot.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-girls-pajamas-short-sleeve-in-pink-polka-dot-1.jpg||-||KicKee Pants Girls Romper Green Meadow Lattice|,|Matching several new arrivals this season, this infant romper was created with love by KicKee Pants. The lime green fabric is soft on the skin and comfortable to wear while covered with a darling lattice print. The bodice is defined with elastic to gather the waist and a light pink ruffle to trim the neckline. The wide shoulder straps grace her shoulders while two pockets are found on the shorts. The elastic ruffle hem on both legs provide the cute bloomer look. A row of inseam snaps makes changing a breeze. Bamboo. Gentle cycle in cold. |,|$19.00$|,||,|KICKEE-PANTS-GIRLS-ROMPER-GREEN-MEADOW-LATTICE|,|$URL$kickee-pants-girls-romper-green-meadow-lattice.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-girls-romper-green-meadow-lattice-1.jpg||-||KicKee Pants Girls Ruffle Tee in Pink|,|^|Filled with a simply beautiful style, this new girls top comes from KicKee Pants line ""Catch a Tiger."" The light pink top offers her a classic fit. A darker pink accents the neckline and ruffles the short sleeves. This tee is perfect own its own or layered underneath a top to make it a touch warmer. Made with viscose blend. Machine wash cold, tumble dry low. ^||,|$9.00$|,||,|KICKEE-PANTS-GIRLS-RUFFLE-TEE-PINK|,|$URL$kickee-pants-girls-ruffle-tee-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-girls-ruffle-tee-in-pink-1.jpg||-||KicKee Pants Girls Striped Convertible Gown - Newborn|,|^|Created by KicKee Pants, this new fabulous baby girls gown is more than meets the eye. Thin stripes wrap around her bodice and blend together in beautiful shades and colors. Her long sleeves feature flip paws and a single keyhole is found on the back. The row of snaps that fasten the front closed. A light pink ruffle also runs down the front while the snaps give mom the option of wearing this piece as a gown or as a romper. Made with viscose blend. Machine wash cold, tumble dry low. SIZE NEWBORN ONLY REMAINING.  ^||,|$29.00$|,||,|KICKEE-PANTS-GIRLS-STRIPED-CONVERTIBLE-GOWN|,|$URL$kickee-pants-girls-striped-convertible-gown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-girls-striped-convertible-gown-1.jpg||-||KicKee Pants Girls Striped Hat|,|A sweet accessory, this new baby girls hat comes from designer KicKee Pants and is available in preemie and newborn sizes. The hat boasts of its thin stripes that blend blues and pinks. The top of the hat is finished with two quaint knots. The folded brim creates a crisp look. Pair with several of the new outfits in KeeKee Pants' spring and summer collection. Viscose blend fabric made from bamboo, adding a luxury level of soft. Machine wash and tumble dry. |,|$11.00$|,||,|KICKEE-PANTS-GIRLS-STRIPED-HAT|,|$URL$kickee-pants-girls-striped-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-girls-striped-hat-1.jpg||-||KicKee Pants Girls Yoga Pant Sailaway Stripe|,|As comfy as can be, these new girls yoga pants are ready to take on the day. KicKee Pants designed this soft pants in colors with match several other new arrivals. Thin stripes blend pinks, blues, and black wonderfully. The fold over waist has a stretch fit and a single pink bow found in the center. Two pockets found on the front give a home for her hands. Made with viscose blend. Machine wash cold, tumble dry low. |,|$19.00$|,||,|KICKEE-PANTS-GIRLS-YOGA-PANT-SAILAWAY-STRIPE|,|$URL$kickee-pants-girls-yoga-pant-sailaway-stripe.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-girls-yoga-pant-sailaway-stripe-1.jpg||-||KicKee Pants Hat for Newborn Winter Rose|,|An accessory that looks darling with her new KicKee Pants outfit, this designer baby girls hat is a must have to finish the look. The rose pink color is found throughout the patterns and styles that are found in the fall and winter collection. The hat has a cute knotted top and a sweet ruffle on the brim. Adding this hat to your purchase can make your baby shower gift complete or add a cute decoration when tied to the bow on the top of your wrapping. |,|$14.00$|,||,|KICKEE-PANTS-HAT-NEWBORN-WINTER-ROSE|,|$URL$kickee-pants-hat-newborn-winter-rose.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-hat-for-newborn-winter-rose-1.jpg||-||KicKee Pants Infant Girl Knot Hat|,|Made to accompany many of the new outfits from KicKee Pants' spring collection, this baby girls hat is available in the newborn size. The hat is covered with thin, colorful stripes which include several pinks and a lime green. The top features a tied knot while the brim is folded up. Bamboo. Gentle cycle in cold. |,|$9.00$|,||,|KICKEE-PANTS-INFANT-GIRL-KNOT-HAT|,|$URL$kickee-pants-infant-girl-knot-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-infant-girl-knot-hat-1.jpg||-||Kickee Pants Infant Girls Baby Sack and Hat in Pink|,|^|Absolutely adorable, this new baby girls outfit comes from designer KicKee Pants' fall and winter 2014 collection. The soft gown is covered with a pattern of a skiing snowbird. A ruffle runs from the neckline down to the hem with the easy changing snaps right by its side. A ruffle runs around the hemline while the back of the cuffs also find a ruffle accent. A matching hat comes with the gown. The front is adorned with a snow bird applique and the folded brim is in the same design as the gown and finished with a ruffle. The top of the hat is completed with two knots. 95% viscose blend. Machine wash on gentle. SIZE NEWBORN ONLY LEFT.  ^||,|$48.00$|,||,|KICKEE-PANTS-INFANT-GIRLS-BABY-SACK-HAT-PINK|,|$URL$kickee-pants-infant-girls-baby-sack-hat-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-infant-girls-baby-sack-and-hat-in-pink-28.jpg||-||Kickee Pants Infant Girls Footie Pink Poinsettia|,|New from KicKee Pants, this adorable little girls footed romper is part of their winter collection. The ivory romper is covered with a poinsettia pattern in three different shades of pink. The row of snaps on the front of the romper is joined with a single quaint ruffle. Light pink trimming is found on the neckline and on the flip paw cuffs. Ruffle accents are added to the back of the romper and small grips are added to both of the closed feet. Bamboo viscose blend, machine washable on gentle cycle. |,|$42.00$|,||,|KICKEE-PANTS-INFANT-GIRLS-FOOTIE-PINK-POINSETTIA|,|$URL$kickee-pants-infant-girls-footie-pink-poinsettia.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-infant-girls-footie-pink-poinsettia-1.jpg||-||KicKee Pants Infant Girls Gown in Watermelon - Newborn|,|^|The perfect gift for the summer baby, this designer infant gown comes from KicKee Pants. The light pink sack boasts of long sleeves and a cute ruffle that runs down the center next to the changing snaps. The fabric is soft to the touch while covered with slices of juicy watermelon. The dark pink contrasts coordinate beautifully! The matching hat is finished with a knot at the top and a sweet, quaint ruffle. Bamboo. Gentle cycle in cold. SIZE NEWBORN ONLY.  ^||,|$38.00$|,||,|KICKEE-PANTS-INFANT-GIRLS-GOWN-WATERMELON-HAT|,|$URL$kickee-pants-infant-girls-gown-watermelon-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-infant-girls-gown-in-watermelon-1.jpg||-||Kickee Pants Infant Romper Pink Snow Bird|,|Matching several other pieces available in their winter collection, this new designer romper is from KicKee Pants. The light pink romper is contrasted with a darker rose to trim the neckline. The same rose ruffles at her cuffs, the hem of both legs, and down the front. The line of changing snaps are easy to use. A final ruffle is found with the snaps on the back. Bamboo viscose blend, machine washable on gentle cycle. |,|$38.00$|,||,|KICKEE-PANTS-INFANT-ROMPER-PINK-SNOW-BIRD|,|$URL$kickee-pants-infant-romper-pink-snow-bird.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-infant-romper-pink-snow-bird-1.jpg||-||Kickee Pants Knot Hat for Infant Christmas Lights|,|^|Created to pair with the ""KicKee Pants Girls Baby Romper Christmas Lights,"" this new infant hat is a welcomed part of the winter collection. The ivory hat is covered with the darling print of a whimsical string of lights. These lights are in blues and pinks upon a grey wire. The brim of the hat is folded up. A cute knot is tied at the top of the hat for a unique style. ^||,|$12.00$|,||,|KICKEE-PANTS-KNOT-HAT-INFANT-CHRISTMAS-LIGHTS|,|$URL$kickee-pants-knot-hat-infant-christmas-lights.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-knot-hat-for-infant-christmas-lights-1.jpg||-||KicKee Pants Koala Sack with Hat - Newborn|,|^|An adorable animal print sure to fit any baby girl, this new gown is from the spring collection by designer KicKee Pants. The soft fabric is sweet to her delicate skin while covered in a darling koala bear print. The lime and pink blends together perfectly while small touches of ruffles add a feminine look. The sack is accompanied by a matching hat that boasts of a knot tied at the top and a pink brim. Bamboo. Gentle cycle in cold. SIZE NEWBORN ONLY AVAILABLE.  ^||,|$38.00$|,||,|KICKEE-PANTS-KOALA-SACK-HAT|,|$URL$kickee-pants-koala-sack-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-koala-sack-with-hat-1.jpg||-||KicKee Pants Large Baby Blanket Ruffled Berry|,|Designer KicKee Pants is now offering this stroller blanket as a part of their fall collection. The blanket boasts of a side covered with a flower garland pattern upon the dark berry pink. The light pink ruffle around the edges matches the reverse side. This piece matches several of the new outfits that are available in the collection, perfect for pairing them together for a baby girls shower gift! Viscose and spandex blend; wash on the gentle cycle. |,|$54.00$|,||,|KICKEE-PANTS-LARGE-BABY-BLANKET-RUFFLED-BERRY|,|$URL$kickee-pants-large-baby-blanket-ruffled-berry.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-large-baby-blanket-ruffled-berry-1.jpg||-||KicKee Pants Moped Infant Girls Romper - 3/6 Mos|,|^|Made from designer KicKee Pants, this unique baby girls romper is adorable. The short sleeves are ruffled with a stretch elastic and a single keyhole is found on her back. The wrap neckline is accented with the small white ruffle. The rich pink fabric is covered with a cute scooter pattern. A row of changing snaps is found on the inseam of the shorts. This fabric is beyond soft and comfortable on her new and delicate skin! Made with viscose blend. Machine wash cold, tumble dry low. (1) 3-6 MOS ONLY LEFT.  ^||,|$19.00$|,||,|KICKEE-PANTS-MOPED-INFANT-GIRLS-ROMPER|,|$URL$kickee-pants-moped-infant-girls-romper.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-moped-infant-girls-romper-1.jpg||-||KicKee Pants Moped Top in Pink Flamingo|,|A darling lounge wear new design, this girls tee is newly available from the designer KeeKee Pants. The dark flamingo pink is unique and beautiful in shade. Short flutter sleeves grace her shoulders while a touch of light pink is found on the jewel neckline. A large scooter is found placed upon the front. This scooter matches some of her baby sisters new arrivals for spring and summer! Made with viscose blend. Machine wash cold, tumble dry low. |,|$19.00$|,||,|KICKEE-PANTS-MOPED-TOP-PINK-FLAMINGO|,|$URL$kickee-pants-moped-top-pink-flamingo.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-moped-top-in-pink-flamingo-1.jpg||-||KicKee Pants Newborn Hat Winter Berry|,|Pairing perfectly with the new pieces that fill their fall and winter collection, this newborn hat comes from KicKee Pants. The hat is created with a soft fabric in a warm berry pink. The fabric is covered with a garland print while styled with a knotted tie on the top. The brim of the hat is completed with a single ruffle in a lighter pink. Look for the matching blanket to truly complete her outfit! Viscose blend, machine wash on cold. |,|$10.50$|,||,|KICKEE-PANTS-NEWBORN-HAT-WINTER-BERRY|,|$URL$kickee-pants-newborn-hat-winter-berry.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-newborn-hat-winter-berry-1.jpg||-||KicKee Pants Newborn Outfit Meadow Flower - 3/6 Mos|,|^|A new design by KicKee Pants, this newborn gift set is an adorable outfit. The long sleeve onsie offers classic changing snaps while the front is styled to wrap, inspired by the kimono look. The light pink trim pops out from the lime green lattice print. This outfit is finished with light pink leggings that are worn beneath. The fabric is comfortable on her skin. Bamboo. Gentle cycle in cold. 3-6 MONTH REMAINING. ^||,|$29.00$|,||,|KICKEE-PANTS-NEWBORN-OUTFIT-MEADOW-FLOWER|,|$URL$kickee-pants-newborn-outfit-meadow-flower.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-newborn-outfit-meadow-flower-1.jpg||-||Kickee Pants Newborn Outfit Snow Bird|,|An all in one set that is perfect for a baby shower gift, this new arrival comes from designer KicKee Pants. The light pink onesie is covered with a fun pattern with skiing bird. The wrap style front is secured with buttons and classic changing snaps. The back of her cuff is completed with a sweet ruffle. A matching hat joins in on the font and is finished with a knotted top and ruffle hem. Solid pink leggings are worn over the onesie have closed feet to keep her warm. Fabric created with a viscose blend from bamboo. Machine wash on gentle. |,|$31.50$|,||,|KICKEE-PANTS-NEWBORN-OUTFIT-SNOW-BIRD|,|$URL$kickee-pants-newborn-outfit-snow-bird.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-newborn-outfit-snow-bird-1.jpg||-||KicKee Pants Onesie Pant Set Girls Pink Snowflake|,|Designed by KicKee Pants, this new gift set is the perfect item to wrap up for your next baby shower! The outfit begins with an ivory onesie with a wrap style secured with snaps. A light pink garland print covers this piece as well as the matching knotted hat. This hat is completed with a light pink ruffle that matches the trimmings. The final piece to this outfit is a solid light pink legging with closed feet. A single ruffle is found on both feet. Viscose and spandex blend, wash on gentle cycle. |,|$31.50$|,||,|KICKEE-PANTS-ONESIE-PANT-SET-GIRLS-PINK-SNOWFLAKE|,|$URL$kickee-pants-onesie-pant-set-girls-pink-snowflake.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-onesie-pant-set-girls-pink-snowflake-1.jpg||-||KicKee Pants Peony Short Sleeve PJ Set (Size 5)|,|^|Offering a night filled with just as much style as the day, this new pajama set comes from KicKee Pants. The flamingo pink shade is rich and accented with light pink around her neckline and short sleeves. The front of the top has a large peony print. A smaller flower print covers the matching pants that come with the top. Both pieces are designed for a fitted look that is safer for your child. Made with viscose blend. Machine wash cold, tumble dry low. SIZE 5 ONLY LEFT. ^||,|$19.00$|,||,|KICKEEE-PANTS-PEONY-SHORT-SLEEVE-PJ-SET|,|$URL$kickeee-pants-peony-short-sleeve-pj-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-peony-short-sleeve-pj-set-1.jpg||-||KicKee Pants Pink Daisy Girls Dress Maxi|,|As sweet as she is, this new toddler dress comes from designer KicKee Pants. This summer dress welcomes the warm sunrays with its fabulous two-tone daisy print. The bodice offers a straight neckline framed with thin straps while the empire waist is a contrast cream. The skirt continues with the same soft, comfortable fabric down to the wide ruffle hem. The skirt comes to life with flowing movement everytime she moves. Pair this maxi dress with a coordinating bolero for an adorable look on a cool day. Bamboo. Gentle cycle in cold. |,|$39.00$|,||,|KICKEE-PANTS-PINK-DAISY-GIRLS-DRESS-MAXI|,|$URL$kickee-pants-pink-daisy-girls-dress-maxi.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-pink-daisy-girls-dress-maxi-1.jpg||-||KicKee Pants Pink Girls Knit Hat|,|Made to match several new arrivals for the spring and summer season, this new baby girls hat from designer KicKee Pants is the perfect way to finish her take home outfit. The fabric of this hat is beyond soft and is light weight. The top of the hat is styled with two tied knots while the brim is folded up. The right pink shade is inspired by the new blooms that are peaking out from the dirt. Made with viscose blend created from bamboo. Machine washable, tumble dry. |,|$9.00$|,||,|KICKEE-PANTS-PINK-GIRLS-KNIT-HAT|,|$URL$kickee-pants-pink-girls-knit-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-pink-girls-knit-hat-1.jpg||-||KicKee Pants Pink Knot Hat|,|From designer KicKee Pants, this newborn girls accessory is sure to be loved. The light pink fabric matches many of the new designs found in their spring collection. The hat is styled by a rolled brim and a knot tied at the top. Bamboo. Gentle cycle in cold. |,|$9.00$|,||,|KICKEE-PANTS-PINK-KNOT-HAT|,|$URL$kickee-pants-pink-knot-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-pink-knot-hat-1.jpg||-||KicKee Pants Pink Polka Dot Infant Hat|,|KicKee Pants is now offering this fabulous newborn and preemie hat to complete several outfits from their newest creations. The fabulous light pink is bright and a classic choice. Large coordinating polka dots cover the fabric while the brim is folded up. The top of the hat is finished with two small knots. The soft fabric is made from a bamboo viscose blend. Machine washable, tumble dry on low. |,|$11.00$|,||,|KICKEE-PANTS-PINK-POLKA-DOT-INFANT-HAT|,|$URL$kickee-pants-pink-polka-dot-infant-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-pink-polka-dot-infant-hat-1.jpg||-||KicKee Pants Pink Polka Dot Yoga Pant|,|A comfortable new pair of yoga pants that she will love to wear every day, these new arrivals come from designer KicKee Pants. Two shades of light pink are found all over the pants in a large polka dot print. The fit is relaxed as you move down towards the hemline. These yoga pants have two front pockets and a fabric that allows stretch in its fit. The roll over waist is decorated with a single bow at the center. Made with viscose blend. Machine wash cold, tumble dry low. |,|$19.00$|,||,|KICKEE-PANTS-PINK-POLKA-DOT-YOGA-PANT|,|$URL$kickee-pants-pink-polka-dot-yoga-pant.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-pink-polka-dot-yoga-pant-1.jpg||-||KicKee Pants Plumeria Footie for Girls - Newborn|,|^|Sure to bring sweet dreams this new infant footie comes from designer KicKee Pants. The pink outfit is covered in small daisies delight in the warmth of summer. Her long sleeves are finished with flip paw cuffs to keep scratches away as she naps. The tiny ruffle that runs down the center accompanies the changing snaps. The back of the romper is decorated with three quaint rows of ruffles. Bamboo. Gentle cycle in cold. SIZE NEWBORN ONLY LEFT.  ^||,|$29.00$|,||,|KICKEE-PANTS-PLUMERIA-FOOTIE-GIRLS|,|$URL$kickee-pants-plumeria-footie-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-plumeria-footie-for-girls-1.jpg||-||KicKee Pants Plumeria Romper Sweetie|,|Filled with the carefree spirit of summer, this new infant romper was designed by KicKee Pants. The light pink fabric is as soft as can be on her skin while sweet daisies dance in a girly print. The elastic waist gathers to separate the bodice from the shorts while the shoulder straps frame the ruffled neckline. Two swooping pockets are found on the front of the romper trimmed with the same ruffles. The legs feature inseam snaps and an elastic ruffled hem. Bamboo. Gentle cycle in cold. |,|$19.00$|,||,|KICKEE-PANTS-PLUMERIA-ROMPER-SWEETIE|,|$URL$kickee-pants-plumeria-romper-sweetie.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-plumeria-romper-sweetie-12.jpg||-||Kickee Pants Red Footie for Baby Snowflake|,|KicKee Pants is now offering this darling baby girls romper that is filled with love for the winter season. The romper is colored in brick red and covered with a light snowflake print that flutters over the entire piece. Ivory ruffles stand out from the print on the back of this romper and match the trimmings around the neck and cuffs. A sweet single ruffle joins the row of changing snaps on the front. Her little feet will stay warm in the cover of fabric. Bamboo viscose blend, machine washable on gentle cycle. |,|$31.50$|,||,|KICKEE-PANTS-RED-FOOTIE-BABY-SNOWFLAKE|,|$URL$kickee-pants-red-footie-baby-snowflake.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-red-footie-for-baby-snowflake-2.jpg||-||Kickee Pants Red Swaddle Blanket Snowflake Falls|,|Completing the gift, this matching swaddling blanket is from the winter collection by KicKee Pants. The soft fabric feels luxurious on her skin. The rich red is complimented with a falling snowflake print. Light ivory frames the blanket and helps the pattern to pop. Match this blanket with the other items that boast of the same great print and color! Soft viscose blend. Machine wash on gentle cold. Dimensions: 27 in. X 39 in. |,|$16.50$|,||,|KICKEE-PANTS-RED-SWADDLE-BLANKET-SNOWFLAKE-FALLS|,|$URL$kickee-pants-red-swaddle-blanket-snowflake-falls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-red-swaddle-blanket-snowflake-falls-1.jpg||-||KicKee Pants Stripe Infant Girls Romper|,|^|Available in infant sizes, this KicKee Pants summer romper is a bright addition to her closet. The top of the romper features a slight sweetheart neckline accented with fuchsia ruffles and wide shoulder straps. The island stripe print is fit for any princess while has a whimsical feel with its diagonal direction. The bottom of the romper is styled for a ruffled bloomer look while offering mom the ease of snaps lining the inseam. Pink ruffles accent the pockets while the hem of both legs are ruffled with a stretch elastic. Bamboo. Gentle cycle in cold. SIZE 3-6 MOS AND 6-12 MOS ONLY LEFT.  ^||,|$19.00$|,||,|KICKEE-PANTS-STRIPE-INFANT-GIRLS-ROMPER|,|$URL$kickee-pants-stripe-infant-girls-romper.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-stripe-infant-girls-romper-1.jpg||-||KicKee Pants Striped Gown Convertible and Hat|,|Unique from the rest, this fabulous convertible gown comes from KicKee Pants. The pink stripes wrap around the entire piece while her long sleeves give her warmth. A dark ruffle falls down the front while the changing snaps are fitted to create a gown or romper. The gown is accompanied by a matching hat. The fabric is soft on her skin and matches several other new arrivals for the season! Bamboo. Gentle cycle in cold. |,|$38.00$|,||,|KICKEE-PANTS-STRIPED-GOWN-CONVERTIBLE-HAT|,|$URL$kickee-pants-striped-gown-convertible-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-striped-gown-convertible-and-hat-1.jpg||-||KicKee Pants Swaddling Blanket Christmas Cranberry (ONE LEFT)|,|^|A solid accessory to match the new outfit from KicKee Pants, this swaddling blanket makes a perfect finish to your baby shower gift. The berry pink is a rich shade while complimented with the lighter pink that runs around the edges. The soft fabric is created from bamboo and is gentle upon her skin. With a blanket this soft, she is sure to nap in cozy warmth. Machine wash on gentle, viscose blend.ONE REMAINING. ^||,|$16.50$|,||,|KICKEE-PANTS-SWADDLING-BLANKET-CHRISTMAS-CRANBERRY|,|$URL$kickee-pants-swaddling-blanket-christmas-cranberry.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-swaddling-blanket-christmas-cranberry-1.jpg||-||KicKee Pants Swaddling Blanket in Rosy Pink|,|A receiving blanket that matches the new pieces from the fall collection by designer KicKee Pants. This blanket is made with the same soft viscose blend that fills the collection. The fabric is gentle on her skin and wraps her up in warmth. The rose pink shade is complimented with the glacier blue trimming. Wash on gentle cycle. |,|$16.50$|,||,|KICKEE-PANTS-SWADDLING-BLANKET-ROSY-PINK|,|$URL$kickee-pants-swaddling-blanket-rosy-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-swaddling-blanket-in-rosy-pink-1.jpg||-||KicKee Pants Watermelon Ruffled Blanket Large|,|In a sweet print, this baby girls blanket is perfect to keep her cozy or to lay her on the floor. The light pink front is decorated with slices of watermelon to match the dark flamingo pink found on the reverse. Girly ruffles run around the edges of this blanket to finish it off beautifully! This print matches several new arrivals. Bamboo. Gentle cycle in cold. |,|$39.00$|,||,|KICKEE-PANTS-WATERMELON-RUFFLED-BLANKET-LARGE|,|$URL$kickee-pants-watermelon-ruffled-blanket-large.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-watermelon-ruffled-blanket-large-1.jpg||-||Kone Shoes Patent Leather Heart Moccasins in Red (Size 5 Toddler)|,|^|With plenty of spirit, these patent red leather moccasin flats new from Kone Shoes finish off that her outfit perfectly. The red shoes feature the contrast stitching typical in moccasins, two drawstring hearts on each toe, and a rubber bottom sole for a firm grip. Lined with a bone white leather. Amazing European quality leather shoes. SIZE 5 REMAINING.  ^||,|$19.00$|,||,|KONE-SHOES-HEART-MOCCASINS-RED|,|$URL$kone-shoes-heart-moccasins-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kone-shoes-patent-leather-heart-moccasins-in-red-13.jpg||-||La Jenns Bunny Capri Set for Girls|,|Ready for any Easter egg hunt, this new La Jenns outfit is available from sizes 2T through 6X. The top is characterized by a large blue bunny applique dressed with a bowtie. The square neckline is framed by wide shoulder straps that are secured with wooden buttons. The yellow and pink patterns are a unique blend that coordinate perfectly. The wide ruffle hem is covered with large dots. The matching pants are created with the blue tulip print and finished with a pink bell hem. Cotton. Machine wash cold. |,|$59.00$|,||,|LA-JENNS-BUNNY-CAPRI-SET-GIRLS|,|$URL$la-jenns-bunny-capri-set-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/la-jenns-bunny-capri-set-for-girls-1.jpg||-||La Jenns Butterfly Dress for Infants|,|From designer La Jenns, this new infant dress is sure to be a hit this spring. The pink dress has a shapeless fit while small polka dots wrap around the piece. The large butterfly applique features button and rick rack ribbon accents. The dress is finished with a sky blue ruffle. The bloomer shorts placed beneath are covered with a large flower pattern. Both legs are hemmed with a ruffle. 100% cotton. Machine wash cool, tumble dry. Made in the USA. |,|$57.00$|,||,|LA-JENNS-BUTTERFLY-DRESS-INFANTS|,|$URL$la-jenns-butterfly-dress-infants.html|,|http://ep.yimg.com/ay/yhst-17102259411242/la-jenns-butterfly-dress-for-infants-1.jpg||-||La Jenns Capri Set for Toddlers with Dog Applique|,|A sweet arrival, this new girls outfit comes from designer La Jenns. The white top has a flowing, relaxed fit that is finished with a wide ruffle. Stripes of ribbons fall down the white fabric while the colorful neckline features quaint ruffled cap sleeves. A blue patterned wiener dog applique is found upon the front. The matching pants are created with a large floral print and elastic waistline. The ruffle found on both legs matches the neckline of the top. 100% cotton. Machine wash cool, tumble dry. Made in the USA. |,|$59.00$|,||,|LA-JENNS-CAPRI-SET-TODDLERS-DOG-APPLIQUE|,|$URL$la-jenns-capri-set-toddlers-dog-applique.html|,|http://ep.yimg.com/ay/yhst-17102259411242/la-jenns-capri-set-for-toddlers-with-dog-applique-1.jpg||-||La Jenns Dragonfly Infant Romper|,|Filled with a fun blend of patterns, these new girls overalls come from the fabulous brand La Jenns. The front features a lime zebra pattern and a square neckline. The wide shoulder straps are secured by wooden buttons. Upon the kaleidoscope flower print we find a large dragonfly applique. The body of the dragonfly is created with buttons. The wide legs are finished with a bell ruffle. 100% cotton. Machine wash cool, tumble dry. Made in the USA. |,|$49.00$|,||,|LA-JENNS-DRAGONFLY-INFANT-ROMPER|,|$URL$la-jenns-dragonfly-infant-romper.html|,|http://ep.yimg.com/ay/yhst-17102259411242/la-jenns-dragonfly-infant-romper-1.jpg||-||La Jenns Dress for Girls with Snail Applique|,|Sweet as can be, this new designer girls outfit comes from La Jenns. The dress features a relaxed fit that is finished with a quaint ruffle hemline. Two buttons are found on her shoulders while a cute flower blooms on the skirt. Beside the flower we find a unique snail applique completed with unique accents. 100% Cotton. Machine wash cool. Tumble dry. |,|$58.00$|,||,|LA-JENNS-DRESS-GIRLS-SNAIL-APPLIQUE|,|$URL$la-jenns-dress-girls-snail-applique.html|,|http://ep.yimg.com/ay/yhst-17102259411242/la-jenns-dress-for-girls-with-snail-applique-8.jpg||-||La Jenns Easter Basket Infant Romper - 18 Mos|,|^|New from designer La Jenns, this fabulous girls overall is a delightful arrival for the coming spring. The empire waist top boasts of a soft blue and pink floral print . Wide lime green straps rest upon her shoulders and are adorned with wooden buttons. The light rose pink is covered with quaint polka dots while a wide green bell ruffle finishes both legs. A large basket applique is found on the let leg filled with three patterned eggs. A pleated ribbon, small pom poms, large bow, and a rick rack ribbon add the finishing touches. 100% cotton. Machine wash cool, tumble dry. SIZE 18 MOS ONLY REMAINING.  ^||,|$49.00$|,||,|LA-JENNS-EASTER-BASKET-INFANT-ROMPER|,|$URL$la-jenns-easter-basket-infant-romper.html|,|http://ep.yimg.com/ay/yhst-17102259411242/la-jenns-easter-basket-infant-romper-1.jpg||-||La Jenns Girls Capri Set with Snail Applique|,|Matching her younger sisters dress, this new swing set from La Jenns is an adorable creation. The top boasts of a pale yellow bodice with an overall fit that is created by the wide shoulder straps and square neckline. A single ruffle rests upon the waist while the pink flower skirt is finished with a blue ruffle hem. A large snail applique is adorned with a ribbon shell. A single round flower blooms nearby. The matching pants are made from the tulip flower pattern and double bell hems. Cotton. Machine wash cool. Tumble dry. |,|$59.00$|,||,|LA-JENNS-GIRLS-CAPRI-SET-SNAIL-APPLIQUE|,|$URL$la-jenns-girls-capri-set-snail-applique.html|,|http://ep.yimg.com/ay/yhst-17102259411242/la-jenns-girls-capri-set-with-snail-applique-15.jpg||-||La Jenns Infant Bubble with Dog Applique (6 Mos)|,|^|La Jenns is now offering this adorable baby girls romper. The white fabric is textured with ribbon stripes. The neckline is mimicked in the back while a wooden button rests upon both shoulders. The legs finish with an elastic ruffle hem. A large blue applique resembles a wiener dog complete with a flower on her ear. 100% cotton. Machine wash cool, tumble dry. Made in the USA. ONLY ONE SIZE 6 MOS REMAINING. ^||,|$39.00$|,||,|LA-JENNS-INFANT-BUBBLE-DOG-APPLIQUE|,|$URL$la-jenns-infant-bubble-dog-applique.html|,|http://ep.yimg.com/ay/yhst-17102259411242/la-jenns-infant-bubble-with-dog-applique-1.jpg||-||La Jenns Infant Romper Floral|,|Bright and enjoyable, this fun new design comes from La Jenns. The wide straps frame the classic square overall neckline secured with two buttons. The shoulders are adorned with striped ruffles. The spring flower print is placed upon a yellow background and coordinates with the large polka dot pattern. Both legs are finished with a wide ruffle. 100% cotton. Machine wash cool, tumble dry. |,|$49.00$|,||,|LA-JENNS-INFANT-ROMPER-FLORAL|,|$URL$la-jenns-infant-romper-floral.html|,|http://ep.yimg.com/ay/yhst-17102259411242/la-jenns-infant-romper-floral-1.jpg||-||La Jenns Toddler Capri Set with Elephant - Size 2T|,|^|Inspired by the fun found at the circus, this new little girls outfit comes from La Jenns. The top boasts of its white and black chevron stripe. The shoulders receive a punch of pink lemonade color with the ruffle accented straps. The large elephant applique has pink ears and a cute blue body. Held by his trunk is a single balloon. The legs are worn beneath in a rich pink pattern. The elastic waist is comfortable to wear. Both legs finish with a double bell hemline to match the bodice. Cotton. Machine wash cold. SIZE 2T ONLY LEFT.  ^||,|$59.00$|,||,|LA-JENNS-TODDLER-CAPRI-SET-ELEPHANT|,|$URL$la-jenns-toddler-capri-set-elephant.html|,|http://ep.yimg.com/ay/yhst-17102259411242/la-jenns-toddler-capri-set-with-elephant-17.jpg||-||La Piccola Danza Mermaid Blue Girls Sequin Dress (Size 8)|,|^|A dress to spark her imagination, this mermaid blue girls sequin dress comes from designer La Piccola Danza. The bodice and short sleeves of this beautiful dress are covered in mermaid blue sequins that shimmer and catch the light as she moves. The skirt is in a lighter shade of the same blue. Rows of ruffles flow from the drop waist over a satin mermaid blue underskirt. A satin sash sits at the waist. The back has a full zipper. Made from nylon/polyester. Hand wash cold, hang to dry. SIZE 8 ONLY LEFT.  ^||,|$69.00$|,||,|LA-PICCOLA-DANZA-MERMAID-BLUE-GIRLS-SEQUIN-DRESS|,|$URL$la-piccola-danza-mermaid-blue-girls-sequin-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/la-piccola-danza-mermaid-blue-girls-sequin-dress-17.jpg||-||La Piccola Danza Pink Satin Beaded Bodice Ruffle Dress|,|She sparkle like a diamond in this brilliant girls dress from designer La Piccola Danza. The strappy bodice of pink satin is beautifully embellished with faux pearls and sparkling jewel accents. The pink satin continues at the back. The skirt is adorned with white tulle ruffles over a white underskirt. A full zipper is at the back. Made from cotton/spandex/polyester. Dry clean only. |,|$39.00$|,||,|LA-PICCOLA-DANZA-PINK-SATIN-BEADED-BODICE-RUFFLE-DRESS|,|$URL$la-piccola-danza-pink-satin-beaded-bodice-ruffle-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/la-piccola-danza-pink-satin-beaded-bodice-ruffle-dress-14.jpg||-||La Piccola Danza Sequined Coral Ruffle Girls Dress|,|A dazzling dress for your little darling, this girls dress comes from designer La Piccola Danza. The sleeveless bodice is done in a stunning sequin pattern of flowers in shades of coral, pink and white. The sequin pattern is continued on the back of the bodice. The skirt is done in layers of coral tulle layers over a coral underskirt. A full zipper is at the back. Made from nylon/polyester. Hand wash cold, line dry. |,|$37.33$|,||,|LA-PICCOLA-DANZA-SEQUINED-CORAL-RUFFLE-GIRLS-DRESS|,|$URL$la-piccola-danza-sequined-coral-ruffle-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/la-piccola-danza-sequined-coral-ruffle-girls-dress-14.jpg||-||LaBella Flora Childrens Boutique Gift Certificate $100|,|Perfect for all special occasions, LaBella Flora Gift Certificates give her the gift of picking out a designer accessory or outfit that speaks to her style! The gift certificate is redeemable on any purchase. Expires 1 year from date of purchase.

A unique gift certificate code is emailed to the buyer one day after purchase. This code is redeemed online during the checkout process. |,|$100.00$|,||,|LABELLA-GIFT-100|,|$URL$labella-gift-100.html|,|http://ep.yimg.com/ay/yhst-17102259411242/labella-flora-childrens-boutique-gift-certificate-100-6.jpg||-||LaBella Flora Childrens Boutique Gift Certificate $25|,|Perfect for all special occasions, LaBella Flora Gift Certificates give her the gift of picking out a designer accessory or outfit that speaks to her style! The gift certificate is redeemable on any purchase. Expires 1 year from date of purchase.

A unique gift certificate code is emailed to the buyer one day after purchase. This code is redeemed online during the checkout process. |,|$25.00$|,||,|LABELLA-GIFT-25|,|$URL$labella-gift-25.html|,|http://ep.yimg.com/ay/yhst-17102259411242/labella-flora-childrens-boutique-gift-certificate-25-6.jpg||-||LaBella Flora Childrens Boutique Gift Certificate $50|,|Perfect for all special occasions, LaBella Flora Gift Certificates give her the gift of picking out a designer accessory or outfit that speaks to her style! The gift certificate is redeemable on any purchase. Expires 1 year from date of purchase.

A unique gift certificate code is emailed to the buyer one day after purchase. This code is redeemed online during the checkout process. |,|$50.00$|,||,|LABELLA-GIFT-50|,|$URL$labella-gift-50.html|,|http://ep.yimg.com/ay/yhst-17102259411242/labella-flora-childrens-boutique-gift-certificate-50-1.jpg||-||LaBella Flora Childrens Boutique Gift Certificate $75|,|Perfect for all special occasions, LaBella Flora Gift Certificates give her the gift of picking out a designer accessory or outfit that speaks to her style! The gift certificate is redeemable on any purchase. Expires 1 year from date of purchase.

A unique gift certificate code is emailed to the buyer one day after purchase. This code is redeemed online during the checkout process. |,|$75.00$|,||,|LABELLA-GIFT-75|,|$URL$labella-gift-75.html|,|http://ep.yimg.com/ay/yhst-17102259411242/labella-flora-childrens-boutique-gift-certificate-75-1.jpg||-||Laura Ashley Shoes Black Suede Flats Studded Bow (Size 3)|,|^|Looking fabulous at all of the special occasions this fall and winter, these new designer girls shoes come from Laura Ashley. The shoe is covered in black velvet that is soft and provides a classic look. A large bow sits upon the toe decorated with small gems on the center and off to the sides. Any of her new party dresses would look great paired with these black flats. ONE SIZE 3 REMAINING.  ^||,|$19.50$|,||,|LAURA-ASHLEY-SHOES-BLACK-SUEDE-FLATS-STUDDED-BOW|,|$URL$laura-ashley-shoes-black-suede-flats-studded-bow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/laura-ashley-shoes-black-suede-flats-studded-bow-1.jpg||-||Laura Ashley Shoes Highend Studded Lace-Up Boots|,|Laura Ashley is now offering this fabulous pair of fall boots! These brown leather boots are the perfect tone to top off her new dresses or boutique outfits! A zipper runs up the inner side of both boots for a quick fit. A matching shoe string is laced up the front and decorated with two leather straps. These straps are secured with a bronze metal bucklke. A final touch of punk glam is found at the heel with the golden studs. |,|$25.50$|,||,|LAURA-ASHLEY-SHOES-HIGHEND-STUDDED-LACE-UP-BOOTS|,|$URL$laura-ashley-shoes-highend-studded-lace-up-boots.html|,|http://ep.yimg.com/ay/yhst-17102259411242/laura-ashley-shoes-highend-studded-lace-up-boots-1.jpg||-||Laura Ashley Shoes Red Fashion Boots Polka Dot Fun|,|A beautiful style that she will love to wear all fall and winter long, these new fashion boots for girls comes from designer Laura Ashley. The boots red patent leather as a brilliant shine. The middle of the boots are textured with a soft red fabric covered in a small silver glitter polka dot print. The outer side of both boots is also dressed with a cute bow. These boots look fabulous paired with skinny jeans, leggings, or dresses! |,|$27.00$|,||,|LAURA-ASHLEY-SHOES-RED-FASHION-BOOTS-POLKA-DOT-FUN|,|$URL$laura-ashley-shoes-red-fashion-boots-polka-dot-fun.html|,|http://ep.yimg.com/ay/yhst-17102259411242/laura-ashley-shoes-red-fashion-boots-polka-dot-fun-1.jpg||-||Le Pink Bella Girls Dress|,|A gorgeous new creation by designer Le Pink, this spring dress for girls is perfect for birthdays and weddings. The empire bodice features a smocked back that stretches for a comfortable fit. The sheer straps are ruffles of matching tulle dressed with small flowers. The same blooms are set upon the front of the bodice with sequin centers. A tulle bow is found on the left side of her waistline. The skirt is filled with the dreamy tulle falling from white down to pink. Polyester. Hand wash, hang dry. Made in the USA. |,|$69.00$|,||,|LE-PINK-BELLA-GIRLS-DRESS|,|$URL$le-pink-bella-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-bella-girls-dress-1.jpg||-||Le Pink Blush Special Occasion Dress for Girls PREORDER|,|^|This adorable new style from LePink is sure to be the perfect Easter or special occasion dress this spring! With it's gorgeous blush pink color, the straps are made with a sheer tulle and accent the straight neckline. The bodice is covered in petals as 3 little flowers with pearl centers sit in a row across her empire waist. The skirt is created with layers of tulle as the ivory crocheted lace peeks out from underneath. Please note that this is a PreOrder item and is NOT currently in stock. This Le Pink item is expected to arrive the week of February 2, 2015. ^||,|$109.00$|,||,|LE-PINK-BLUSH-SPECIAL-OCCASION-DRESS-GIRLS|,|$URL$le-pink-blush-special-occasion-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-blush-special-occasion-dress-for-girls-preorder-17.jpg||-||Le Pink Boutique Tween Dress in Pink Rose|,|^|Le Pink is now offering this fabulous boutique tween dress, perfect for the special celebrations that fill fall and winter. The bodice is covered with a sheer rosette texture that is covered with sparkling sequins. The back of the top is closed with a hidden zipper while the sleeveless neckline has a classic ""U"" shape. Around the waist we find a wide ribbon sash tied into a bow. The skirt is a sheer pink tulle divided into three tiers. The refreshing shades of pink are sure to stand out! Cotton/Polyester Blend. Machine wash in cold water. Tumble dry on low heat. ^||,|$96.00$|,||,|LE-PINK-BOUTIQUE-TWEEN-DRESS-PINK-ROSE|,|$URL$le-pink-boutique-tween-dress-pink-rose.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-boutique-tween-dress-in-pink-rose-1.jpg||-||Le Pink Couture Dress for Girls in Aqua PREORDER|,|^|Matching her sister's style, this Ariel blue party dress from LePink is sure to be one of her favorites! The straight neckline is accented with a band of tiny aqua and green sequins and thin tulle straps. The dress is made of a larger iridescent dot embellished fabric covered in a layer of tulle. Please note that this is a PreOrder item and is NOT currently in stock. This Le Pink item is expected to arrive the week of February 2, 2015. ^||,|$89.00$|,||,|LE-PINK-COUTURE-DRESS-GIRLS-AQUA|,|$URL$le-pink-couture-dress-girls-aqua.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-couture-dress-for-girls-in-aqua-preorder-1.jpg||-||Le Pink Fancy Girls Dress Gold Holiday|,|A new piece from Le Pink, this designer holiday dress for girls is aiming for the spotlight! The dress has an A line shape and is styled with a sleeveless neckline. A sheer ivory sash is tied around the waist with a flower attached on the front. The tulle overlay that covers the dress is accented with fun gold sequins. Close the hidden zipper in the back for a perfect fit! Layered under the hemline, a sheer ruffle falls, extending the length of the dress. 100% Polyester. Machine wash inside out in cold water. Hang to dry. |,|$85.50$|,||,|LE-PINK-FANCY-GIRLS-DRESS-GOLD-HOLIDAY|,|$URL$le-pink-fancy-girls-dress-gold-holiday.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-fancy-girls-dress-gold-holiday-1.jpg||-||Le Pink Fancy Girls Dress in Ivory Rose|,|Filled with sweet style, this gorgeous girls dress comes from the Le Pink line by designer Little Mass. The sleeveless bodice boasts of the textured ivory flowers that cover it entirely and a hidden zipper that secures the fit in the back. The peachy pink tulle is tied around the waist and adds a bit of dazzle with the sparkling bow in the front. The dreamy skirt falls in layers of the same pink tulle and offers the same pink lining as the bodice. This dress is perfect for holiday celebrations, birthdays, and recitals! Created in 100% polyester. Machine wash on gentle and tumble dry on low. |,|$49.00$|,||,|LE-PINK-FANCY-GIRLS-DRESS-IVORY-ROSE|,|$URL$le-pink-fancy-girls-dress-ivory-rose.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-fancy-girls-dress-in-ivory-rose-13.jpg||-||Le Pink Flower Girl Dress Five Tiers of Pink PREORDER|,|^|A sweet little French tutu dress from LePink is just what she needs this spring and summer. With it's beautiful blush pink color, she will be right on trend with all the weddings this season. Thin flower straps begin the a line shape of this dress with it's layers of tulle pieced together for a fancy look. A tiny flower accents her shoulder while a large layer of crocheted lace peeks out below the hem. Please note that this is a PreOrder item and is NOT currently in stock. This Le Pink item is expected to arrive the week of February 2, 2015. ^||,|$84.00$|,||,|LE-PINK-FLOWER-GIRL-DRESS-FIVE-TIERS-PINK|,|$URL$le-pink-flower-girl-dress-five-tiers-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-flower-girl-dress-five-tiers-of-pink-preorder-1.jpg||-||Le Pink Flower Girls Dress Crochet Daisy PREORDER|,|^|Just in time for the May flowers, this sister style comes to us from designer LePink. The sleeveless style has an a line shape with a fitted bodice. The white dress has a fun applique of powder blue flowers flowing throughout the bodice while the straps are a thin mesh. A white sash ties into a bow behind her back and is accented with a large off center flower. The skirt is created with layers of flowing tulle that moves about the room with her. Please note that this is a PreOrder item and is NOT currently in stock. This Le Pink item is expected to arrive the week of February 2, 2015. ^||,|$99.00$|,||,|LE-PINK-FLOWER-GIRLS-DRESS-CROCHET-DAISY|,|$URL$le-pink-flower-girls-dress-crochet-daisy.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-flower-girls-dress-crochet-daisy-preorder-1.jpg||-||Le Pink Flower Girls Dress Ivory Silver Bells|,|Designed for your beautiful little flower girl, this new ivory dress is a creation by Le Pink. The bodice has an empire waist and cute ruffles accenting the sleeveless neckline. Silver sequins are added to accent the flower pattern. The skirt is created with dreamy layers of ivory tulle ruffled on top of each other. A single flower sits off centered on her waist. The fit is secured with a hidden zipper found on the back. 100% Polyester. Machine wash in cold water. Hang to dry. |,|$64.50$|,||,|LE-PINK-FLOWER-GIRLS-DRESS-IVORY-SILVER-BELLS|,|$URL$le-pink-flower-girls-dress-ivory-silver-bells.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-flower-girls-dress-ivory-silver-bells-17.jpg||-||Le Pink Girls Dress in Crochet Daisy PREORDER|,|^|Just in time for the May flowers, this dress comes to us from designer LePink. The sleeveless style has an a line shape with a fitted bodice. The white dress has a fun applique of powder blue flowers flowing throughout the piece. A white sash ties into a bow behind her back and is accented with a large off center flower. Please note that this is a PreOrder item and is NOT currently in stock. This Le Pink item is expected to arrive the week of February 2, 2015. ^||,|$94.00$|,||,|LE-PINK-GIRLS-DRESS-CROCHET-DAISY|,|$URL$le-pink-girls-dress-crochet-daisy.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-girls-dress-in-crochet-daisy-preorder-1.jpg||-||Le Pink Girls Easter Dress Beautiful Belle PREORDER|,|^|She will be the Belle of the ball in this gorgeous new Easter dress from LePink! Created in a traditional shape, the sleeveless style has a fitted bodice and full skirt. The entire piece is covered in ribbon-like flowers in gold and red with little gold sequins in the centers. The full skirt is layered with tulle that peeks out from underneath the hemline. Please note that this is a PreOrder item and is NOT currently in stock. This Le Pink item is expected to arrive the week of February 2, 2015. ^||,|$109.00$|,||,|LE-PINK-GIRLS-EASTER-DRESS-BEAUTIFUL-BELLE|,|$URL$le-pink-girls-easter-dress-beautiful-belle.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-girls-easter-dress-beautiful-belle-preorder-1.jpg||-||Le Pink Girls Frilly Dress Ruffle Dream PREORDER|,|^|This vintage inspired LePink dress is sure to be a favorite no matter where she goes this spring and summer! The straight neckline is accented by a wide trim of crocheted lace and thin ruffled straps. A cluster of flowers with pearl centers sit at her shoulder while layers of dreamy tulle flow down in an uneven pattern giving it much depth and volume. This adorable dress would be perfect for Easter! Please note that this is a PreOrder item and is NOT currently in stock. This Le Pink item is expected to arrive the week of February 2, 2015. ^||,|$94.00$|,||,|LE-PINK-GIRLS-FRILLY-DRESS-RUFFLE-DREAM|,|$URL$le-pink-girls-frilly-dress-ruffle-dream.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-girls-frilly-dress-ruffle-dream-preorder-1.jpg||-||Le Pink Girls Party Dress Ariel Blue PREORDER|,|^|Perfect for a day under the sea, this Ariel blue party dress comes to us from LePink. The straight neckline is accented with thin teal straps while the bodice is covered in green and teal tiny sequins. The skirt is created with a larger iridescent dot embellished fabric covered in a layer of tulle. Please note that this is a PreOrder item and is NOT currently in stock. This Le Pink item is expected to arrive the week of February 2, 2015. ^||,|$116.00$|,||,|LE-PINK-GIRLS-PARTY-DRESS-ARIEL-BLUE|,|$URL$le-pink-girls-party-dress-ariel-blue.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-girls-party-dress-ariel-blue-preorder-1.jpg||-||Le Pink Girls Party Dress in Leopard Sequins|,|Simply precious, this new little girls dress from Le Pink will be one that she never forgets. The sleeveless neckline is accented with ivory tulle ruffles and a hidden zipper runs up the back. Small sequins line the top in a fun leopard print. The skirt is separated into three tiers of tulle layers finished with a ruffle. A lining on the skirt is the same warm ivory. Dress: 100% polyester; Lining: 100% acetate. Machine wash and hang to dry. |,|$34.33$|,||,|LE-PINK-GIRLS-PARTY-DRESS-LEOPARD-SEQUINS|,|$URL$le-pink-girls-party-dress-leopard-sequins.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-girls-party-dress-in-leopard-sequins-1.jpg||-||Le Pink Girls Party Dress Pink Glitter|,|A dazzling creation that will become her favorite dress, this new arrival comes from designer Le Pink. The empire bodice glimmers from the rows of attached sequins. These accents are protected with a tulle overlay. The wide neckline is framed with cap sleeves while the fit is assured by the hidden zipper in the back. A matching tulle sash is tied into a bow around her waistline. The skirt is created with sheer ruffles in a pink tulle. Some of the tulle is accented with a small glittering polka dot print. Made in the USA. Machine wash in cold water. Hang to dry. |,|$70.50$|,||,|LE-PINK-GIRLS-PARTY-DRESS-PINK-GLITTER|,|$URL$le-pink-girls-party-dress-pink-glitter.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-girls-party-dress-pink-glitter-22.jpg||-||Le Pink Girls Pink Dress|,|Ready for her Easter celebration, this fancy girls dress from designer Le Pink is a fanciful creation sure to delight. The empire bodice is fitted with a hidden zipper in the back. The front is covered with colorful flowers and small touches of glimmering sequins. The skirt opens to a princess shape thanks to the layers of structured tulle overlays. The hemline of the tulle finds a few flower accents to match the bodice. The dress is fully lined. Polyester. Hand wash, hang dry. Made in the USA. |,|$79.00$|,||,|LE-PINK-GIRLS-EASTER-DRESS|,|$URL$le-pink-girls-easter-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-girls-pink-dress-1.jpg||-||Le Pink Girls Sequin Party Dress Rose|,|^|A beautiful new party dress from Le Pink, this creation is part of their new fall and winter line. The bodice is sleeveless and fitted while colored in a dusty rose. The fabric is textured as well as accented by glittering sequins. At the back of her neckline we find a single button keyhole. The skirt is created with vertical ruffles of matching, soft tulle. Off centered on the waist we find a beaded bow accent. Polyester/Cotton. Machine wash in cold water. Tumble dry on low. SIZE 5 REMAINING. ^||,|$96.75$|,||,|LE-PINK-GIRLS-SEQUIN-PARTY-DRESS-ROSE|,|$URL$le-pink-girls-sequin-party-dress-rose.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-girls-sequin-party-dress-rose-1.jpg||-||Le Pink Girls Shrug Special Occasion Pink Sequin (4, 6, 14)|,|^|Designer Le Pink has created this fabulous girls shrug to pair with their new, gorgeous dresses. The dusty rose pink fills their fall 2014 collection. The jacket is covered in a shaggy texture and accented fun sequins that add the perfect amount of shimmer. The neckline comes to a soft ""V"" shape that is closed with a single button. The lining on this piece removes any trouble she may have layering over other fabrics. Cotton/Polyester. Machine wash in cold water. Tumble dry on low.SIZE 4, 6, & 14 REMAINING. ^||,|$44.25$|,||,|LE-PINK-GIRLS-SHRUG-SPECIAL-OCCASION-PINK-SEQUIN|,|$URL$le-pink-girls-shrug-special-occasion-pink-sequin.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-girls-shrug-special-occasion-pink-sequin-1.jpg||-||Le Pink Girls Special Occasion Dress (4, 6X, 8 & 10)|,|Beyond elegance, this fabulous new girls dress comes from designer Le Pink. The bodice features a unique texture of petals that cover the front. The neckline is slightly curved and framed with thin spaghetti straps. Her empire waistline is decorated with shimmering gold and gems. The long skirt falls in the same light peachy pink. Layers of tulle overlay the skirt and fall below the hem and matching flowers are sprinkled down off centered to one side. Polyester. Hand wash, hang dry. Made in the USA. |,|$76.50$|,||,|LE-PINK-GIRLS-SPECIAL-OCCASION-DRESS|,|$URL$le-pink-girls-special-occasion-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-girls-special-occasion-dress-1.jpg||-||Le Pink Girls Tulle Dress Gala Red PREORDER|,|^|Matching her sister's style, this red floral dress from LePink is sure to be one of her favorites! The straight neckline is accented with a garden of yellow and red ribbon-like flowers with tiny gold sequin centers and wide red straps. The skirt is created with layers of red tulle finishing the hem in an hanky style. Please note that this is a PreOrder item and is NOT currently in stock. This Le Pink item is expected to arrive the week of February 2, 2015. ^||,|$89.00$|,||,|LE-PINK-GIRLS-TULLE-DRESS-GALA-RED|,|$URL$le-pink-girls-tulle-dress-gala-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-girls-tulle-dress-gala-red-preorder-1.jpg||-||Le Pink Girls Tulle Dress in Pink|,|Filled with the precious style of spring, this designer dress for girls comes from Le Pink by Little Mass. The dress boasts of its feminine style created with the tiers of light pink tulle ruffles. The bodice has an empire waist that is accented with a ribbon that ties into a bow. Her thin straps create the neckline and make it easy to pair a light sweater over top if needed. The skirt opens in an A line shape. Polyester. Hand wash, hang dry. Made in the USA. |,|$78.00$|,||,|LE-PINK-GIRLS-TULLE-DRESS-PINK|,|$URL$le-pink-girls-tulle-dress-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-girls-tulle-dress-in-pink-1.jpg||-||Le Pink Holiday Dress for Girls in Glitter Tulle|,|Absolutely gorgeous, this new designer girls dress from Le Pink will outshine the rest at any celebration! The empire waist is styled with a sweetheart neckline and wide straps. A sheer tulle overlay covered with small glittering polka dots falls in pleats from the neckline, creating an overlay for the entire dress. A matching sash is decorated with three pink flowers with pearl centers and is tied around the waist. The skirt is covered with the same dreamy tulle. This dress matches several of the other new arrivals from Le Pink, perfect for creating a family photo! Polyester/Acetate Blend. Machine wash in cold water. Hang to dry. Made in the USA. |,|$64.50$|,||,|LE-PINK-HOLIDAY-DRESS-GIRLS-GLITTER-TULLE|,|$URL$le-pink-holiday-dress-girls-glitter-tulle.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-holiday-dress-for-girls-in-glitter-tulle-1.jpg||-||Le Pink Holiday Dress for Little Girls with Silver Tulle|,|^|Le Pink has created this new dress for little girls as a part of their ""Winter Blossom"" collection for fall and winter. The bodice is created with a purple floral fabric and has a straight neckline framed with wide shoulder straps. The back of the bodice has a smocked stretch for a pull on fit. The flower accents cover the front of the bodice. The skirt is finished with a silver glitter tulle overlay. Polyester/Acetate Blend. Machine wash in cold water. Hang to dry. Made in the USA.Strap and flower colors may vary slightly. Straps may be lighter and flowers may be purple. ^||,|$64.50$|,||,|LE-PINK-HOLIDAY-DRESS-LITTLE-GIRLS-SILVER-TULLE|,|$URL$le-pink-holiday-dress-little-girls-silver-tulle.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-holiday-dress-for-little-girls-with-silver-tulle-1.jpg||-||Le Pink Jewel Girls Birthday Dress in Pink (Size 2T)|,|^|Accompanying her on a very special day, this new girls dress comes from fabulous Le Pink. The empire bodice offers cap sleeves, a hidden zipper back, and cascading ruffles that add texture. A thin velvet ribbon wraps around her waist and ties in a bow at the back while accented with fun gems on the front. The skirt is created with layers of pink tulle. 100% polyester. Machine wash and hang to dry. Made in the USA. (1) 2T ONLY LEFT. ^||,|$39.00$|,||,|LE-PINK-JEWEL-GIRLS-BIRTHDAY-DRESS-PINK|,|$URL$le-pink-jewel-girls-birthday-dress-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-jewel-girls-birthday-dress-in-pink-1.jpg||-||Le Pink Le Beaute Cascading Ruffles Girls Dress (24 Mos)|,|^|Your little beauty will shine in this lovely girls dress from the Le Pink collection of designer Little Mass. The strappy bodice is covered in sequins that create a heart pattern of gold and pink. The wispy straps are adjustable. The back of the bodice is smocked. White ruffles cascade from the waist to the bubble hemline over an underskirt of pink. Made from cotton/polyester/spandex. Machine wash cold, tumble dry low. (1) 24 MOS ONLY LEFT.  ^||,|$29.00$|,||,|LE-PINK-LE-BEAUTE-CASCADING-RUFFLES-GIRLS-DRESS|,|$URL$le-pink-le-beaute-cascading-ruffles-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-le-beaute-cascading-ruffles-girls-dress-14.jpg||-||Le Pink Little Girls Dress in Pucci Swirls (Size 3T)|,|^|Matching her older sisters hi-low dress, this new arrival was designed by Le Pink. The cap sleeve garment boasts of a trapeze cut accented with a scoop neckline. A single button keyhole is found on the back while large black flowers sit beneath the neck on the front. The unique design is mixed with stripes and swirls. The fabric is slightly sheer and offers a silky feel. A single ruffle wraps around the hemline to finish this look. 100% polyester, fully lined. Machine wash and hang dry. SIZE 3T ONLY LEFT. ^||,|$32.00$|,||,|LE-PINK-LITTLE-GIRLS-DRESS-PUCCI-SWIRLS|,|$URL$le-pink-little-girls-dress-pucci-swirls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-little-girls-dress-in-pucci-swirls-1.jpg||-||Le Pink Little Girls Holiday Dress Silver and Pink|,|^|A glimmering look introduced as a part of Le Pink's ""Winter Blossom"" collection, this new little girls dress looks beautiful at parties and in photographs! The bodice is cut for a fitted look and features darling cap sleeves. The wide neckline is closed with a hidden zipper in the back. The silver bodice is covered with a metallic lace that looks radiant in any lighting. The tutu inspired skirt is a fun pink tulle ruffled in tiers. The layers of this sheer fabric creates the full shape while two pink and purple flowers sit on her waist. Nylon/Rayon/Metallic Blend. Machine Wash in Cold Water. Tumble Dry on Low. ^||,|$63.00$|,||,|LE-PINK-LITTLE-GIRLS-HOLIDAY-DRESS-SILVER-PINK|,|$URL$le-pink-little-girls-holiday-dress-silver-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-little-girls-holiday-dress-silver-and-pink-1.jpg||-||Le Pink Little Girls TuTu Dress Gold Leaves|,|A unique look from Le Pink, this new little girls dress will look stunning as a flower girls dress or at any special occasion. The ivory bodice is dressed with a tulle overlay that is decorated with golden sequin leaves. The sleeveless neckline is finished with tulle ruffle accents. The skirt is covered with a stiff tulle that holds its full shape while introduced by a single flower off centered on her waistline. A hidden zipper runs up the back of this gown for a great fitted bodice! Polyester/Nylon Blend. Machine wash in cold water. Hang to dry. Made in the USA. |,|$59.25$|,||,|LE-PINK-LITTLE-GIRLS-TUTU-DRESS-GOLD-LEAVES|,|$URL$le-pink-little-girls-tutu-dress-gold-leaves.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-little-girls-tutu-dress-gold-leaves-1.jpg||-||Le Pink Mimosa Coral Chiffon Girls Dress (Size 4)|,|^|A touch of lace adorns this smart and stylish girls dress from Le Pink by Little Mass. The bodice boasts of cap sleeves and triangles of lace at the neckline. An overlay of coral chiffon gathers at the bodice and flows to the ruffled hemline. An additional lace accent is found on the ruffle. The waistline is gathered with elastic and ties with a white ribbon. Made from rayon/spandex/polyester. Machine wash cold, delicate cycle, hang to dry.(1) 4 ONLY LEFT.  ^||,|$29.00$|,||,|LE-PINK-MIMOSA-CORAL-CHIFFON-TWEEN-DRESS|,|$URL$le-pink-mimosa-coral-chiffon-tween-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-mimosa-coral-chiffon-girls-dress-1.jpg||-||Le Pink Tulle Dress for Girls in Blue Floral PREORDER|,|^|Fit for a fairytale, this whimsical new dress comes from designer LePink. The straight neckline is accented by thin blue straps. The bodice is covered in multi colored embroidered flowers and sequins to give it a garden feel. The tutu skirt is made with layers of blue, green and purple tulle to complete the look. Please note that this is a PreOrder item and is NOT currently in stock. This Le Pink item is expected to arrive the week of February 2, 2015. ^||,|$98.00$|,||,|LE-PINK-TULLE-DRESS-GIRLS-BLUE-FLORAL|,|$URL$le-pink-tulle-dress-girls-blue-floral.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-tulle-dress-for-girls-in-blue-floral-preorder-1.jpg||-||Le Pink Tween Girls Dress in Hi Low Hem (Size 7)|,|^|A new design by Le Pink, this tween dress is filled with a whimsical dream. The unique print boasts of shades of pink, teal, and plum that dances and billows upon the sheer fabric. The bodice receives a blouson look from the elastic waistline. Black sequins adorn the shoulders and a single button keyhole is found on the back. An accompanying tulle sash is tied around the waist and adorned with black sequins on the front. This dress finishes with a high low hemline and is fully lined. 100% polyester, machine wash and hang to dry. (2) SIZE 7 ONLY REMAIN. ^||,|$42.00$|,||,|LE-PINK-TWEEN-GIRLS-DRESS-HI-LOW-HEM|,|$URL$le-pink-tween-girls-dress-hi-low-hem.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-tween-girls-dress-in-hi-low-hem-1.jpg||-||Le Pink Tween Holiday Dress Ivory Tulle|,|An elegant tween dress, this new arrival is from designer Le Pink. The dress is perfectly styled for weddings and holiday celebrations. The bodice is covered with a lacey overlay and is styled with a sleeveless scoop neckline. The sheer sash tied around the waist is decorated with gems and a single ivory flower upon the front. The long skirt is draped with layers of ivory tulle from waist to hem. Polyester/Rayon/Spandex Blend. Machine wash in cold water. Hang to dry. Made in the USA. |,|$73.50$|,||,|LE-PINK-TWEEN-HOLIDAY-DRESS-IVORY-TULLE|,|$URL$le-pink-tween-holiday-dress-ivory-tulle.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-tween-holiday-dress-ivory-tulle-1.jpg||-||Le Pink Victoria Lace Girls Sleeveless Dress (Size 14)|,|^|This lace dress from designer Le Pink is a sweet style for the any season. The sleeveless bodice is a soft velvet and boasts of a belt that ties in the back and is adorned with scalloped velvet and lace in the front. The pink tulle skirt is covered with tiered black lace and holds its full shape. Perfect for photos or special occasions! Polyester blend, machine washable. ONE SIZE 14 ONLY LEFT.  ^||,|$39.00$|,||,|LE-PINK-VICTORIA-LACE-GIRLS-SLEEVELESS-HOLIDAY-DRESS|,|$URL$le-pink-victoria-lace-girls-sleeveless-holiday-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-victoria-lace-girls-sleeveless-dress-17.jpg||-||Le' Za Me Baby Bonnet for Girls Christmas Floral|,|For your little snow baby, this new girls bonnet comes from Le' Za Me. The bonnet is covered with red and lime to match the holiday season. The unique pattern is inspired by snowflakes and has a whimsical appeal. The ruffle that is found on the front is dressed with three blooms side by side. Two of these flowers are made with the same pattern while the center is a solid red to match the large bow that is tied for a sure fit. 100% Cotton. Machine Wash in Cold Water. Tumble Dry Low. |,|$14.25$|,||,|LE-ZA-ME-BABY-BONNET-GIRLS-CHRISTMAS-FLORAL|,|$URL$le-za-me-baby-bonnet-girls-christmas-floral.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-za-me-baby-bonnet-for-girls-christmas-floral-1.jpg||-||Le' Za Me Baby Girl Bonnet Golden Celebration|,|This darling celebration bonnet is brought to you by designer Le' Za Me. The bonnet has bold mustard yellow stripes and is accented with a majestic purple border over the front ruffle that flows into beautifully wide, long straps to tie in a bow beneath her chin. The ruffle is adorned with a handmade fabric adornment with contrasting neon green polka dot and purple and white stripe fabric and a matching mustard yellow stripe button in the center. 100% Cotton. Machine wash in cool water. Tumble dry on low. |,|$14.25$|,||,|LE-ZA-ME-BABY-GIRL-BONNET-GOLDEN-CELEBRATION|,|$URL$le-za-me-baby-girl-bonnet-golden-celebration.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-za-me-baby-girl-bonnet-golden-celebration-1.jpg||-||Le' Za Me Baby Girl Bonnet Hat Fuchsia Fun|,|Le' Za Me is a boutique baby brand now offering this adorable baby girls bonnet. The pink fabric is covered with a flowery ivory pattern. The large bow tied under her chin is also in this fabric. Wrapping across the top is a grey flower pattern completed with scallop ruffles. Three rosettes sit on the right side of her head and complete this darling look. A sweet bonnet is the perfect prop for her next photo shoot! 100% Cotton. Machine wash cold. Tumble dry. |,|$14.25$|,||,|LE-ZA-ME-BABY-GIRL-BONNET-HAT-FUCHSIA-FUN|,|$URL$le-za-me-baby-girl-bonnet-hat-fuchsia-fun.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-za-me-baby-girl-bonnet-hat-fuchsia-fun-1.jpg||-||Le' Za Me Baby Girl Bonnet Hat Red Damask|,|A playful and fun design, this new baby girls bonnet from Le' Za Me is perfect for creating an adorable holiday photo! The hat is covered with a rich red damask pattern. The wide ruffle that runs across the front is trimmed with a scallop line. The red tie is placed in the center of this ruffle and creates the bow under her chin. A flower accent on the right side is created with both the solid red and the patterned fabric. 100% Cotton. Machine wash in cool water. Tumble dry on low. |,|$14.25$|,||,|LE-ZA-ME-BABY-GIRL-BONNET-HAT-RED-DAMASK|,|$URL$le-za-me-baby-girl-bonnet-hat-red-damask.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-za-me-baby-girl-bonnet-hat-red-damask-1.jpg||-||Le' Za Me Baby Girl Bonnet Winter Fun|,|A unique piece, this baby bonnet was designed by Le' Za Me. The bonnet features a swirling print in blue, red, and gray. This fabric also creates the ruffle and rosette accents. The flowers are finished with large red button centers. A tie is secured under her chin into a bow. 100% Cotton. Machine Wash in Cold Water. Tumble Dry Low. |,|$14.25$|,||,|LE-ZA-ME-BABY-GIRL-BONNET-WINTER-FUN|,|$URL$le-za-me-baby-girl-bonnet-winter-fun.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-za-me-baby-girl-bonnet-winter-fun-1.jpg||-||Le' Za Me Infant Bonnet for Girls Checkered Christmas|,|Gingham glory, this new bonnet for baby girls comes from the fall line by Le' Za Me. The body of the bonnet is the red gingham, matching to the bow tied under her chin. A light green gingham ruffle dresses up the top of her head and creates a fun holiday feel. Off to one side we find a fabric bloom created with strips of raw edge fabric. Cotton/Polyester. Machine wash in cool water. Tumble dry on low. |,|$14.25$|,||,|LE-ZA-ME-INFANT-BONNET-GIRLS-CHECKERED-CHRISTMAS|,|$URL$le-za-me-infant-bonnet-girls-checkered-christmas.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-za-me-infant-bonnet-for-girls-checkered-christmas-1.jpg||-||Le' Za Me Infant Bonnet Pumpkin Spice|,|A cute baby girls gift, this new bonnet comes from the Le' Za Me line. The bonnet blends a coral red with lime, blue, and brown. The chevron stripes provide a modern feel on this vintage twist. The long straps tie into a large bow beneath her chin while a ruffle runs across the top. Off to the right side we find three hand turned rosettes. This item is simply darling in photos! 100% Cotton. Machine Wash in Cold Water. Tumble Dry Low. |,|$14.25$|,||,|LE-ZA-ME-INFANT-BONNET-PUMPKIN-SPICE|,|$URL$le-za-me-infant-bonnet-pumpkin-spice.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-za-me-infant-bonnet-pumpkin-spice-1.jpg||-||Le' Za Me Infant Girl Bonnet Happy Holiday|,|Created by Le' Za Me, this new baby bonnet for girls will help make her next photo shoot memorable and unique. The bonnet features a large, pale sky blue pattern. The red tie is set upon a scallop lined ruffle and creates a large bow under her chin. On the right side we find three matching rosettes. Other cute bonnets are also available from Le' Za Me, a design for everyone! 100% Cotton. Machine Wash in Cold Water. Tumble Dry Low. |,|$14.25$|,||,|LE-ZA-ME-INFANT-GIRL-BONNET-HAPPY-HOLIDAY|,|$URL$le-za-me-infant-girl-bonnet-happy-holiday.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-za-me-infant-girl-bonnet-happy-holiday-1.jpg||-||Lemon Love Lime Fuchsia Girls Ruffled Top (2, 4 & 5)|,|^|From designer Lemon Loves Lime, this fabulous new girls tee has been created as part of their ""Enchanted Garden"" collection for spring and summer. The dark pink top features a soft cotton fabric that is cut for a fitted look. The neckline has a slight curve found to it while both shoulders are wrapped with several ruffles to create the straps. This top can be easily paired with almost any of the Lemon Loves Lime bottoms! Be sure to check out the new skirts. ^||,|$29.00$|,||,|LEMON-LOVE-LIME-FUCHSIA-GIRLS-RUFFLED-TOP|,|$URL$lemon-love-lime-fuchsia-girls-ruffled-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-love-lime-fuchsia-girls-ruffled-top-6.jpg||-||Lemon Love Lime Girls Dress with Cupcake in Fuchsia|,|^|In the ""Summer Fun"" collection, this new girls dress was designed by Lemon Loves Lime. The hot pink dress has an easy fit that pulls on and is made with a soft fabric that feels great on her skin. A frilly fun design, the bodice of the dress features a single cupcake. The cup is decorated with quaint touches while the large frosting is made in a bright blue. A small flower is placed on top of the frosting. The sleeveless tunic fit is relaxed and easy to pull on. The skirt falls in an assymetrical hemline with a wide ruffle that dances with her movements. ^||,|$39.00$|,||,|LEMON-LOVE-LIME-GIRLS-DRESS-CUPCAKE-FUCHSIA|,|$URL$lemon-love-lime-girls-dress-cupcake-fuchsia.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-love-lime-girls-dress-with-cupcake-in-fuchsia-6.jpg||-||Lemon Love Lime Hummingbird Top in Fuchsia|,|In a hot fuchsia pink, this new Lemon Loves Lime girls top is hard to ignore. The tank has a a jewel neckline and wide straps. The top is fitted and allows slight stretch in its fabric. Her right shoulder is dressed with a romantic rosette with a lime green vine of leaves. Placed directly beside is a beautiful hummingbird applique. The gorgeous lime and purple coloring stands out. |,|$39.00$|,||,|LEMON-LOVE-LIME-HUMMINGBIRD-TOP-FUCHSIA|,|$URL$lemon-love-lime-hummingbird-top-fuchsia.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-love-lime-hummingbird-top-in-fuchsia-6.jpg||-||Lemon Love Lime Little Girls Top in Aqua|,|In cool aqua blue, Lemon Loves Lime is offering this adorable tank top for girls. The light blue is a popular shade for the season, making her feel like she belongs amongst the clouds. The top is cut for a fitted look and the comfortable fabric does allow slight stretch. The neckline is designed with ruffles that become the straps to the top. The layers of these ruffles have great volume to them to match her favorite new skirt or bottoms. |,|$29.00$|,||,|LEMON-LOVE-LIME-LITTLE-GIRLS-TOP-AQUA|,|$URL$lemon-love-lime-little-girls-top-aqua.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-love-lime-little-girls-top-in-aqua-6.jpg||-||Lemon Loves Lime Aqua Infant Headband|,|A gogeous light blue, this baby girls headband is a new creation by Lemon Loves Lime. The light blue fills the two large blooms worn off to one side of her head. Coordinating tulle fabric is layered within the flowers for a dreamy touch. This accessory has a comfortable, stretch fit around her head. |,|$14.00$|,||,|LEMON-LOVES-LIME-AQUA-INFANT-HEADBAND|,|$URL$lemon-loves-lime-aqua-infant-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-aqua-infant-headband-1.jpg||-||Lemon Loves Lime Baby Dancing Bows Dress PREORDER|,|^|Fit for a princess, this new dress comes from Lemon Loves Lime. The sleeveless bodice is perfect for spring and summer while the soft pink color is accented with ivory lace around the neckline. Straight ruffles fall from the empire waist while the hem is dressed with beautiful pink bows and lace. This dress is perfect for her first birthday pictures! 100% Pima Cotton. Please note that this is a PreOrder item and is NOT currently in stock. This Lemon Loves Lime Layette item is expected to arrive between January 15 thru April 15, 2015. ^||,|$59.00$|,||,|LEMON-LOVES-LIME-BABY-DANCING-BOWS-DRESS|,|$URL$lemon-loves-lime-baby-dancing-bows-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-baby-dancing-bows-dress-preorder-1.jpg||-||Lemon Loves Lime Baby Girl Dress Ruffled Red|,|This new adorable infant dress was designed by fabulous Lemon Loves Lime. The bodice has long sleeves and boasts of its clean lines and wrap V neck. The skirt opens almost to a full circle shape. Scallop tiers of ruffles are layered on the skirt like the frosting on a cake. This dress looks darling at first birthdays or any day of the week! The true red shade is perfect for holiday celebrations! 100% Cotton. Machine wash inside out in warm water. Tumble dry on low. |,|$42.00$|,||,|LEMON-LOVES-LIME-BABY-GIRL-DRESS-RUFFLED-RED|,|$URL$lemon-loves-lime-baby-girl-dress-ruffled-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-baby-girl-dress-ruffled-red-1.jpg||-||Lemon Loves Lime Baby Girls Dress in Light Pink|,|^|Created by Lemon Loves Lime, this baby girls dress is one that will not be forgotten. The light pink cotton is selected for its great quality and ""soft-to-the-touch"" feel, perfect for her baby skin. The sleeveless bodice has a jewel neckline. The skirt of this dress is draped in ruffles. The rows of fabric run straight from waist to hem. These ruffles make a darling detail in photographs! Cotton. Machine wash. ^||,|$36.80$|,||,|LEMON-LOVES-LIME-BABY-GIRLS-DRESS-LIGHT-PINK|,|$URL$lemon-loves-lime-baby-girls-dress-light-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-baby-girls-dress-in-light-pink-1.jpg||-||Lemon Loves Lime Baby Girls Holiday Cardigan|,|Bold in red, this fabulous holiday cardigan comes from the layette line by Lemon Loves Lime. The sweater is created with a classic neckline and long sleeves. The knit fabric is a warm staple for the season. A ring of poppies grace the neck with ruffle petals and a green center. A single button is fastened in the front to finish this look. A matching hat is also available from the collection while quantities last. 100% Cotton. Hand wash in warm water. Lay flat to dry. |,|$36.75$|,||,|LEMON-LOVES-LIME-BABY-GIRLS-HOLIDAY-CARDIGAN|,|$URL$lemon-loves-lime-baby-girls-holiday-cardigan.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-baby-girls-holiday-cardigan-18.jpg||-||Lemon Loves Lime Baby Mia Dress in Blue PREORDER|,|^|Bright and sunny in color, this fabulous spring and summer dress for baby girls comes from Lemon Loves Lime. The neckline is in a classic rounded shape while the bodice features an easy kimono pull over fit. The skirt of this dress receives a touch of drama in style. Rows and rows of ruffles fall in waves down the skirt, covering it in the same light blue fabric. This dress will not disappoint! Be sure to look for the matching accessories! Cotton. Machine wash. Please note that this is a PreOrder item and is NOT currently in stock. This Lemon Loves Lime Layette item is expected to arrive between January 15 thru April 15, 2015. ^||,|$42.00$|,||,|LEMON-LOVES-LIME-BABY-MIA-DRESS-BLUE|,|$URL$lemon-loves-lime-baby-mia-dress-blue.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-baby-mia-dress-in-blue-preorder-1.jpg||-||Lemon Loves Lime Baby Ruffle Dress in Purple|,|^|The ""Jada"" style from designer Lemon Loves Lime is a fabulous infant dress that is filled with sweet style. The dress offers a wrap, V neck and long sleeves perfect for the months from fall through spring. The light lilac is a color that will look fabulous no matter the season. Tiers of ruffles fall upon the skirt in a scallop shape and dress it up for any occasion. The skirt has almost a full circle shape. 100% Cotton. Machine wash inside out in warm water. Tumble dry on low. ^||,|$42.00$|,||,|LEMON-LOVES-LIME-BABY-RUFFLE-DRESS-PURPLE|,|$URL$lemon-loves-lime-baby-ruffle-dress-purple.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-baby-ruffle-dress-in-purple-1.jpg||-||Lemon Loves Lime Baby Ruffle Pants in Fuchsia|,|Absolutely adorable, these new Lemon Loves Lime infant pants are the perfect piece to add style to her every day look. The rich fuchsia pink is a pop of color that is always welcomed. The pants have an easy pull on fit with a stretch waistband to match the cuffs. Both legs are covered completely with rows of ruffled fabric. Whether she is out shopping with mom, at daycare, or taking photos, these pants are darling. 100% Cotton. Machine wash inside out in warm water. Tumble dry on low. |,|$26.00$|,||,|LEMON-LOVES-LIME-BABY-RUFFLE-PANTS-FUCHSIA|,|$URL$lemon-loves-lime-baby-ruffle-pants-fuchsia.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-baby-ruffle-pants-in-fuchsia-1.jpg||-||Lemon Loves Lime Bella Bloomer in Fuchsia (0-3 Mos & 6-12 Mos)|,|^|In a fabulous fuchsia, these new baby bloomers were created by Lemon Loves Lime. The dark pink bloomers offer a comfortable elastic waist and a stretch hemline that creates the ruffle that runs around both legs. The combination of the waist and the hemline make the bubble shape that bloomers are known for. These would pair perfectly under her new dress! SIZE 0-3 MOS AND 6-12 MOS ONLY LEFT. ^||,|$12.80$|,||,|LEMON-LOVES-LIME-BELLA-BLOOMER-FUCHSIA|,|$URL$lemon-loves-lime-bella-bloomer-fuchsia.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-bella-bloomer-in-fuchsia-7.jpg||-||Lemon Loves Lime Bella Bloomer in Light Pink|,|Whether they are paired beneath her dress, or matched with her onesies, these darling baby bloomers from Lemon Loves Lime are lovely. The soft light pink cotton fabric was selected to be delicate on her new skin. The bloomer style bubbles out and is gathered with an elastic hem on both legs. This elastic causes a cute rufle to run around both of her legs. Cotton. Machine wash. |,|$12.80$|,||,|LEMON-LOVES-LIME-BELLA-BLOOMER-LIGHT-PINK|,|$URL$lemon-loves-lime-bella-bloomer-light-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-bella-bloomer-in-light-pink-1.jpg||-||Lemon Loves Lime Blossom Tank in White for Girls PREORDER|,|^|Such a cute racer back style, this tank top is the perfect match to any of her new Lemon Loves Lime shorts or skirts. The neckline creates a ruffled strap that wraps around to her back. More ruffles accent the neckline and the back of the top in between her shoulders. This shirt is cut for a fitted look, while the hem offers another tiny ruffle detail. Please note that this is a PreOrder item and is NOT currently in stock. This Lemon Loves Lime item is expected to arrive between January 15 thru March 25, 2015. ^||,|$28.00$|,||,|LEMON-LOVES-LIME-BLOSSOM-TANK-WHITE-GIRLS|,|$URL$lemon-loves-lime-blossom-tank-white-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-blossom-tank-in-white-for-girls-preorder-1.jpg||-||Lemon Loves Lime Blue Dancing Bows Infant Dress PREORDER|,|^|Fit for a princess, this new dress comes from Lemon Loves Lime. The sleeveless bodice is perfect for spring and summer while the soft blue color is accented with ivory lace around the neckline. Straight ruffles fall from the empire waist while the hem is dressed with beautiful icy blue bows and lace. This dress is perfect for any spring occasion! 100% Pima Cotton. Please note that this is a PreOrder item and is NOT currently in stock. This Lemon Loves Lime Layette item is expected to arrive between January 15 thru April 15, 2015. ^||,|$59.00$|,||,|LEMON-LOVES-LIME-BLUE-DANCING-BOWS-INFANT-DRESS|,|$URL$lemon-loves-lime-blue-dancing-bows-infant-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-blue-dancing-bows-infant-dress-preorder-1.jpg||-||Lemon Loves Lime Blue Ruffle Shorts for Girls PREORDER|,|^|A perfect new separate to create fanciful outfits this spring, these girls ruffle shorts comes from designer Lemon Loves Lime. The soft ivory cotton shorts boast of an elastic fit waist while aqua blue ruffles fall down the shorts down from the hem. 100% Pima Cotton. Please note that this is a PreOrder item and is NOT currently in stock. This Lemon Loves Lime item is expected to arrive between January 15 thru March 25, 2015. ^||,|$39.00$|,||,|LEMON-LOVES-LIME-BLUE-RUFFLE-SHORTS-GIRLS|,|$URL$lemon-loves-lime-blue-ruffle-shorts-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-blue-ruffle-shorts-for-girls-preorder-1.jpg||-||Lemon Loves Lime Buttercup Infant Dress (0-3 Mos, 3/6 Mos & 6/12 Mos)|,|Made from a fairytale, this new designer baby dress comes from Lemon Loves Lime. The bright fuchsia pink owns the summer while the sleeveless neckline makes it easy to pair a light sweater with the dress if the air holds a touch of chill. The skirt opens in shape and falls down to a scallop hemline. Lime green threading accent the ruffles which divide the skirt when falling from the waist. |,|$36.00$|,||,|LEMON-LOVES-LIME-BUTTERCUP-INFANT-DRESS|,|$URL$lemon-loves-lime-buttercup-infant-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-buttercup-infant-dress-6.jpg||-||Lemon Loves Lime Cake Cream Skirt in Pink (4 & 8)|,|^|Matching several new tops, this fabulous girls skirt from designer Lemon Loves Lime is like the frosting on top of the cake. The stretch waist has a great pull on fit that is perfect for her to pick out herself! The skirt opens to a full circle shape, allowing extra fabric to drape around her legs and dance along with every step. Layers of ruffles are tiered down the skirt. These ruffles alternate between the bright fuchsia and the two lighter pinks that fill the new summer collection. This adorable pink skirt is perfect for her next birthday celebration! SISE 4 AND 8 ONLY REMAINING.  ^||,|$39.00$|,||,|LEMON-LOVES-LIME-CAKE-CREAM-SKIRT-PINK|,|$URL$lemon-loves-lime-cake-cream-skirt-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-cake-cream-skirt-in-pink-7.jpg||-||Lemon Loves Lime Cozy Flower Clip in Purple|,|New from Lemon Loves Lime, this girls flower clip is so pretty. The crocheted petals have a life like shape while the rounded center is the same grape color. |,|$5.00$|,||,|LEMON-LOVES-LIME-COZY-FLOWER-CLIP-PURPLE|,|$URL$lemon-loves-lime-cozy-flower-clip-purple.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-cozy-flower-clip-in-purple-11.jpg||-||Lemon Loves Lime Dancing Bows Dress for Baby PREORDER|,|^|Fit for a princess, this new dress comes from Lemon Loves Lime. The sleeveless bodice is perfect for spring and summer while the soft yellow color is accented with ivory lace around the neckline. Straight ruffles fall from the empire waist while the hem is dressed with beautiful yellow bows and lace. This dress is perfect for any spring occasion! 100% Pima Cotton. Please note that this is a PreOrder item and is NOT currently in stock. This Lemon Loves Lime Layette item is expected to arrive between January 15 thru April 15, 2015. ^||,|$59.00$|,||,|LEMON-LOVES-LIME-DANCING-BOWS-DRESS-BABY|,|$URL$lemon-loves-lime-dancing-bows-dress-baby.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-dancing-bows-dress-for-baby-preorder-1.jpg||-||Lemon Loves Lime Designer Baby Sweater Ivory|,|Designed by the creative minds at Lemon Loves Lime, this sweet baby sweater is from the fall 2014 layette collection. A single button is fastened on the top of the front while the long sleeves and soft knit adds warmth to her outfit. Four flower accents sit upon the neckline. These flowers boast of light pink ruffles and a bold green center. Pair the matching hat to complete her outfit. 100% Cotton. Hand wash in warm water. Lay flat to dry. |,|$36.75$|,||,|LEMON-LOVES-LIME-DESIGNER-BABY-SWEATER-IVORY|,|$URL$lemon-loves-lime-designer-baby-sweater-ivory.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-designer-baby-sweater-ivory-18.jpg||-||Lemon Loves Lime Do A Dance Cascade Green Skirt (2)|,|^|A perfect new separate to create fanciful outfits this spring, this girls skirt comes from designer Lemon Loves Lime. The soft daiquiri green cotton skirt boasts of an elastic fit waist while ruffles fall down the skirt creating an uneven hemline. Made from cotton. Machine wash warm, tumble dry low. SIZE 2 ONLY LEFT.  ^||,|$19.00$|,||,|LEMON-LOVES-LIME-DO-A-DANCE-CASCADE-GREEN-SKIRT|,|$URL$lemon-loves-lime-do-a-dance-cascade-green-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-do-a-dance-cascade-green-skirt-18.jpg||-||Lemon Loves Lime Emma Cardigan for Infants Pink (12/18 Mos & 18/24 Mos)|,|^|Helping to keep your little girl warm in the cooler months, this new knit sweater from designer Lemon Loves Lime really takes the cake. This cardigan features a classic fit and long sleeves. The front is covered with rows of ruffles in a semi circle pattern. Mair with the Jada Dress for a stunning outfit! Made with 100% prima cotton. Machine wash gentle, tumble dry on low. SIZE 12/18 MOS AND 18/24 MOS ONLY LEFT. ^||,|$29.00$|,||,|LEMON-LOVES-LIME-EMMA-CARDIGAN-INFANTS-PINK|,|$URL$lemon-loves-lime-emma-cardigan-infants-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-emma-cardigan-for-infants-pink-3.jpg||-||Lemon Loves Lime Everyday Girls Dress PREORDER|,|^|This new adorable dress was designed by fabulous Lemon Loves Lime with sisters in mind. The sleeveless bodice boasts of its clean lines. The skirt opens almost to a full circle shape. Scallop tiers of ruffles are layered on the skirt like the frosting on a cake. This dress looks darling at birthday parties or any day of the week! Please note that this is a PreOrder item and is NOT currently in stock. This Lemon Loves Lime item is expected to arrive between January 15 thru March 25, 2015. ^||,|$59.00$|,||,|LEMON-LOVES-LIME-EVERYDAY-GIRLS-DRESS|,|$URL$lemon-loves-lime-everyday-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-everyday-girls-dress-preorder-1.jpg||-||Lemon Loves Lime Fancy Little Girls Shorts PREORDER|,|^|A perfect new separate to create fanciful outfits this spring, these girls ruffle shorts comes from designer Lemon Loves Lime. The soft cotton shorts boast of an elastic fit waist while bold raspberry ruffles fall down the shorts down from the hem. 100% Pima Cotton. Please note that this is a PreOrder item and is NOT currently in stock. This Lemon Loves Lime item is expected to arrive between January 15 thru March 25, 2015. ^||,|$39.00$|,||,|LEMON-LOVES-LIME-FANCY-LITTLE-GIRLS-SHORTS|,|$URL$lemon-loves-lime-fancy-little-girls-shorts.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-fancy-little-girls-shorts-preorder-1.jpg||-||Lemon Loves Lime Fish Dress in White (2 & 4)|,|^|A new creation from designer Lemon Loves Lime, this girls dress is sure to be a favorite summer outfit! The drop waist bodice has a tank fit with a sleeveless jewel neckline. The fabric allows slight stretch with its pull on fit. The skirt of this dress is wrapped with three tiers of solid white ruffles. A colorful fish is found upon the front. This applique is colored in bright lime and coral. A few bubbles are placed near where he swims. SIZE 2 AND 4 ONLY AVAILABLE. ^||,|$39.00$|,||,|LEMON-LOVES-LIME-FISH-DRESS-WHITE|,|$URL$lemon-loves-lime-fish-dress-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-fish-dress-in-white-6.jpg||-||Lemon Loves Lime Frog Necklace for Girls|,|One of Lemon Loves Lime's beautiful handmade necklace designs, this new arrival will have her leaping for joy. The necklace features a fun crochet frog sitting front and center while other crochet designs adorn the necklace as well. The final adornment fits through a loop in place of a clasp. Spot clean with damp cloth. Air dry. |,|$13.00$|,||,|LEMON-LOVES-LIME-FROG-NECKLACE-GIRLS|,|$URL$lemon-loves-lime-frog-necklace-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-frog-necklace-for-girls-1.jpg||-||Lemon Loves Lime Fuchsia Baby Hat with Flowers|,|^|An adorable creation by Lemon Loves Lime, this new infant girls hat is part of their ""Floral Collection."" The rich fuchsia knit is soft and filled with warmth. The bright color stands out during the season while the hem is a ribbed knit. Two mum accents in lilac are worn off to one side and complete with a pink center. This hat matches the ""Lemon Loves Lime Infant Girls Cardigan Poppy Fuchsia"". 100% Cotton. Hand wash in warm water. Lay flat to dry. ^||,|$34.00$|,||,|LEMON-LOVES-LIME-FUCHSIA-BABY-HAT-FLOWERS|,|$URL$lemon-loves-lime-fuchsia-baby-hat-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-fuchsia-baby-hat-with-flowers-1.jpg||-||Lemon Loves Lime Fuchsia Girls Twirly Dress|,|Sure to be loved the moment she puts it on, this fun new dress for girls was designed by Lemon Loves Lime. The hot pink fabric stands out amongst all the other colors that are sure to fill the summer months. The fitted bodice has a square neckline. The wide shoulder straps have slight gathering found at their base to allow for a pleasing shape. The skirt opens in shape and is tiered in four layers of ruffles. These ruffles are created from her dreams as they twirl about with ease. |,|$49.00$|,||,|LEMON-LOVES-LIME-FUCHSIA-GIRLS-TWIRLY-DRESS|,|$URL$lemon-loves-lime-fuchsia-girls-twirly-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-fuchsia-girls-twirly-dress-6.jpg||-||Lemon Loves Lime Fuchsia Headband|,|Bold in fuchsia, this bright new headband from Lemon Loves Lime is available in infant sizes. The rich pink band is solid in color and has the perfect stretch for comfort. The matching pink flower blooms are worn off to one side of her head while tulle is layered within the flower itself. |,|$14.00$|,||,|LEMON-LOVES-LIME-FUCHSIA-HEADBAND|,|$URL$lemon-loves-lime-fuchsia-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-fuchsia-headband-1.jpg||-||Lemon Loves Lime Fuchsia Legging for Girls (2 & 3)|,|^|Every little girls closet needs a pair of fuchsia leggings, such an easy wash and wear item. Soft Peruvian cotton knit with elastic waistband. Three tiers of ruffles complete the look. Made to match Lemon Loves Limes tops, dresses, top and skirts. 100% cotton. Machine wash warm water, inside out, gentle cycle. Low heat tumble dry. SIZE 2 AND 3 REMAINING.  ^||,|$29.00$|,||,|LEMON-LOVES-LIME-FUCHSIA-LEGGING-GIRLS|,|$URL$lemon-loves-lime-fuchsia-legging-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-fuchsia-legging-for-girls-1.jpg||-||Lemon Loves Lime Fuchsia Ruffle Infant Hat|,|^|Ruffled for fun, this new infant hat comes from designer Lemon Loves Lime. The fuchsia pink hat matches several new arrivals from their fall season. The knit hat offers a fitted look of warmth. The rows of ruffles wrap around the hat at an angle. Created with 100% pima cotton. When needed, machine wash on gentle and tumble dry on low. SIZE 0/3 MOS AND 18/24 MOS ONLY LEFT. ^||,|$28.00$|,||,|LEMON-LOVES-LIME-FUCHSIA-RUFFLE-INFANT-HAT|,|$URL$lemon-loves-lime-fuchsia-ruffle-infant-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-fuchsia-ruffle-infant-hat-3.jpg||-||Lemon Loves Lime Fuchsia Ruffle Romper for Girls|,|Turn heads in this sassy but sweet fuchsia ruffle romper by Lemon Loves Lime. The gorgeous long sleeved bodice is made from a soft fabric that is delicate on your baby girl's skin, while a ruffle embellishes the neckline. A single ruffle fabric flower is placed on the waistline with ruffles swooping down from waist to hem. The full diaper changing snaps make dressing and changing baby easier for mom. Romper is made of 100% pima cotton. Please machine wash gentle and tumble try on low to maintain this item's beauty. |,|$49.00$|,||,|LEMON-LOVES-LIME-FUCHSIA-RUFFLE-ROMPER-GIRLS|,|$URL$lemon-loves-lime-fuchsia-ruffle-romper-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-fuchsia-ruffle-romper-for-girls-3.jpg||-||Lemon Loves Lime Fuchsia Ruffled Infant Gown|,|Whether she is arriving home from the hospital or posing for the camera, this new Lemon Loves Lime baby gown will suite her sweet smile perfectly. The pink fabric is delicate on her skin and features ruffled accents embellishing the wrap neckline and the waist. The long sleeves help to keep her warm while the skirts elastic ruffled hemline keeps her little toes bundled. Made with 100% prima cotton. Machine wash gentle, tumble dry on low. |,|$34.00$|,||,|LEMON-LOVES-LIME-FUCHSIA-RUFFLED-INFANT-GOWN|,|$URL$lemon-loves-lime-fuchsia-ruffled-infant-gown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-fuchsia-ruffled-infant-gown-3.jpg||-||Lemon Loves Lime Giraffe Girls Top with Skort ( 4 )|,|^|Designed by whimsical Lemon Loves Lime, this girls spring and summer outfit is too adorable! The rose shadow tank boasts of fringe fluttering on her shoulders while the two sweet giraffes are cuddling on the front. Paired with the pink lemonade skort boasting of its fun tiers of ruffles and comfortable waist. Made from cotton. Machine wash warm, tumble dry low. DEEPLY DISCOUNTED DUE TO PINHOLE-SIZE BLACK DOT ON FRONT. MAY POSSIBLY COME OUT IN WASH. (1) SIZE 4 ONLY AVAILABLE. ^||,|$29.00$|,||,|LEMON-LOVES-LIME-GIRAFFE-GIRLS-TOP-SKORT|,|$URL$lemon-loves-lime-giraffe-girls-top-skort.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-giraffe-girls-top-with-skort-17.jpg||-||Lemon Loves Lime Girls Blue Bow Skirt PREORDER|,|^|Lemon Loves Lime brings us this adorable bow skirt to match her little sister's dress. Made in a beautiful icy blue, this skirt is truly timeless. Straight ruffles fall from the elastic waistband while the hem is dressed with beautiful bows with lace around the hem. This skirt is perfect for her birthday! 100% Pima Cotton. Please note that this is a PreOrder item and is NOT currently in stock. This Lemon Loves Lime item is expected to arrive between January 15 thru March 25, 2015. ^||,|$58.00$|,||,|LEMON-LOVES-LIME-GIRLS-BLUE-BOW-SKIRT|,|$URL$lemon-loves-lime-girls-blue-bow-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-girls-blue-bow-skirt-preorder-1.jpg||-||Lemon Loves Lime Girls Fuchsia Skirt (Size 2)|,|^|From fabulous designer Lemon Loves Lime, this girls skirt will spark any young girls creativity! The pink lemonade skirt is made with soft and comfortable cotton with a stretch fit waist. The falling ruffles dangle past the hem for a cute look and catch the wind with her movement. Made from cotton. Machine wash warm, tumble dry low. ONE SIZE 2 ONLY LEFT. ^||,|$18.33$|,||,|LEMON-LOVES-LIME-GIRLS-FUCHSIA-SKIRT|,|$URL$lemon-loves-lime-girls-fuchsia-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-girls-fuchsia-skirt-14.jpg||-||Lemon Loves Lime Girls Hooray Seahorse Tank PREORDER|,|^|In a soft pink, this new Lemon Loves Lime top is filled with splish splash style. The unique shade of pink is defined perfectly with the blend of ivory details. The large seahorse applique has adorable sequin and lace details. A tiny rhinestone bow is found right at the center of the neckline. The ruffled sleeves add a fanciful detail that is both feminine and fun. Please note that this is a PreOrder item and is NOT currently in stock. This Lemon Loves Lime item is expected to arrive between January 15 thru March 25, 2015. ^||,|$56.00$|,||,|LEMON-LOVES-LIME-GIRLS-HOORAY-SEAHORSE-TANK|,|$URL$lemon-loves-lime-girls-hooray-seahorse-tank.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-girls-hooray-seahorse-tank-preorder-1.jpg||-||Lemon Loves Lime Girls Ivory Whisper Wish Dress PREORDER|,|^|Soft and elegant in ivory, this cute Lemon Loves Lime dress is ready to accompany her anywhere. The sleeveless style is accented with fluttering lace around the edges. The soft ivory cotton fabric allows slight stretch and is completely comfortable. The skirt has a crocheted lace detail while two layers of ruffles complete the look. The bodice is cut for an a line style. Please note that this is a PreOrder item and is NOT currently in stock. This Lemon Loves Lime item is expected to arrive between January 15 thru March 25, 2015. ^||,|$78.00$|,||,|LEMON-LOVES-LIME-GIRLS-IVORY-WHISPER-WISH-DRESS|,|$URL$lemon-loves-lime-girls-ivory-whisper-wish-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-girls-ivory-whisper-wish-dress-preorder-1.jpg||-||Lemon Loves Lime Girls Legging Aqua (2)|,|^|There's one thing we know for sure, Lemon Loves Lime offers a super soft cotton legging. The easy pull on style legging has a nice wide waistband with triple ruffled hem. Pair it with her favorite dress or top for a cute summer look that will take her back to school in the fall. 100% cotton. Machine wash warm water, inside out, gentle cycle. Low heat tumble dry. ONE SIZE 2 ONLY LEFT. ^||,|$29.00$|,||,|LEMON-LOVES-LIME-GIRLS-LEGGING-AQUA|,|$URL$lemon-loves-lime-girls-legging-aqua.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-girls-legging-aqua-6.jpg||-||Lemon Loves Lime Girls Lucky Ladybug Tank Top PREORDER|,|^|The perfect summer top, this styles comes to us from Lemon Loves Lime. The navy blue trapeze style top is perfect for spring and summer with it's sleeveless cut. The neckline is dressed with a fun pink flower applique and a tiny lady bug. Pair this top with any of her new shorts or skirts for a fun summer look! Please note that this is a PreOrder item and is NOT currently in stock. This Lemon Loves Lime item is expected to arrive between January 15 thru March 25, 2015. ^||,|$49.00$|,||,|LEMON-LOVES-LIME-GIRLS-LUCKY-LADYBUG-TANK-TOP|,|$URL$lemon-loves-lime-girls-lucky-ladybug-tank-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-girls-lucky-ladybug-tank-top-preorder-1.jpg||-||Lemon Loves Lime Girls Shrug in Lilac Summer PREORDER|,|^|The perfect topper to any of her new spring dresses, this Princess Cape comes to us from Lemon Loves Lime. An adorable style, this design has a crocheted lace back and shoulders, as well as all the way around the hem. Tiny pin tucked ruffles hit her shoulders, while the front is made to tie around her shoulders to keep her warm in the spring. Please note that this is a PreOrder item and is NOT currently in stock. This Lemon Loves Lime item is expected to arrive between January 15 thru March 25, 2015. ^||,|$49.00$|,||,|LEMON-LOVES-LIME-GIRLS-SHRUG-LILAC-SUMMER|,|$URL$lemon-loves-lime-girls-shrug-lilac-summer.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-girls-shrug-in-lilac-summer-preorder-1.jpg||-||Lemon Loves Lime Girls Summer Dress Butterfly Bow PREORDER|,|^|With sweet summer style, this new dress comes from Lemon Loves Lime. The sleeveless bodice is perfect for spring and summer while the soft pink outlining is accented with white ruffles around the neckline. Straight ruffles in fun stripes and confetti dots fall from the empire waist while the hem is dressed with beautiful bows. This dress is perfect for any spring or summer occasion! 100% Pima Cotton. Please note that this is a PreOrder item and is NOT currently in stock. This Lemon Loves Lime item is expected to arrive between January 15 thru March 25, 2015. ^||,|$69.00$|,||,|LEMON-LOVES-LIME-GIRLS-SUMMER-DRESS-BUTTERFLY-BOW|,|$URL$lemon-loves-lime-girls-summer-dress-butterfly-bow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-girls-summer-dress-butterfly-bow-preorder-1.jpg||-||Lemon Loves Lime Girls Twirly Dress in Aqua|,|Bright and bold in blue, this cute Lemon Loves Lime dress is ready to accompany her anywhere. The wide straps create the square, wide neckline that is featured on this piece. The aqua blue fabric allows slight stretch and is completely comfortable. The tiered skirt has four layers of ruffles, these twirl about with her in a carefree spirit. The bodice is cut for a fitted look. |,|$49.00$|,||,|LEMON-LOVES-LIME-GIRLS-TWIRLY-DRESS-AQUA|,|$URL$lemon-loves-lime-girls-twirly-dress-aqua.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-girls-twirly-dress-in-aqua-6.jpg||-||Lemon Loves Lime Handmade Baby Hat Red Poppy|,|^|Designed to match the ""Poppy"" cardigan, this new baby girls hat is a part of the fall 2014 collection by Lemon Loves Lime. The hat is knit with a bold red that is comfortable and warm. A large poppy flower is placed off centered from the front of the hat. This bloom is created with ruffles of red alternated with cream and finished with a green center. This hat will be loved all season long! 100% Cotton. Hand wash in warm water. Lay flat to dry. ^||,|$21.75$|,||,|LEMON-LOVES-LIME-HANDMADE-BABY-HAT-RED-POPPY|,|$URL$lemon-loves-lime-handmade-baby-hat-red-poppy.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-handmade-baby-hat-red-poppy-1.jpg||-||Lemon Loves Lime Ice Cream Parlor Dress|,|Lemon Loves Lime is now offering this darling little girls dress as a part of their new summer collection. The sleeveless bodice is fitted and has slight stretch found in its fabric. Attention is drawn to the neckline with three colorful ruffles in yellow, blue, and lime. A pink lemon ruffle dresses the waistline. The skirt opens to about a half circle shape while four icecream cones sit near the ruffle hemline. The touch of blue to finish the piece is a perfect choice. These bold colors are sure to fill any summer day with fun! |,|$49.00$|,||,|LEMON-LOVES-LIME-ICE-CREAM-PARLOR-DRESS|,|$URL$lemon-loves-lime-ice-cream-parlor-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-ice-cream-parlor-dress-16.jpg||-||Lemon Loves Lime Infant Flower Hat Ivory and Pink (0-3 Mos)|,|^|A fun accessory from the new fall 2014 collection, this baby girls hat comes from Lemon Loves Lime. A large flower created with pink ruffles is set off to one side of the front. The green center stands out on the bloom and matches the flower centers on her new ""Poppy"" cardigan. The ivory knit hat is a comfortable fit that will help keep your baby girl warm and snug. 100% Cotton. Hand wash in warm water. Lay flat to dry. SIZE 0-3 MOS ONLY LEFT. ^||,|$21.75$|,||,|LEMON-LOVES-LIME-INFANT-FLOWER-HAT-IVORY-PINK|,|$URL$lemon-loves-lime-infant-flower-hat-ivory-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-infant-flower-hat-ivory-and-pink-1.jpg||-||Lemon Loves Lime Infant Girl Hydrangea Dress PREORDER|,|^|An adorable little spring dress, this new styles comes from Lemon Loves Lime. It's sleeveless style is perfect for spring and summer, while the neckline is dressed up with ruffles. The empire waist bodice is simply adorable while the flowing skirt is decorated with different shades of pink crocheted flowers dancing around the hem. Made with 100% Pima Cotton. Please note that this is a PreOrder item and is NOT currently in stock. This Lemon Loves Lime Layette item is expected to arrive between January 15 thru April 15, 2015. ^||,|$59.00$|,||,|LEMON-LOVES-LIME-INFANT-GIRL-HYDRANGEA-DRESS|,|$URL$lemon-loves-lime-infant-girl-hydrangea-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-infant-girl-hydrangea-dress-preorder-1.jpg||-||Lemon Loves Lime Infant Girls Cardigan Poppy Fuchsia (3/6 Mos, 18/24 Mos)|,|^|A soft sweater that will look adorable over her knew Lemon Loves Lime outfits, this design is a must have! The knit fabric is soft on her skin and colored in a bright fuchsia. The front is dressed with a trio of lilac mums that fall down the center. The long sleeves add warmth while a single button fastens on the neckline. Also available for purchase is a matching hat! 100% Cotton. Hand wash in warm water. Lay flat to dry. SIZE 3/6 MOS & 18/24 MOS ONLY LEFT.  ^||,|$36.75$|,||,|LEMON-LOVES-LIME-INFANT-GIRLS-CARDIGAN-POPPY-FUCHSIA|,|$URL$lemon-loves-lime-infant-girls-cardigan-poppy-fuchsia.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-infant-girls-cardigan-poppy-fuchsia-18.jpg||-||Lemon Loves Lime Infant Girls Dress in Fuchsia|,|Bright and warm in color, this fabulous spring and summer dress for baby girls comes from Lemon Loves Lime. The sleeveless neckline is in a classic rounded shape while the bodice features an easy pull over fit. The skirt of this dress receives a touch of drama in style. Rows and rows of ruffles fall in straight lines down the skirt, covering it in the same fuchsia fabric. This dress will not dissapoint! Be sure to look for the matching accessories! Cotton. Machine wash. |,|$36.80$|,||,|LEMON-LOVES-LIME-INFANT-GIRLS-DRESS-FUCHSIA|,|$URL$lemon-loves-lime-infant-girls-dress-fuchsia.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-infant-girls-dress-in-fuchsia-1.jpg||-||Lemon Loves Lime Infant Girls Hats Lilac Ruffles|,|Matching several new arrivals from Lemon Loves Lime, this hat for baby girls is created in the same lovely lilac that is used to create dresses and rompers alike. The hat has a classic shape with a twist. The entire piece is covered with ruffles from the crown of her head down to the hem. These ruffles are such a darling accent upon the hat and speak volumes of style in photographs! 100% Cotton. Machine wash inside out in warm water. Tumble dry on low. |,|$28.00$|,||,|LEMON-LOVES-LIME-INFANT-GIRLS-HATS-LILAC-RUFFLES|,|$URL$lemon-loves-lime-infant-girls-hats-lilac-ruffles.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-infant-girls-hats-lilac-ruffles-1.jpg||-||Lemon Loves Lime Infant Headband in Blue PREORDER|,|^|Adorable in light blue, this bright new headband from Lemon Loves Lime is available in infant sizes. The candy colored band is solid in color and has the perfect stretch for comfort. The matching blue flower blooms are worn off to one side of her head while tulle is layered within the flower itself. Please note that this is a PreOrder item and is NOT currently in stock. This Lemon Loves Lime Layette item is expected to arrive between January 15 thru April 15, 2015. ^||,|$14.00$|,||,|LEMON-LOVES-LIME-INFANT-HEADBAND-BLUE|,|$URL$lemon-loves-lime-infant-headband-blue.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-infant-headband-in-blue-preorder-1.jpg||-||Lemon Loves Lime Infant Romper By the Sea PREORDER|,|^|Sweet as can be, this new infant girls romper comes from Lemon Loves Lime. The sleeveless bodice boasts of an adorable pink stripe in oh so soft cotton. The legs are wrapped with draping ruffle rows down to the hemline. Classic changing snaps line the inner legs to make things easier for mom. Made with 100% pima cotton. Please note that this is a PreOrder item and is NOT currently in stock. This Lemon Loves Lime Layette item is expected to arrive between January 15 thru April 15, 2015. ^||,|$56.00$|,||,|LEMON-LOVES-LIME-INFANT-ROMPER-BY-SEA|,|$URL$lemon-loves-lime-infant-romper-by-sea.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-infant-romper-by-the-sea-preorder-1.jpg||-||Lemon Loves Lime Infant Ruffle Pants in Purple|,|Also available in other colors while quantities last, these new baby girl pants are from Lemon Loves Lime. The star of this cute style is the layers of ruffles that wrap around both legs. The stretch fit waist pulls on with ease while matching the hem on both legs. These pants are unlike any other in your babies closet and are sure to receive many compliments! They also make the perfect piece for photographs! 100% Cotton. Machine wash inside out in warm water. Tumble dry on low. |,|$26.00$|,||,|LEMON-LOVES-LIME-INFANT-RUFFLE-PANTS-PURPLE|,|$URL$lemon-loves-lime-infant-ruffle-pants-purple.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-infant-ruffle-pants-in-purple-1.jpg||-||Lemon Loves Lime Ivory Hat for Baby Girls with Flower|,|^|Newly created by Lemon Loves Lime, this darling knit hat is the perfect match to her new ""Poppy"" cardigan. The hat is created in a light ivory and is a warm addition. An oversized bloom is set off to one side of the front, creating the perfect accent. This flower is in true red and ivory and is created with ruffles. The center of the flower is finished with a touch of green. 100% Cotton. Hand wash in warm water. Lay flat to dry. ^||,|$21.75$|,||,|LEMON-LOVES-LIME-IVORY-HAT-BABY-GIRLS-FLOWER|,|$URL$lemon-loves-lime-ivory-hat-baby-girls-flower.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-ivory-hat-for-baby-girls-with-flower-1.jpg||-||Lemon Loves Lime Ivory Isabel Hat with Ruffles (6/12 Mos & 18/24 Mos)|,|^|To go with her darling new Lemon Loves Lime pieces for the fall season, this new hat couldn't be more perfect! The infant hat boasts of its soft cotton blend fabric that hugs her head and gives her warmth. The rows of ruffles wrap around in unique angles. Created with 100% prima cotton. When needed, machine wash on gentle and tumble dry on low. SIZE 6/12 MOS & 18/24 MOS ONLY LEFT. ^||,|$28.00$|,||,|LEMON-LOVES-LIME-IVORY-ISABEL-HAT-RUFFLES|,|$URL$lemon-loves-lime-ivory-isabel-hat-ruffles.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-ivory-isabel-hat-with-ruffles-2.jpg||-||Lemon Loves Lime Lilac Infant Headband|,|Lemon Loves Lime is now offering this baby girls hair accessory to match her new outfits! The soft lilac is a shade that will go with many of her new clothes. The stretch band is worn around her head and decorated with two flowers. The purple flowers are a blend of a solid fabric with the whimsical tulle. |,|$14.00$|,||,|LEMON-LOVES-LIME-LILAC-INFANT-HEADBAND|,|$URL$lemon-loves-lime-lilac-infant-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-lilac-infant-headband-1.jpg||-||Lemon Loves Lime Little Girls Designer Dress PREORDER|,|^|This new adorable dress was designed by fabulous Lemon Loves Lime with sisters in mind. The sleeveless bodice boasts of its clean lines. The skirt opens almost to a full circle shape. Scallop tiers of ruffles are layered on the skirt like the frosting on a cake. This dress looks darling at birthday parties or any day of the week! Please note that this is a PreOrder item and is NOT currently in stock. This Lemon Loves Lime item is expected to arrive between January 15 thru March 25, 2015. ^||,|$59.00$|,||,|LEMON-LOVES-LIME-LITTLE-GIRLS-DESIGNER-DRESS|,|$URL$lemon-loves-lime-little-girls-designer-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-little-girls-designer-dress-preorder-1.jpg||-||Lemon Loves Lime Make a Wish Upon a Starfish Girls Tank PREORDER|,|^|In a cool icy blue, Lemon Loves Lime is offering this adorable tank top for girls. The light blue is a popular shade for the season, making her feel like she belongs amongst the clouds. The top is cut for a fitted look and the comfortable fabric does allow slight stretch. The neckline is designed with lace ruffles that enhance the straps to the top, and wrap around the neckline as well. A bedazzled beach scene sits upon the front of the top.Please note that this is a PreOrder item and is NOT currently in stock. This Lemon Loves Lime item is expected to arrive between January 15 thru March 25, 2015. ^||,|$54.00$|,||,|LEMON-LOVES-LIME-MAKE-WISH-UPON-STARFISH-GIRLS-TANK|,|$URL$lemon-loves-lime-make-wish-upon-starfish-girls-tank.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-make-a-wish-upon-a-starfish-girls-tank-preorder-1.jpg||-||Lemon Loves Lime Mia Ruffle Dress for Baby PREORDER|,|^|The ""Mia"" style from designer Lemon Loves Lime is a fabulous infant dress that is filled with sweet ruffles. The dress offers a sleeveless kimono style perfect for the spring months. The white is a color that will look fabulous no matter the season. Tiers of ruffles fall upon the skirt in a scallop shape and dress it up for any occasion. The skirt has almost a full circle shape. 100% Pima Cotton. Please note that this is a PreOrder item and is NOT currently in stock. This Lemon Loves Lime Layette item is expected to arrive between January 15 thru April 15, 2015. ^||,|$42.00$|,||,|LEMON-LOVES-LIME-MIA-RUFFLE-DRESS-BABY|,|$URL$lemon-loves-lime-mia-ruffle-dress-baby.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-mia-ruffle-dress-for-baby-preorder-1.jpg||-||Lemon Loves Lime Monarch Princess Cape PREORDER|,|^|The perfect topper to any of her new spring dresses, this Princess Cape comes to us from Lemon Loves Lime. An adorable style, this design has a crocheted lace back and shoulders, as well as all the way around the hem. Tiny pin tucked ruffles hit her shoulders, while the front is made to tie around her shoulders to keep her warm in the spring. Please note that this is a PreOrder item and is NOT currently in stock. This Lemon Loves Lime item is expected to arrive between January 15 thru March 25, 2015. ^||,|$49.00$|,||,|LEMON-LOVES-LIME-MONARCH-PRINCESS-CAPE|,|$URL$lemon-loves-lime-monarch-princess-cape.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-monarch-princess-cape-preorder-1.jpg||-||Lemon Loves Lime Nautical Red and White Girls Skort PREORDER|,|^|In nautical style, this fabulous skort from designer Lemon Loves Lime is like the frosting on top of the cake. The stretch waist has a great pull on fit that is perfect for her to pick out herself! The skirt opens to a full circle shape, allowing extra fabric to drape around her legs and dance along with every step. Layers of striped ruffles are draped down the skirt. This adorable skort has the look of a skirt with soft cotton shorts paired beneath, perfect for summer! Please note that this is a PreOrder item and is NOT currently in stock. This Lemon Loves Lime item is expected to arrive between January 15 thru March 25, 2015. ^||,|$46.00$|,||,|LEMON-LOVES-LIME-NAUTICAL-RED-WHITE-GIRLS-SKORT|,|$URL$lemon-loves-lime-nautical-red-white-girls-skort.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-nautical-red-and-white-girls-skort-preorder-1.jpg||-||Lemon Loves Lime Navy By the Sea Baby Romper PREORDER|,|^|Sweet as can be, this new infant girls romper comes from Lemon Loves Lime. The sleeveless bodice boasts of an adorable navy sailor stripe in oh so soft cotton. The legs are wrapped with draping ruffle rows down to the hemline. Classic changing snaps line the inner legs to make things easier for mom. Made with 100% pima cotton. Please note that this is a PreOrder item and is NOT currently in stock. This Lemon Loves Lime Layette item is expected to arrive between January 15 thru April 15, 2015. ^||,|$56.00$|,||,|LEMON-LOVES-LIME-NAVY-BY-SEA-BABY-ROMPER|,|$URL$lemon-loves-lime-navy-by-sea-baby-romper.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-navy-by-the-sea-baby-romper-preorder-1.jpg||-||Lemon Loves Lime Octopus Top for Girls (2 & 6)|,|^|In a pink salmon or coral, this new Lemon Loves Lime top is filled with splish splash style. The unique shade of pink is defined perfectly with the blend of cool blues. The large octopus applique has eight swirling legs that are decorated with suction pads. A cute flower is found on her head adding a touch of crochet detail. The ruffled cap sleeves add a fanciful detail that is both feminine and fun. SIZE 2 AND 6 REMAINING. ^||,|$39.00$|,||,|LEMON-LOVES-LIME-OCTOPUS-TOP-GIRLS|,|$URL$lemon-loves-lime-octopus-top-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-octopus-top-for-girls-7.jpg||-||Lemon Loves Lime Peony Romper for Girls in Pink|,|Adorable as can be, this new infant girls romper comes from sweet Lemon Loves Lime. The long sleeve bodice boasts of a ruffled neckline and a single flower off centered at the waist. The legs are wrapped with draping ruffle rows down to the hemline. Classic changing snaps line the inner legs to make things easier for mom. Made with 100% pima cotton. Machine wash gentle, tumble dry on low. |,|$49.00$|,||,|LEMON-LOVES-LIME-PEONY-ROMPER-GIRLS-PINK|,|$URL$lemon-loves-lime-peony-romper-girls-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-peony-romper-for-girls-in-pink-3.jpg||-||Lemon Loves Lime Peony Romper in Red|,|This beautiful Peony romper from Lemon Loves Lime's Layette collection is the perfect combination of pretty and functional. It's true red color and ruffled details make it perfect for any occasion. The romper features a ruffled neckline and a single fabric flower found on the waist. The legs are draped with ruffles that fall from the waist and scoop down the legs. The inseam is lined with changing snaps. 100% Cotton. Machine wash inside out in warm water. Tumble dry on low. |,|$49.00$|,||,|LEMON-LOVES-LIME-PEONY-ROMPER-RED|,|$URL$lemon-loves-lime-peony-romper-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-peony-romper-in-red-18.jpg||-||Lemon Loves Lime Pink and White Dress with Capri (2)|,|^|Created in wide stripes, this new girls dress from Lemon Loves Lime is an addition to their ""Seashell on the Seashore"" collection. The top of the dress has a pull on fit that allows slight stretch in its fabric. Bold pink and white stripes run across the piece horizontally. The skirt mixes up the direction of the skirt and adds an adorable ruffle. The handkerchief hem is decorated with a wide, matching ruffle. The dress is accompanied by matching leggings in the same light pink and white stripes. SIZE 2 ONLY AVAILABLE. ^||,|$59.00$|,||,|LEMON-LOVES-LIME-PINK-WHITE-DRESS-CAPRI|,|$URL$lemon-loves-lime-pink-white-dress-capri.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-pink-and-white-dress-with-capri-6.jpg||-||Lemon Loves Lime Pink Infant Dress Jada Ruffles|,|Fitting for her first birthday or any other celebration, this adorable infant girls dress comes from designer Lemon Loves Lime. The long sleeve bodice is clean and solid and boasts only of a wrap, v neckline. The skirt adds character to the dress with the scalloped tiers of matching pink ruffles that layer down half of the skirt. Made with 100% prima cotton. Machine wash gentle, tumble dry on low. |,|$42.00$|,||,|LEMON-LOVES-LIME-PINK-INFANT-DRESS-JADA-RUFFLES|,|$URL$lemon-loves-lime-pink-infant-dress-jada-ruffles.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-pink-infant-dress-jada-ruffles-3.jpg||-||Lemon Loves Lime Pink Infant Headband|,|^|A darling new baby girls hair accessory, this fabulous Lemon Loves Lime headband is sure to match several of her outfits! The headband features a stretch band that fits comfortably around her head. This band is decorated with two large pink blooms. The light pink shade is a classic baby girls color with its delicate femininity. XS 0-6 MOS ONLY LEFT. ^||,|$14.00$|,||,|LEMON-LOVES-LIME-PINK-INFANT-HEADBAND|,|$URL$lemon-loves-lime-pink-infant-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-pink-infant-headband-1.jpg||-||Lemon Loves Lime Pink Infant Mia Dress PREORDER|,|^|Created by Lemon Loves Lime, this baby girls dress is one that will not be forgotten. The light pink cotton is selected for its great quality and ""soft-to-the-touch"" feel, perfect for her baby skin. The sleeveless bodice has a jewel neckline. The skirt of this dress is draped in wavy ruffles. These ruffles make a darling detail in photographs! Made with 100% Pima Cotton. Please note that this is a PreOrder item and is NOT currently in stock. This Lemon Loves Lime Layette item is expected to arrive between January 15 thru April 15, 2015. ^||,|$42.00$|,||,|LEMON-LOVES-LIME-PINK-INFANT-MIA-DRESS|,|$URL$lemon-loves-lime-pink-infant-mia-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-pink-infant-mia-dress-preorder-1.jpg||-||Lemon Loves Lime Pink Infant Ruffle Hat|,|Matching several of the new arrivals from Lemon Loves Lime Fall 2013 baby line, this hat really is the icing on the cake. This knit hat is enhanced by layers of light pink ruffles wrapping around the piece at an angle. Be sure to visit the Lemon Loves Lime page to see all of the other wonderful creations. Created with 100% prima cotton. When needed, machine wash on gentle and tumble dry on low. |,|$28.00$|,||,|LEMON-LOVES-LIME-PINK-INFANT-RUFFLE-HAT|,|$URL$lemon-loves-lime-pink-infant-ruffle-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-pink-infant-ruffle-hat-3.jpg||-||Lemon Loves Lime Popcorn Stand Tee Shirt (2, 3 & 4)|,|Created with a vintage inspiration, this lively new girls tee is from designer Lemon Loves Lime. The blue top is finished with a fitted look that is trendy and perfect for pairing with any style bottom. The front of the top receives a glorious decoration in the old popcorn stand. The circus red stands out while touches of yellow is found on the wheels, awning, and the writing. Even two bags of popcorn are added to the print, making it perfectly realistic and part of her dreams at the same time. |,|$39.00$|,||,|LEMON-LOVES-LIME-POPCORN-STAND-TEE-SHIRT|,|$URL$lemon-loves-lime-popcorn-stand-tee-shirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-popcorn-stand-tee-shirt-7.jpg||-||Lemon Loves Lime Poppy Cardigan for Infant Girls Ivory|,|Helping to keep your little girl warm in the cooler months, this new knit sweater from designer Lemon Loves Lime really takes the cake. The design is a creation from Lemon Loves Lime's fall 2014 collection and boasts of a matching hat also found within their new styles. This cardigan features a classic fit and long sleeves. The front of the neckline is decorated with sweet ruffle flowers. Complete the look by purchasing the matching hat! The soft knit is delicate on her skin. 100% Cotton. Hand wash in warm water. Lay flat to dry. |,|$36.75$|,||,|LEMON-LOVES-LIME-POPPY-CARDIGAN-INFANT-GIRLS-IVORY|,|$URL$lemon-loves-lime-poppy-cardigan-infant-girls-ivory.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-poppy-cardigan-for-infant-girls-ivory-18.jpg||-||Lemon Loves Lime Puffer Fish Girls Top (2 & 6)|,|^|A bright new creation from Lemon Loves Lime, this fun designer tee will become one of her favorite pieces of clothing. The bright lime green is a punch of color and made from a soft fabric that is comfortable for her. The flutter cap sleeves are made with lime and hot fuchsia ruffles. A character applique on the front is a puffer fish. The light pink fish is accented with fringe and a crochet ruffle tail. SIZE 2 & 6 REMAINING.  ^||,|$39.00$|,||,|LEMON-LOVES-LIME-PUFFER-FISH-GIRLS-TOP|,|$URL$lemon-loves-lime-puffer-fish-girls-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-puffer-fish-girls-top-13.jpg||-||Lemon Loves Lime Purple Pretty Bow Skirt for Girls PREORDER|,|^|Lemon Loves Lime brings us this adorable bow skirt to match her little sister's dress. Made in a beautiful lilac, this skirt is truly timeless. Straight ruffles fall from the elastic waistband while the hem is dressed with beautiful bows with lace around the hem. This skirt is perfect for her birthday! 100% Pima Cotton. Please note that this is a PreOrder item and is NOT currently in stock. This Lemon Loves Lime item is expected to arrive between January 15 thru March 25, 2015. ^||,|$58.00$|,||,|LEMON-LOVES-LIME-PURPLE-PRETTY-BOW-SKIRT-GIRLS|,|$URL$lemon-loves-lime-purple-pretty-bow-skirt-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-purple-pretty-bow-skirt-for-girls-preorder-1.jpg||-||Lemon Loves Lime Red Holiday Shrug for Girls|,|The perfect shrug for holiday get togethers, this new creation comes from the fabulous Lemon Loves Lime Holly Holiday collection. The soft red shrug boasts of its many ruffles from her neck to the hem while the long sleeves finish in a ruffle cuff and protect her from the cold winds. |,|$19.00$|,||,|LEMON-LOVES-LIME-RED-HOLIDAY-SHRUG-GIRLS|,|$URL$lemon-loves-lime-red-holiday-shrug-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-red-holiday-shrug-for-girls-17.jpg||-||Lemon Loves Lime Rose Headband in Ivory|,|In soft ivory, this new designer headband for baby girls is part of Lemon Loves Lime's layette collection. The ivory band stretches to a comfortable fit that will stay on her head. The large duo of flowers is meant to sit off to one side. The small touches of tulle add elegance to this new piece. |,|$14.00$|,||,|LEMON-LOVES-LIME-ROSE-HEADBAND-IVORY|,|$URL$lemon-loves-lime-rose-headband-ivory.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-rose-headband-in-ivory-1.jpg||-||Lemon Loves Lime Ruffle Baby Romper Lilac Peony|,|Coming from designer Lemon Loves Lime, this new baby girls romper is a precious piece that mom and baby will both adore! The romper features a soft lilac purple and a ruffled neckline. The legs are draped with ruffles that fall from the waist and scoop down the legs. A single fabric flower is found on her waist. The inseam is lined with changing snaps. 100% Cotton. Machine wash inside out in warm water. Tumble dry on low. |,|$49.00$|,||,|LEMON-LOVES-LIME-RUFFLE-BABY-ROMPER-LILAC-PEONY|,|$URL$lemon-loves-lime-ruffle-baby-romper-lilac-peony.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-ruffle-baby-romper-lilac-peony-1.jpg||-||Lemon Loves Lime Ruffle Emma Cardigan in Fuchsia (12/18 Mos & 18/24 Mos)|,|^|Vibrant and lively, this sweet infant cardigan is sure to make a perfect finish to her new Lemon Loves Lime outfit. The long sleeves help her arms fend from the cold while the soft knit is delicate on her skin. The front is covered with semi circle ruffles. Made with 100% prima cotton. Machine wash gentle, tumble dry on low.SIZE 12/18 MOS & 18/24 MOS REMAINING. ^||,|$21.75$|,||,|LEMON-LOVES-LIME-RUFFLE-EMMA-CARDIGAN-FUCHSIA|,|$URL$lemon-loves-lime-ruffle-emma-cardigan-fuchsia.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-ruffle-emma-cardigan-in-fuchsia-3.jpg||-||Lemon Loves Lime Ruffle Girls Shorts PREORDER|,|^|A perfect new separate to create fanciful outfits this spring, these girls ruffle shorts comes from designer Lemon Loves Lime. The soft ivory cotton shorts boast of an elastic fit waist while ruffles fall down the shorts down from the hem. 100% Pima Cotton. Please note that this is a PreOrder item and is NOT currently in stock. This Lemon Loves Lime item is expected to arrive between January 15 thru March 25, 2015. ^||,|$39.00$|,||,|LEMON-LOVES-LIME-RUFFLE-GIRLS-SHORTS|,|$URL$lemon-loves-lime-ruffle-girls-shorts.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-ruffle-girls-shorts-preorder-1.jpg||-||Lemon Loves Lime Ruffled Infant Hat Holiday Red|,|^|Perfect from fall through the winter holiday season, this baby girls hat comes from the beloved designer Lemon Loves Lime as a part of their layette collection for fall 2014. The hat is named ""Isabel"" which is perfect for this sweet look that is not bound by time. Red ruffles cover the entire hat and slightly transfer the shape. The style matches the new dresses from Lemon Loves Lime perfectly, making this a must have accessory to complete her outfit! 100% Cotton. Machine wash inside out in warm water. Tumble dry on low. SIZE 0-3 MOS AND 18-24 MOS LEFT.  ^||,|$28.00$|,||,|LEMON-LOVES-LIME-RUFFLED-INFANT-HAT-HOLIDAY-RED|,|$URL$lemon-loves-lime-ruffled-infant-hat-holiday-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-ruffled-infant-hat-holiday-red-1.jpg||-||Lemon Loves Lime Ruffled Pants for Baby Girls White|,|Lemon Loves Lime is now offering these ruffled pants for your infant girl. The white fabric is easy to pair with many pieces while also soft and kind to her skin. The outside of the pants are dressed with tiers of fun ruffles that wrap around the legs. The fit is a simple pull on with the stretch waist and hem. Pair these pants over her every day onesie for a fresh new look! 100% Cotton. Machine wash inside out in warm water. Tumble dry on low. |,|$26.00$|,||,|LEMON-LOVES-LIME-RUFFLED-PANTS-BABY-GIRLS-WHITE|,|$URL$lemon-loves-lime-ruffled-pants-baby-girls-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-ruffled-pants-for-baby-girls-white-1.jpg||-||Lemon Loves Lime Rula Baby Romper in Blue PREORDER|,|^|Adorable as can be, this new infant girls romper comes from sweet Lemon Loves Lime. The sleeveless bodice boasts of a ruffled neckline and quaint fluttering ruffles at the sleeves. The legs are wrapped with draping ruffle rows down to the hemline. Classic changing snaps line the inner legs to make things easier for mom. Made with 100% pima cotton. Please note that this is a PreOrder item and is NOT currently in stock. This Lemon Loves Lime Layette item is expected to arrive between January 15 thru April 15, 2015. ^||,|$44.00$|,||,|LEMON-LOVES-LIME-RULA-BABY-ROMPER-BLUE|,|$URL$lemon-loves-lime-rula-baby-romper-blue.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-rula-baby-romper-in-blue-preorder-1.jpg||-||Lemon Loves Lime Scottish Terrier Necklace|,|The smallest details create the most wondrous things sometimes, as is the case with this new Lemon Loves Lime necklace. Small handmade charms adorn this necklace including a black Scottish terrier. |,|$13.00$|,||,|LEMON-LOVES-LIME-SCOTTISH-TERRIER-NECKLACE|,|$URL$lemon-loves-lime-scottish-terrier-necklace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-scottish-terrier-necklace-10.jpg||-||Lemon Loves Lime Tank Top for Girl Rainbow Fish PREORDER|,|^|In fun summer style, this new Lemon Loves Lime top is just too cute. In a flowing trapeze style, this sleeveless top is perfect for breezy spring and summer. The fluttering sleeves add an adorable touch of detail, while the bodice is accented with a bright and colorful rainbow fish. Filled with colors of summer and fun ruffles, she's sure to love having a little friend by her side! Please note that this is a PreOrder item and is NOT currently in stock. This Lemon Loves Lime item is expected to arrive between January 15 thru March 25, 2015. ^||,|$56.00$|,||,|LEMON-LOVES-LIME-TANK-TOP-GIRL-RAINBOW-FISH|,|$URL$lemon-loves-lime-tank-top-girl-rainbow-fish.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-tank-top-for-girl-rainbow-fish-preorder-1.jpg||-||Lemon Loves Lime White Infant Headband|,|From designer Lemon Loves Lime, this darling new baby girls accessory is sure to make a splash. The headband has a stretch fit with its solid matching band. The two off centered flower decorate the side of her head elegantly. The white flowers are layered with touches of tulle. |,|$14.00$|,||,|LEMON-LOVES-LIME-WHITE-INFANT-HEADBAND|,|$URL$lemon-loves-lime-white-infant-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-white-infant-headband-1.jpg||-||Lemon Loves Lime White Ruffle Isabel hat|,|Going with so many of her cute boutique outfits, this new designer baby hat comes from Lemon Loves Lime. The knit hat allows slight stretch to fit around her head and boasts of the fun matching ruffles that wrap in an angle around the entire piece. Created with 100% prima cotton. When needed, machine wash on gentle and tumble dry on low. |,|$28.00$|,||,|LEMON-LOVES-LIME-WHITE-RUFFLE-ISABEL-HAT|,|$URL$lemon-loves-lime-white-ruffle-isabel-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-white-ruffle-isabel-hat-2.jpg||-||Lime Apple Black Athletic Leggings for Girls|,|Looking fabulous with any new LimeApple top, these new girls leggings are created just for her! The black fabric provides a comfortable, fitted look while becoming the perfect companion during any high energy activity. The leggings are full length and offer a classic waistband. The solid black shade makes it simple to pair these leggings with any of her new activewear tops from Lime Apple. |,|$28.00$|,||,|LIME-APPLE-BLACK-ATHLETIC-LEGGINGS-GIRLS|,|$URL$lime-apple-black-athletic-leggings-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lime-apple-black-athletic-leggings-for-girls-1.jpg||-||Lime Apple Invincible Short Sleeve Top Active Wear|,|Designed by Limeapple, this new girls top is perfect for any work out. The fitted top boasts of an almost rashguard look created with its classic neckline and short sleeves. The top is divided into blocks of bright, fun colors. The blend of blue, red, and lime is out of this world while creating a cute match to any of the new shorts or leggings that have also arrived from the Limeapple collection. |,|$29.00$|,||,|LIME-APPLE-INVINCIBLE-SHORT-SLEEVE-TOP-ACTIVE-WEAR|,|$URL$lime-apple-invincible-short-sleeve-top-active-wear.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lime-apple-invincible-shot-sleeve-top-active-wear-1.jpg||-||Lime Apple Tween Girls Mini Shorts|,|Prepared to run the race, these designer shorts from Limeapple are a part of their activewear collection. The black shorts have a stretch fit in their solid black fabric. The waistline is adorned with a vibrant row of color block that wraps around the shorts. Pair these shorts with any of the new activewear tops for the perfect outfit. These shorts are great for dancers! |,|$27.00$|,||,|LIME-APPLE-TWEEN-GIRLS-MINI-SHORTS|,|$URL$lime-apple-tween-girls-mini-shorts.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lime-apple-tween-girls-mini-shorts-1.jpg||-||Limeapple Active Wear Girls Tank Top|,|From fabulous Limeapple, this new girls design is sure to be instantly loved by your active little girl. The top is created with a blend of turquoise, periwinkle, and lime. The unique straps have a large cut out on the back while the single stripe of green adds a real splash to the front. A hidden side pocket has a zipper to all of its contents in place as she runs and jumps. This top matches all of the new Limeapple active wear bottoms! |,|$27.00$|,||,|LIMEAPPLE-ACTIVE-WEAR-GIRLS-TANK-TOP|,|$URL$limeapple-active-wear-girls-tank-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/limeapple-active-wear-girls-tank-top-1.jpg||-||LimeApple Active Wear Half Top|,|In sweet periwinkle, this new designer top from Limeapple is sure to be one she loves. The fabric is created to keep her comfortable during any fun activity while the half style is a popular look. The cool blue is contrasted with a vibrant red. The shoulder straps are cut for a racer back design. Pair this top with any of the new activewear bottoms from Limeapple this season! |,|$24.00$|,||,|LIMEAPPLE-ACTIVE-WEAR-HALF-TOP|,|$URL$limeapple-active-wear-half-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/limeapple-active-wear-half-top-1.jpg||-||Limeapple Activewear Jacket for Girls with Ruffles|,|From Limeapple, this new active wear jacket for girls is created to promote healthy living in style. This jacket is designed with bright color blocking that stands out from the grey long sleeves. The collar is done in pink to match a racing stripe found on the sleeves. The turquoise blue looks fabulous beneath the lime ruffle. A zipper runs up the front of this jacket, closing the fitted look. The ruffle on this jacket looks beautiful with her fitted yoga pants or leggings. The fast drying fabric holds moisture wicking capabilities. Polyester/Spandex Blend. Machine Wash in Cold Water. Hang to Dry. |,|$44.00$|,||,|LIMEAPPLE-ACTIVEWEAR-JACKET-GIRLS-RUFFLES|,|$URL$limeapple-activewear-jacket-girls-ruffles.html|,|http://ep.yimg.com/ay/yhst-17102259411242/limeapple-activewear-jacket-for-girls-with-ruffles-1.jpg||-||Limeapple Athletic Pant for Tweens|,|A brilliant new look, this new pair of athletic pants come from Limeapple. These pants are comfortable for all day wear and keep her looking great while still prepared for whatever she has in store. The long pants have a straight leg and are made from a fabric that allows stretch in its fit. A band of color wraps around the waistband to insure any of the new Limeapple tops will be a perfect match! |,|$29.00$|,||,|LIMEAPPLE-ATHLETIC-PANT-TWEENS|,|$URL$limeapple-athletic-pant-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/limeapple-athletic-pant-for-tweens-1.jpg||-||Limeapple Girls Activewear Detailed Leggings in Charcoal|,|Designed to match with their new tops and jackets, these tween active wear leggings come from Limeapple. A small pocket is offered on both legs to hold any exercise necessities. The unique waistline has a wrap style in a chevron print accented with a touch of pink. Stitching creates the unique shape detailing found on these leggings. Polyester/Spandex. Machine wash cold. Tumble dry on low. |,|$29.25$|,||,|LIMEAPPLE-GIRLS-ACTIVEWEAR-DETAILED-LEGGINGS-CHARCOAL|,|$URL$limeapple-girls-activewear-detailed-leggings-charcoal.html|,|http://ep.yimg.com/ay/yhst-17102259411242/limeapple-girls-activewear-detailed-leggings-in-charcoal-1.jpg||-||Limeapple Girls Activewear Pant in Charcoal|,|A comfortable yoga pant for your active daughter, this new arrival is from Limeapple. The fabric is comfortable with an easy stretch in fit. Two bright stripes in pink and lime wrap around the waist. Limeapple is a brand that promotes active and healthier lives for our young girls, a mission we can all certainly love! They use quality, breathable fabrics that are fast drying and boast of antibacterial properties! Cotton/Polyester/Spandex. Machine wash cold. Tumble dry on low. |,|$35.25$|,||,|LIMEAPPLE-GIRLS-ACTIVEWEAR-PANT-CHARCOAL|,|$URL$limeapple-girls-activewear-pant-charcoal.html|,|http://ep.yimg.com/ay/yhst-17102259411242/limeapple-girls-activewear-pant-in-charcoal-1.jpg||-||Limeapple Girls Activewear Racerback Tank in Teal|,|New from Limeapple, this tween tank is sure to be one of her favorite tops to wear for practice or exercising! The body of the top is a cool turquoise with color block lime sides. The double shoulder straps criss cross on her back. This top is fitted in style to keep any extra fabric out of her way. Matching active wear jackets and bottoms from Limeapple are also available! Polyester/Spandex. Machine wash cold. Tumble dry on low. |,|$26.25$|,||,|LIMEAPPLE-GIRLS-ACTIVEWEAR-RACERBACK-TANK-TEAL|,|$URL$limeapple-girls-activewear-racerback-tank-teal.html|,|http://ep.yimg.com/ay/yhst-17102259411242/limeapple-girls-activewear-racerback-tank-in-teal-21.jpg||-||Limeapple Girls Activewear Zip-Up Jacket|,|For your active little girl, this fabulous new athletic wear jacket comes from Limeapple. The grey jacket has long sleeves with turquoise cuffs to match the hemline. The turquoise is also found as a color block next to the lime on the top just beneath the collar. The two front pockets are trimmed in a rose pink while a grey chevron texture creates the bottom of the sleeves. Pair with the active shorts and tops for the complete look! Polyester/Spandex. Machine wash cold. Tumble dry on low. |,|$44.25$|,||,|LIMEAPPLE-GIRLS-ACTIVEWEAR-ZIP-UP-JACKET|,|$URL$limeapple-girls-activewear-zip-up-jacket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/limeapple-girls-activewear-zip-up-jacket-1.jpg||-||Limeapple Girls Hoodie Activewear (Size 4, 5 & 7/8)|,|Created for your active daughter, this fabulous new girls hoodie comes from designer Limeapple. The hoodie has a cool periwinkle blue shade while black cuffs are accented with a bright red zipper. A cozy hood pulls over her head and the front zipper is off centered to one side. Down the front of the hoodie are bright blocks of color in red, teal, and yellow. The top has a single pocket. |,|$39.00$|,||,|LIMEAPPLE-GIRLS-HOODIE-ACTIVEWEAR|,|$URL$limeapple-girls-hoodie-activewear.html|,|http://ep.yimg.com/ay/yhst-17102259411242/limeapple-girls-hoodie-activewear-1.jpg||-||Limeapple Girls Sports Tank Top|,|Ready for your active little girl, this new designer top from Limeapple will keep her feeling great! The top boasts of a red empire bodice finished with a bold colorblock waistband. The bottom of the top is finished with a soft periwinkle. The unique shoulder straps are doubled and feature a center cross upon her back. This top will look fabulous with any of the new activewear bottoms from Limeapple. |,|$26.00$|,||,|LIMEAPPLE-TWEEN-SPORTS-TANK-TOP|,|$URL$limeapple-tween-sports-tank-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/limeapple-tween-sports-tank-top-1.jpg||-||LimeApple Invincible Capri for Tweens|,|Created with an athletic stretch fit, these new girls capris come from designer Lime Apple. The jet black capris are created with the perfect fabric to handle any activity the day might bring. The comfortable fit keeps them out of the way while a punch of bright color is received by the waist. Pair these capris with any of the new Limeapple active wear tops! |,|$28.00$|,||,|LIMEAPPLE-INVINCIBLE-CAPRI-TWEENS|,|$URL$limeapple-invincible-capri-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/limeapple-invincible-capri-for-tweens-1.jpg||-||Lipstik Girls Little Girls Sassy Shopper Skirt Set - 2T & 4|,|^|Just for your sassy little shopper comes this skirt set from designer Lipstik Girls. It's the perfect outfit to wear on her shopping excursions or other fun activities. A sassy shopper decked out in a sequined ensemble and armed with her shopping bags adorns the top. The neckline and sleeves are trimmed with red piping. Black mesh with a jeweled black bow overlays the skirt of white with hearts and red dots. A black lace ruffle peaks from underneath the hemline. The stretch waistband is of black and white stripes. Top is a cotton/spandex blend, while the skirt is polyester. Both should be hand washed, line dry. ONE EACH SIZE 2T AND 4 REMAINING.  ^||,|$49.00$|,||,|LIPSTIK-GIRLS-LITTLE-GIRLS-SASSY-SHOPPER-SKIRT-SET|,|$URL$lipstik-girls-little-girls-sassy-shopper-skirt-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lipstik-girls-little-girls-sassy-shopper-skirt-set-14.jpg||-||Lipstik Girls Pink and Ivory Lace Girls Dress - Size 3T|,|^|A sweet dress for your sweet girl from Lipstik Girls. This pink and ivory lace girls dress is too darling. The dress boasts of an overlay of ivory lace in a flower pattern over a pink lining. The strappy bodice hosts three pink jewel buttons. Ruffles of lace and tulle adorn the hemline. Made from 100% polyester. Machine wash cold, line dry. (1) 3T ONLY LEFT. ^||,|$39.00$|,||,|LIPSTIK-GIRLS-PINK-IVORY-LACE-GIRLS-DRESS|,|$URL$lipstik-girls-pink-ivory-lace-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lipstik-girls-pink-and-ivory-lace-girls-dress-14.jpg||-||Lipstik Girls Tween Dress White Lace and Chiffon (Size 16)|,|^|Elegant in white, Lipstik Girls is now offering this tween summer dress in white lace. The A-line dress boasts of its chiffon detailing at the bodice's back and classic sheath fit. The white lace is covered in white floral designs made with tulle giving a unique look and texture. Made from 100% cotton, machine washable. (1) 16 ONLY LEFT.  ^||,|$39.00$|,||,|LIPSTIK-GIRLS-TWEEN-DRESS-WHITE-LACE|,|$URL$lipstik-girls-tween-dress-white-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lipstik-girls-tween-dress-white-lace-and-chiffon-11.jpg||-||Lipstik Girls Tween Dress with Chiffon Flowers/Elisa B (Size 7 & 8)|,|^|With its playful splash of color, this new black and white tween dress from Lipstik Girls brings a new look to spring time. The dress features wide straps, a classic jewel neckline, and is covered with spotted whit and black chiffon swirls. Bits of pink floral color pops out in the shape of fun flowers. Fully lined in black, 100% polyester, machine wash. ONE EACH OF SIZES 7 AND 8 LEFT. ^||,|$39.00$|,||,|LIPSTIK-GIRLS-TWEEN-DRESS-CHIFFON-FLOWERS|,|$URL$lipstik-girls-tween-dress-chiffon-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lipstik-girls-tween-dress-with-chiffon-flowers-elisa-b-11.jpg||-||Little Girls Lace Headband with Pink and Grey Flowers|,|^|Placed upon a lacey headband, these five adorable flowers will compliment her dress beautifully. The light pink chiffon is spiraled and adorned with a pearl center while the structured grey petals are accented with tulle. Row of flowers measure 6"" long. ^||,|$24.00$|,||,|LITTLE-GIRLS-LACE-HEADBAND-PINK-GREY-FLOWERS|,|$URL$little-girls-lace-headband-pink-grey-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-girls-lace-headband-with-pink-and-grey-flowers-12.jpg||-||Little Mass Aji Moto Party Tank Set Beach Dog|,|Sure to be one of her favorites, this new designer short set from Little Mass is just what she needs this spring and summer. The gray tank too is cut with a sleeveless style and hi-lo hems. The shoulders are accented with a bright aqua tulle ruffle. Sitting front and center is an applique of a cute little dog wearing her sunglasses at the beach. The pull on shorts have a lively Aztec pattern and a chain of daisies at the hem. Polyester/Spandex Blend. Machine wash in cold water. Tumble dry on low. Made in the USA. |,|$84.00$|,||,|LITTLE-MASS-AJI-MOTO-PARTY-TANK-SET-BEACH-DOG|,|$URL$little-mass-aji-moto-party-tank-set-beach-dog.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-aji-moto-party-tank-set-beach-dog-1.jpg||-||Little Mass Aqua Fleur Girls Dress (24 Mos & 5)|,|^|Embracing the blooming ideals of the spring season, this adorable girls dress was designed by Little Mass. The empire bodice is covered with a garden of flowers found on the front. These flowers are made with different textures which include tulle, satin, and gems. The fabric stretches for a unbelievably comfortable fit while the straps come to a V shape on her back. The fun floral fabric opens to a full shape from the waist while dotted pink mesh interrupts the pattern and creates the uneven hemline. The white lining can be seen through the fabric and finishes the design. Created in the United States. Fabric Content: [dress] 100% polyester; [lining] 100% cotton. SIZE 24 MOS AND 5 ONLY REMAINING.  ^||,|$57.00$|,||,|LITTLE-MASS-AQUA-FLUER-GIRLS-DRESS|,|$URL$little-mass-aqua-fluer-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-aqua-fluer-girls-dress-1.jpg||-||Little Mass Bling Meow Sequin Shorts and Tank Set (Size 10)|,|^|Dazzling fun, this new designer outfit comes from designer Little Mass. The sleeveless top has a scoop neckline that is edged with lime green. The scarf cut of the shirt has a free fit while a white tank is paired beneath. The sheer turquoise fabric is striped with metallic silver. Matching shorts are worn with the top and really make the outfit a star! The lime green waist is a stretch elastic and coordinates with the hem. The entire pair of shorts is covered with silver sequins that catch every ray of light. 100% polyester. Machine wash cold, tumble dry low. (1) SIZE 10 AVAILABLE.  ^||,|$64.50$|,||,|LITTLE-MASS-BLING-MEOW-SEQUIN-SHORTS-TANK-SET|,|$URL$little-mass-bling-meow-sequin-shorts-tank-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-bling-meow-sequin-shorts-and-tank-set-1.jpg||-||Little Mass Blue Zipper Top for Girls with Velvet Legging (4)|,|^|Taking popular trends to a new height, this fabulous girls outfit comes from the Little Mass Brand. The top boasts of a rich shade of royal blue that stands out from the masses. Two gold zippers framed in black draw attention to her shoulders while the oversized cut offers her a trendy fit. The coordinated leggings are a soft black velvet covered with a golden screen print. The tones found on the leggings draw out the zippers found on the top. Polyester blend fabrics. Machine wash and hang dry both pieces. SIZE 4 ONLY REMAINING.  ^||,|$39.00$|,||,|LITTLE-MASS-BLUE-ZIPPER-TOP-GIRLS-VELVET-LEGGING|,|$URL$little-mass-blue-zipper-top-girls-velvet-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-blue-zipper-top-for-girls-with-velvet-legging-2.jpg||-||Little Mass British Flag Tee and Pleather Skirt for Girls|,|From trendy designer Little Mass, this new girls outfit boasts of its british infusion for an unforgettable back to school look. The long sleeve tee offers a textured natural fiber grey poly cotton blend fabric and a unique take on the British flag. The applique on the front is made with a scottish plaid edged with scalloped lace and enhanced with silver studs. Paired with the perfect pleather skirt with flattering pleating and a zipper that runs up the back. A black pleather and crochet flower is tacked just beneath the waist while ruffled red plaid matching the top peaks out beneath the hemline. Skirt is made with 100% polyester. Hand wash and hang dry. The top is machine washable. |,|$36.33$|,||,|LITTLE-MASS-BRITISH-FLAG-TEE-PLEATHER-SKIRT-GIRLS|,|$URL$little-mass-british-flag-tee-pleather-skirt-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-british-flag-tee-and-pleather-skirt-for-girls-31.jpg||-||Little Mass Couture Skirt Outfit for Girls Puppy Fun|,|Created for your designer daughter, this new couture outfit is from Little Mass. The light top is long sleeve to help guard against the chilly air. Upon the front we find a large screen print with a sweet Yorkie puppy sitting in a designer purse. Stud accents complete this look. The top is paired with a sparkling gold skirt. The fabric is covered with rows of sequins. The stretch waist is a wild leopard print to match the hem. Top: Rayon/Spandex Blend. Skirt: 100% Polyester. Machine Wash in Cold Water. Tumble Dry Low. |,|$58.50$|,||,|LITTLE-MASS-COUTURE-SKIRT-OUTFIT-GIRLS-PUPPY-FUN|,|$URL$little-mass-couture-skirt-outfit-girls-puppy-fun.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-couture-skirt-outfit-for-girls-puppy-fun-22.jpg||-||Little Mass Denim Jacket for Girls Hard Rock (Size 4)|,|^|The perfect accompanmient piece for so many Little Mass creations for the fall 2013 collection, this girls jacket is a season must have. The dark denim boasts of slight fading for a distressed look and pin tucks on the front to give a structured shape. Silver metal buttons that run up the front and close the cuffs give it a real authentic feel. Petals and flowers accent the top near the collar. The shorter cut makes this jacket perfect for a casual dress with sass. Jacket: Cotton-polyblend. Machine wash on cold and hang dry. ONE SIZE 4 ONLY LEFT. ^||,|$37.00$|,||,|LITTLE-MASS-DENIM-JACKET-GIRLS-HARD-ROCK|,|$URL$little-mass-denim-jacket-girls-hard-rock.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-denim-jacket-for-girls-hard-rock-2.jpg||-||Little Mass Denim Vest for Little Girls Bowtastic|,|From Little Mass, this new girls vest is the perfect piece to layer over the new tops and dresses available in the fall season. The denim is a darker wash with a unique hue and is distressed with raw edges at her shoulders. The collar is decorated with fabric bows and rosettes as well as large studs. Metal buttons fasten the front and match those that adorn the flap pockets. This vest is a cropped style and offers a great structured shape. Cotton/Polyester Blend. Machine Wash in Cold Water. Hang to Dry. |,|$49.50$|,||,|LITTLE-MASS-DENIM-VEST-LITTLE-GIRLS-BOWTASTIC|,|$URL$little-mass-denim-vest-little-girls-bowtastic.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-denim-vest-for-little-girls-bowtastic-1.jpg||-||Little Mass Fancy Little Girls Dress Mont Blanc|,|Little Mass brings us this gorgeous dress perfect for any spring or summer occasion. The sleeveless style is created with a bold navy blue and white floral pattern giving it a vintage feel. The skirt of the dress is created with layers of plush tulle in a draped pattern to give it depth. She is sure to love twirling around the dance floor in this dress! Cotton/Polyester Blend. Machine wash in cold water. Tumble dry on low. Made in the USA. |,|$69.00$|,||,|LITTLE-MASS-FANCY-LITTLE-GIRLS-DRESS-MONT-BLANC|,|$URL$little-mass-fancy-little-girls-dress-mont-blanc.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-fancy-little-girls-dress-mont-blanc-1.jpg||-||Little Mass Girls Dress with Daisies|,|Matching another new arrival from designer Little Mass, this spring dress for girls is absolutely fabulous. The bodice offers a high neckline and wide straps. The pull over fit is comfortable and covered with a sequin daisy design. Layers of yellow, pink, and blue tulle create the skirt. The shape of the skirt is a full circle with plenty of extra fabric for her to twirl around. The empire waist is a classic cut and looks fabulous with a light sweater over top if needed! 100% polyester. Machine wash cold, tumble dry low. |,|$59.00$|,||,|LITTLE-MASS-GIRLS-EASTER-DRESS-DAISIES|,|$URL$little-mass-girls-easter-dress-daisies.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-girls-dress-with-daisies-11.jpg||-||Little Mass Girls Dress with Neon Flowers (2T & 5)|,|^|New from designer Little Mass, this girls dress is available in several size ranges. The long sleeve bodice boasts of a light fabric that is gentle on her skin. The front of the bodice is decorated with a yellow and pink floral screen print. The fabulous skirt spices up this design with soft black faux fur. Created with polyblend fabrics. Machine wash and hang to dry. SIZE 2T AND 5 ONLY LEFT. ^||,|$34.00$|,||,|LITTLE-MASS-GIRLS-DRESS-NEON-FLOWERS|,|$URL$little-mass-girls-dress-neon-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-girls-dress-with-neon-flowers-2.jpg||-||Little Mass Girls Ivory Lace Dress|,|New from Little Mass, this fabulous girls dress is simply sugar sweet! The boat neckline is dressed with layered ruffles that lay on her shoulders and a thin chiffon flower is planted near by on the left. The ivory lace covers the bodice while boasting of a floral design. Two fancy ruffles finish the hem. Soft ivory fabric is seen through the lace and keeps this dress pure and beautiful. The shorter style is gorgeous for spring weddings and is easily paired with leggings or tights beneath. Made in the USA. Fabric Content: [lace] nylon and cotton blend; [under fabric] stretch rayon blend. Machine washable, tumble dry on low. |,|$39.00$|,||,|LITTLE-MASS-GIRLS-IVORY-LACE-DRESS|,|$URL$little-mass-girls-ivory-lace-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-girls-ivory-lace-dress-1.jpg||-||Little Mass Girls Ivory Lace Leggings with Faux Fur (Size 12)|,|^|Soft to the touch and adding a stylish flair, these new girls leggings are from designer Little Mass. The leggings boast of a brushed lace overlay, elastic fit waist, and matching faux fur found at the hem. Made with a cotton poly blend, machine washable. SIZE 12 REMAINING.  ^||,|$19.00$|,||,|LITTLE-MASS-GIRLS-IVORY-LACE-LEGGINGS-FAUX-FUR|,|$URL$little-mass-girls-ivory-lace-leggings-faux-fur.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-girls-ivory-lace-leggings-with-faux-fur-13.jpg||-||Little Mass Girls Mesh Dress in Navy Four Tier|,|New from designer Little Mass, this trendy dress is sure to become your tweens favorite this summer. The thin straps are created with a crocheted lace detail. The dress is made in a sleeveless style and hangs with an a line shape. Layers of dark navy blue tulle are pieced together with exposed seams giving this dress an adorable vintage French style. 100% Polyester. Machine wash in cold water. Tumble dry on low. Made in the USA. |,|$66.00$|,||,|LITTLE-MASS-GIRLS-MESH-DRESS-NAVY-FOUR-TIER|,|$URL$little-mass-girls-mesh-dress-navy-four-tier.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-girls-mesh-dress-in-navy-four-tier-1.jpg||-||Little Mass Girls Party Dress Rosy Tulle|,|Designed by Little Mass, this new little girls rose dress is a gorgeous choice for birthdays or any event. The long sleeve bodice has a fitted look with slight stretch in the fabric colored with a rose print. A pink velvet waistline ties into a bow on the back and is decorated with a rose on the front. The tutu inspired skirt is layered with different shades of pink tulle. The skirt is lined and gem accents are found on the flower at the waist. Polyester/Spandex Blend. Machine Wash in Cold Water. Hang to Dry. |,|$63.00$|,||,|LITTLE-MASS-GIRLS-PARTY-DRESS-ROSY-TULLE|,|$URL$little-mass-girls-party-dress-rosy-tulle.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-girls-party-dress-rosy-tulle-1.jpg||-||Little Mass Girls Red Rose Top and Legging|,|A cute new outfit that matches the Little Mass Mary Poppins dress, this fabulous new arrival is one she will want to wear constantly. The top boasts of a sweet red rose print that covers the body while her long sleeves contrast in black. A fabric flower under the neckline adds more texture. Solid black leggings are paired beneath and a black brushed lace insert is found on both sides of the top. Rose print: rayon blend, black fabric: polyester blend. Machine wash and hang to dry. |,|$24.33$|,||,|LITTLE-MASS-GIRLS-RED-ROSE-TOP-LEGGING|,|$URL$little-mass-girls-red-rose-top-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-girls-red-rose-top-and-legging-2.jpg||-||Little Mass Girls Ruffle Dress Hard Rock Plaid (Size 2T)|,|^|Matching her sisters British flag set, this new little girls dress from Little Mass will be a hit this fall! The grey bodice features a black sequin heart adorned by a cute plaid bow to match the faux cap sleeves. Long back sleeves help protect her from the chilly air. The skirt is created with five ruffle tiers alternating between the red Scottish plaid and the sweet black lace. made with 100% polyester and poly cotton blends. Machine wash and hang dry. SIZE 2T ONLY LEFT.  ^||,|$32.33$|,||,|LITTLE-MASS-GIRLS-RUFFLE-DRESS-HARD-ROCK-PLAID|,|$URL$little-mass-girls-ruffle-dress-hard-rock-plaid.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-girls-ruffle-dress-hard-rock-plaid-31.jpg||-||Little Mass Girls Tutu Dress with Heart (18 Mos)|,|^|A vibrant new girls dress, this fabulous piece comes from designer Little Mass. The sleeveless bodice is a bold neon pink. A sheer white lace is used as an overlay found on both the front and back. A bright heart is made with chiffon flowers and tulle in the center of the bodice. The tutu skirt is a sky blue tulle layered for a full volume. A full circle shape creates extra fabric that dances around her legs. Cute ruffles in the tutu adorn the hemline. Made with a cotton and polyester blend. Machine wash this dress and tumble dry on low.(1) SIZE 18 MOS ONLY LEFT. ^||,|$49.00$|,||,|LITTLE-MASS-GIRLS-TUTU-DRESS-HEART|,|$URL$little-mass-girls-tutu-dress-heart.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-girls-tutu-dress-with-heart-1.jpg||-||Little Mass Indian Summer Top and Shorts with Dog|,|A new little girls outfit from Little Mass, this arrival is sure to be loved no matter where she is! The sleeveless top is a soft, solid white fabric with exposed blue stitching. Upon the front of this shirt we find a cut puppy screen print accented with a red white and blue headdress. The top is paired with some colorful pull on shorts. The shorts are trimmed with little crochet pom poms! Polyester/Spandex Blend. Machine wash in cold water. Tumble dry on low. Made in the USA. |,|$68.00$|,||,|LITTLE-MASS-INDIAN-SUMMER-TOP-SHORTS-DOG|,|$URL$little-mass-indian-summer-top-shorts-dog.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-indian-summer-top-and-shorts-with-dog-1.jpg||-||Little Mass Little Girls Dress and Leggings Set Panda Fun|,|An adorable design, this new little girls dress comes from designer Little Mass. The bodice of the dress is wrapped in white polka dots and features contrasting black and white stripes. Her comfortable hood is lined in a pop of pink. A large panda applique sits upon the front created with sequins. The tulle skirt is layered and finishes with an uneven hemline. Beneath the dress we find striped leggings. The knees are decorated with a pink heart applique. Cotton/Polyester/Rayon Blend. Machine wash cold. Tumble dry low. |,|$78.00$|,||,|LITTLE-MASS-LITTLE-GIRLS-DRESS-LEGGINGS-SET-PANDA-FUN|,|$URL$little-mass-little-girls-dress-leggings-set-panda-fun.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-little-girls-dress-and-leggings-set-panda-fun-1.jpg||-||Little Mass Little Girls Tutu Dress in Velvet (3T, 5, 6X & 7)|,|The perfect new design to liven up this holiday season, this new girls dress comes from designer Little Mass. The black velvet bodice boasts of a long sleeve style to keep her warm in the winter and a pull over fit comfortable for all day wear. The front of the bodice is dressed with a gold foil screen print in a beautiful damask design. A quaint bow is found off centered on the ribbon waist adorned with metal and sequins. The skirt is inspired from the beloved tutu look and is created with layers of trimmed black tulle. Created with stretch polyester blend and 100% polyester tulle. Machine wash and hang to dry. |,|$36.33$|,||,|LITTLE-MASS-LITTLE-GIRLS-TUTU-DRESS-VELVET|,|$URL$little-mass-little-girls-tutu-dress-velvet.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-little-girls-tutu-dress-in-velvet-1.jpg||-||Little Mass Mary Poppin Red Girls Dress|,|Style never looked so sweet! This new Little Mass dress is sure to make her smile bloom each time she wears it. The bodice is covered with a unique rose print while the sweater-like fabric adds warmth to the dress. Her long sleeves continue in the same pattern. A black bow is found off centered on her neckline framed with small swirls created with silver studs. The volume-filled skirt layers tulle in a gorgeous shade of red and finishes with a ruffled hemline. Stretch rayon blend and 100% polyester fabric, machine wash on gentle and hang to dry. |,|$29.33$|,||,|LITTLE-MASS-MARY-POPPIN-RED-GIRLS-DRESS|,|$URL$little-mass-mary-poppin-red-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-mary-poppin-red-girls-dress-2.jpg||-||Little Mass Mint Rose Girls Tutu Dress (12 Mos)|,|^|Colored with a flirty, fun floral, this new girls dress comes from trending designer Little Mass. The bodice is cut for a fitted look and boasts of the pink flowers that pop off of the cool mint background. The sleeveless neckline is accented with a raw-edged fabric rosette to match the one just above her waist. The skirt is created with matching pink tones to truly pull the piece together. The tiers of the skirt are made with a stiff tulle that ruffles around her legs. The dark pink overlay of tulle is enriched by a lighter shade just beneath. A matching pink lining is comfortable against her legs and provides a canvas to which the tulle is attached. Fabric Contents: [self] polyester and spandex blend; [contrast] cotton and poly-nylon blend. Machine wash on cold and tumble dry low. SIZE 12 MONTH ONLY LEFT. ^||,|$43.00$|,||,|LITTLE-MASS-MINT-ROSE-GIRLS-TUTU-DRESS|,|$URL$little-mass-mint-rose-girls-tutu-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-mint-rose-girls-tutu-dress-1.jpg||-||Little Mass Miss Daisy Sequin Girls Dress|,|Created by Little Mass, this fancy little girls dress is sure to be a big hit this spring! The dress boasts an a line shape. Colorful daisies cover the mesh overlay with their sequin shimmer and a touch of blue tulle ruffles around the neckline. A single button closes at the top of the back and a large tulle bow is tied in the center. The hemline is skirted with a matching blue ruffle. 100% polyester. Machine wash cold, tumble dry low. |,|$79.00$|,||,|LITTLE-MASS-MISS-DAISY-SEQUIN-GIRLS-DRESS|,|$URL$little-mass-miss-daisy-sequin-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-miss-daisy-sequin-girls-dress-41.jpg||-||Little Mass Mont Blanc Tank and Ruffle Skirt in Navy|,|An adorable outfit for any fancy occasion, this little girl's skirt set from Little Mass is just darling! The sleeveless top is created in a white fabric with a bouquet of flower and gem appliques flowing all down the front. The skirt is made with layers of ruffled navy tulle. A single flower applique sits at her hip as a nice accent to the top. Cotton/Polyester/Rayon/Spandex Blend. Machine wash in cold water. Tumble dry on low. Made in the USA. |,|$94.00$|,||,|LITTLE-MASS-MONT-BLANC-TANK-RUFFLE-SKIRT-NAVY|,|$URL$little-mass-mont-blanc-tank-ruffle-skirt-navy.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-mont-blanc-tank-and-ruffle-skirt-in-navy-1.jpg||-||Little Mass Mont Blanc Tunic Pant Set with Lace Accent|,|Little Mass brings us this adorable tunic and pant set, perfect for any occasion this spring. The navy tank top is accented with a lace trim around the sweetheart neckline. Flowing ruffles fall from the hem of the shirt in an uneven pattern to give it depth. The pants are created in a pull on style with a bold navy and white floral pattern to match. Rayon/Spandex/Polyester/Cotton Blend. Machine wash in cold water. Tumble dry on low. Made in the USA. |,|$76.00$|,||,|LITTLE-MASS-MONT-BLANC-TUNIC-PANT-SET-LACE-ACCENT|,|$URL$little-mass-mont-blanc-tunic-pant-set-lace-accent.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-mont-blanc-tunic-pant-set-with-lace-accent-1.jpg||-||Little Mass Neon Pink Girls Lace Dress (Size 4)|,|^|New from designer Little Mass, this trendy lace dress is sure to become your tweens favorite this summer. The soft neon pink knit dress is covered with an elegant floral lace overlay with neon piping outlining the flowers. 100% polyester. Machine wash cold, hang dry. SIZE 4 ONLY LEFT.  ^||,|$24.00$|,||,|LITTLE-MASS-NEON-PINK-LACE-DRESS-FANTA|,|$URL$little-mass-neon-pink-lace-dress-fanta.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-neon-pink-girls-lace-dress-14.jpg||-||Little Mass Owl Top Indian Summer|,|Such a hoot, this new designer top from Little Mass is right on trend! The long top is a soft white fabric accented with rainbow trim around the neckline. Made in the racer back style, she's sure to love how breezy this top is for spring and summer. A screen printed colorful owl sits front and center. What a fun little shirt to go with any of her new pairs of shorts! Polyester/Spandex Blend. Machine wash in cold water. Tumble dry on low. Made in the USA. |,|$39.00$|,||,|LITTLE-MASS-OWL-TOP-INDIAN-SUMMER|,|$URL$little-mass-owl-top-indian-summer.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-owl-top-indian-summer-1.jpg||-||Little Mass Owl Tunic with Capri Legging (6 & 6X)|,|^|A real hoot, this new designer top and legging set from Little Mass is right on trend. The long top is a soft white fabric accented with the orange trim around the sleeveless neckline. A fabric applique is found upon the front, a large owl. The bird features cute headphones and warm colors. Matching leggings are paired with the top. The stretch pants offer her a capri length and a splash of turquoise found in the middle of the orange and pink print. Rayon. Hand was cold. SIZE 6 AND 6X ONLY LEFT. ^||,|$49.00$|,||,|LITTLE-MASS-OWL-TUNIC-CAPRI-LEGGING|,|$URL$little-mass-owl-tunic-capri-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-owl-tunic-with-capri-legging-1.jpg||-||Little Mass Pink Striped Tween JoJo Caplet (Size 14)|,|^|A bright new piece sure to entice, this tween caplet comes from trendy designer Little Mass. The neon pink is striped with a heathered grey and boasts of its unique style. The cute hood hangs in the back while the loose fit and sequin adorned flutter cap sleeves are perfect for layering with her favorite camis or tanks. Made with a soft poly blend, machine washable. SIZE 14 AVAILABLE. ^||,|$19.00$|,||,|LITTLE-MASS-PINK-STRIPED-TWEEN-JOJO-CAPLET|,|$URL$little-mass-pink-striped-tween-jojo-caplet.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-pink-striped-tween-jojo-caplet-14.jpg||-||Little Mass Sunshine Chevron Girls Tutu Dress (12 Mos)|,|^|This little girls party dress comes to you from fun designer Little Mass. The tank style knit bodice has a delicate lace overlay in a vibrant chevron print and adorned with a bright fuchsia flower with purple floral center. The triple layer tutu is embellished with embroidered floral accents of different sizes and colors. Perfect for all of her special occasions. Polyester/rayon/cotton blend. Machine wash cold, hang dry recommended. SIZE 12 MOS ONLY LEFT.  ^||,|$29.00$|,||,|LITTLE-MASS-SUNSHINE-CHEVRON-GIRLS-TUTU-DRESS|,|$URL$little-mass-sunshine-chevron-girls-tutu-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-sunshine-chevron-girls-tutu-dress-14.jpg||-||Little Mass Tunic Outfit for Little Girls Leopard Love (3T, 5 & 6)|,|Part of their fall line, this new Little Mass outfit will look fabulous accompanying her to school. The tunic offers an empire waist and sheer lace sleeves. The skirt of the tunic is dresses with a lacey overlay. The bold turquoise is accented with leopard print rosettes and matching sequins at the neckline. Animal print leggings are paired beneath the tunic to complete the look. Nylon/Spandex/Chenille Blend. Machine Wash in Cold Water. Tumble Dry Low. |,|$49.50$|,||,|LITTLE-MASS-TUNIC-OUTFIT-LITTLE-GIRLS-LEOPARD-LOVE|,|$URL$little-mass-tunic-outfit-little-girls-leopard-love.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-tunic-outfit-for-little-girls-leopard-love-17.jpg||-||Little Mass Tween Skirt with Mesh Overlay (Size 14)|,|^|This fun and flirty skirt is from the Tru Luv line of designer Little Mass. The short white skirt has a longer overlay of white mesh flowing down from the waist. Rayone and polyester. Machine wash cold, hang to dry. ONE SIZE 14 LEFT. ^||,|$19.00$|,||,|LITTLE-MASS-TWEEN-SKIRT-TULLE-TULLE-OVERLAY|,|$URL$little-mass-tween-skirt-tulle-tulle-overlay.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-tween-skirt-with-mesh-overlay-13.jpg||-||Live & Luca Petal Shoes in Watermelon|,|A great color for all summer activities, these new Livie and Luca petal shoes are just as cute as can be! The watermelon red fits in not only with holidays, but is perfect for a pop of color to any outfit. The sandal has a rounded toe and a Velcro strap. The petal cut out pattern is one of the most popular designs from Livie and Luca. A great grip is provided by the rubber sole while the soft faux leather on the inside keeps her foot comfortable as she plays. |,|$40.50$|,||,|LIVE-LUCA-PETAL-SHOES-WATERMELON|,|$URL$live-luca-petal-shoes-watermelon.html|,|http://ep.yimg.com/ay/yhst-17102259411242/live-luca-petal-shoes-in-watermelon-14.jpg||-||Livie & Luca Baby Girls Elephant Shoes in Red (Size 0-6 Mos)|,|^|With such a loveable character on the toe of this new Livie & Luca shoe, how can you resist? The shoe is made with red and pink leather and features a Velcro strap. Ellie the Elephant finds her home on this shoe while the soft inner and outer leather soles keep her shoes comfy and light weight! (1) SIZE 0-6 MOS ONLY LEFT.  ^||,|$19.00$|,||,|LIVIE-LUCA-BABY-GIRLS-ELEPHANT-SHOES-RED|,|$URL$livie-luca-baby-girls-elephant-shoes-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-luca-baby-girls-elephant-shoes-in-red-11.jpg||-||Livie & Luca Bloom Shoes Light Blue for Baby|,|A sky blue beauty, this new designer baby shoe comes from Livie and Luca. The bloom shoe offers soft faux leather both on the outside and inside of this shoe, making not only a great look, but also great comfort. Velcro secures the single strap and a touch of elastic makes it easy for mom to place them on her little feet. A large cut out flower is found on the rounded, peep toe. |,|$27.75$|,||,|LIVIE-LUCA-BLOOM-SHOES-LIGHT-BLOOM-BABY|,|$URL$livie-luca-bloom-shoes-light-bloom-baby.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-luca-bloom-shoes-light-bloom-for-baby-1.jpg||-||Livie & Luca Fuchsia Bloom Girls Shoes (Size 4 Infant)|,|^|A classic style in fuchsia from Livie & Luca, this sandal is a delight! The fuchsia pink is accented by an orange flower in full bloom on the top of her foot. Her toes will peek through the front opening. The rubber sole gives stability as she skips and plays. (1) 4 ONLY LEFT.  ^||,|$29.00$|,||,|LIVIE-LUCA-FUCHSIA-BLOOM-GIRLS-SANDALS|,|$URL$livie-luca-fuchsia-bloom-girls-sandals.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-luca-fuchsia-bloom-girls-shoes-13.jpg||-||Livie & Luca Girls Petal Shoes in Pink (Size 13)|,|^|For infants to girls, this patent leather shoe is a hit from Livie & Luca. Pink petals enclose the toes and a velcro strap at the ankle makes them easy to take on and off. SIZE 13 ONLY LEFT.  ^||,|$42.00$|,||,|LIVIE-LUCA-GIRLS-PETAL-PAT-SHOES-PINK|,|$URL$livie-luca-girls-petal-pat-shoes-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-luca-girls-petal-shoes-in-pink-13.jpg||-||Livie & Luca Guava Merry Bell Girls Shoes (Size 4 Infant)|,|^|These merry girls shoes are from designer Livie & Luca. The guava pink is accented with blue trim. An open toe design allows her toes to peek out. Two little green flowers bloom on the fastening strap. SIZE 4 ONLY AVAILABLE. ^||,|$29.00$|,||,|LIVIE-LUCA-GUAVA-MERRY-BELL-GIRLS-SHOES|,|$URL$livie-luca-guava-merry-bell-girls-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-luca-guava-merry-bell-girls-shoes-13.jpg||-||Livie & Luca Lavender Bloom Shoes for Babies (Size 0-6 Mos)|,|^|In a sweet lilac shade, these new purple baby shoes were designed by Livie and Luca. The dark trimming has a cute scallop edge. The single strap features a flower with a glitter center hiding the Velcro that secures the fit. The soft sole is perfect for her delicate feet, keep her comfortable and stylish! Purchase older sizes to match the sisters! SIZE 0-6 MOS ONLY LEFT. ^||,|$27.75$|,||,|LIVIE-LUCA-LAVENDER-BLOOM-SHOES-BABIES|,|$URL$livie-luca-lavender-bloom-shoes-babies.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-luca-lavender-bloom-shoes-for-babies-1.jpg||-||Livie & Luca Light Pink Bloom Shoes for Toddlers and Girls (Size 5 & 6)|,|^|Matching the baby sizes that are also available, these little girls shoes come from Livie and Luca. A sweet peep toe interrupts the rounded shape of the shoe while the detail stitching is a subtle accent. A large flower is found on the top of her foot with a light blue center. The strap that travels around her ankle is secured with Velcro. The rubber outsole has grip while the leather is a comfortable padding for her foot.SIZE 5 & 6 LEFT.  ^||,|$39.00$|,||,|LIVIE-LUCA-LIGHT-PINK-BLOOM-SHOES-TODDLERS-GIRLS|,|$URL$livie-luca-light-pink-bloom-shoes-toddlers-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-luca-light-pink-bloom-shoes-for-toddlers-and-girls-1.jpg||-||Livie & Luca Lime Bloom Girls Sandals (Size 4 Infant)|,|^|This classic from Livie & Luca in lime is blooming just in time for spring! A fuchsia rosette adorns the top of her foot as her toes peek from the front. Fastens at the ankle with velcro. SIZE 4 ONLY LEFT.  ^||,|$29.00$|,||,|LIVIE-LUCA-LIME-BLOOM-GIRLS-SANDALS|,|$URL$livie-luca-lime-bloom-girls-sandals.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-luca-lime-bloom-girls-sandals-13.jpg||-||Livie & Luca Luz Orange Girls Shoes (6)|,|^|Unlike any other shoes she owns, these new Livie and Lucas are so fun! The orange shoe has a rounded tow and is created with an orange and magenta blend. Three rectangle windows are lined with pick stitching on the toes. The criss cross straps are secured with Velcro near her heel. The rubber sole is textured like a bee hive and grips the ground as she runs and plays. SIZE 6 ONLY REMAINING. ^||,|$39.00$|,||,|LIVIE-LUCA-LUZ-ORANGE-GIRLS-SHOES|,|$URL$livie-luca-luz-orange-girls-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-luca-luz-orange-girls-shoes-1.jpg||-||Livie & Luca Merry Bell Mint Baby Shoes (Size 0-6 Mos)|,|^|A trendy springtime color, these new baby shoes from Livie and Luca are both unexpected and comfortably familiar. The soft faux leather is as cozy for her feet as can be. The mint green is a bright pastel accented with blue, scallop trim. The rounded toe has a small peep hole cut out. A strap runs across the front and is accented with a sweet flower bloom. Fasten the velcro on the side to secure her foot in place. SIZE 0-6 MOS LEFT.  ^||,|$27.75$|,||,|LIVIE-LUCA-MERRY-BELL-MINT-BABY-SHOES|,|$URL$livie-luca-merry-bell-mint-baby-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-luca-merry-bell-mint-baby-shoes-1.jpg||-||Livie & Luca Violet Merry Bell Girls Shoes (Size 4 Infant)|,|^|Violet merry bells from designer Livie & Luca will bloom beautifully on her feet this spring! An open toe design with flower accents on the strap and lime green trim add to the adorable charm of these shoes. Rubber soles give stability. SIZE 4 REMAINING.  ^||,|$29.00$|,||,|LIVIE-LUCA-VIOLET-MERRY-BELL-GIRLS-SHOES|,|$URL$livie-luca-violet-merry-bell-girls-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-luca-violet-merry-bell-girls-shoes-16.jpg||-||Livie and Luca Baby Shoes in Grey Bluebell (Size 12/18 Mos)|,|^|Created by Livie Luca for your darling infants feet, these sweet shoes are sure to make her stand apart. The grey patent leather helps to catch the light while the cobalt grey goes with just about anything. Purple scalloped trimming accent is found on some of the edges while the Velcro strap is adorned with a cute little flower. Two slits at the back of her heels allow stretch along with some elastic, making the fit as comfortable as possible. The soft sole boasts of two rubber pads that give some grip. SIZE 12-18 MOS ONLY LEFT.  ^||,|$29.00$|,||,|LIVIE-LUCA-BABY-SHOES-GREY-BLUEBELL|,|$URL$livie-luca-baby-shoes-grey-bluebell.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-baby-shoes-in-grey-bluebell-2.jpg||-||Livie and Luca Bird Shoes in Turquoise|,|From Livie and Luca, these new little girls shoes are a breath of fresh air all fall and winter long. The Mary Jane's are colored in a bold turquoise that adds a pop of color to her outfit. The side of the toe is adorned with a gold glitter bird applique. A second glitter applique is found on the Velcro ankle strap. These shoes are lined with a soft leather. The outer sole is a gripping leather, the older sizes of these shoes have a slightly different shape due to the different sole used. |,|$43.50$|,||,|LIVIE-AND-LUCA-BIRD-SHOES-TURQUOISE|,|$URL$livie-and-luca-bird-shoes-turquoise.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-bird-shoes-in-turquoise-17.jpg||-||Livie and Luca Dawn Light Pink Girls Shoes (Size 4)|,|^|A new style from designer Livie and Luca, these little girls shoes are ready for all of her fun in the sun. The light pink shoe features metallic gold sun rays covering her rounded toe. The strap on the top of her foot is striped in gold and pink, creating a girly rainbow to the sweet golden cloud that is fastened on the outer side of both shoes. The inner sole and patting is a soft faux leather. The rubber outsole has a great grip for her active life. The light pink is sure to catch her eye and match many pieces in her closet! SIZE 4 ONLY REMAINING. ^||,|$39.00$|,||,|LIVIE-LUCA-DAWN-LIGHT-PINK-GIRLS-SHOES|,|$URL$livie-luca-dawn-light-pink-girls-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-dawn-light-pink-girls-shoes-14.jpg||-||Livie and Luca Girls Designer Boots in Fuchsia with Buttons|,|^|A fabulously adorable boot, these new designer shoes for little girls come from Livie and Luca. The ""Marchita"" boots are a popular design from their fall collection while this fuchsia suede is a perfect pop of color. The outer side of the boot is closed with large metal buttons that create a ruffled fit. The shoe is finished with a honeycomb sole with a great grip and flexibility. ^||,|$51.00$|,||,|LIVIE-AND-LUCA-GIRLS-DESIGNER-BOOTS-FUCHSIA-BUTTONS|,|$URL$livie-and-luca-girls-designer-boots-fuchsia-buttons.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-girls-designer-boots-in-fuchsia-with-buttons-19.jpg||-||Livie and Luca Girls Embossed Leather Shoes in Yellow|,|A unique creation, these little girls fall shoes are from Livie and Luca. The rich mustard yellow leather is a hot fall color. The shoe is dressed with the embossed baroque pattern. The strap is decorated with a brass buckle that allows her little hands to practice buckling and unbuckling. These shoes are hand sewn for an added value. |,|$43.50$|,||,|LIVIE-AND-LUCA-GIRLS-EMBOSSED-LEATHER-SHOES-YELLOW|,|$URL$livie-and-luca-girls-embossed-leather-shoes-yellow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-girls-embossed-leather-shoes-in-yellow-12.jpg||-||Livie and Luca Girls Leather Shoes in Gold Metallic|,|Created in neutral tones to match many different outfits, this new little girls shoe was designed by Livie and Luca. The gold leather is a soft, brushed shade that has just the perfect amount of shimmer. Soft leather lines the inside while a rubber sole grips the ground with every step. The ankle strap is a secure fit that is dressed with suede flower accents. The final decoration is found on the top of her foot, a touch of scallop edges with matching brown suede. |,|$43.50$|,||,|LIVIE-AND-LUCA-GIRLS-LEATHER-SHOES-GOLD-METALLIC|,|$URL$livie-and-luca-girls-leather-shoes-gold-metallic.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-girls-leather-shoes-in-gold-metallic-12.jpg||-||Livie and Luca Girls Patent Leather Shoes in Grape|,|A fabulous new design by Livie and Luca, these adorable little girl shoes have arrived in tie for the fall and winter season. The shoes are created in a grape patent leather and is trimmed with touches of red suede. The top of her foot boasts of a scallop edge. The Velcro strap is finished with a suede bow complete with flower tassels. The rubber outer sole offers grip as she runs and plays. |,|$43.50$|,||,|LIVIE-AND-LUCA-GIRLS-PATENT-LEATHER-SHOES-GRAPE|,|$URL$livie-and-luca-girls-patent-leather-shoes-grape.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-girls-patent-leather-shoes-in-grape-6.jpg||-||Livie and Luca Girls Petal Shoes in Black Leather|,|Designed by Livie and Luca, these new little girl shoes are a sweet design that is a touch of elegance and playfulness. The shoe boasts of the petal accent that sits upon the top of her toes. This shoe is made with a classic patent leather look that is a fabulous match to many different outfits. A soft leather lines the inside while the outer sole is a gripping leather. Please note that the older sizes of the shoes may have a different shape due to the different style of sole. |,|$43.50$|,||,|LIVIE-AND-LUCA-GIRLS-PETAL-SHOES-BLACK-LEATHER|,|$URL$livie-and-luca-girls-petal-shoes-black-leather.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-girls-petal-shoes-in-black-leather-12.jpg||-||Livie and Luca Girls Red Petal Shoes in Suede|,|A favorite design with a new recipe, these Livie and Luca petal shoes are perfect for holiday parties. The red shoe boasts of the blend of soft suede and shiny patent leather. The petal design is the perfect decoration on her toe. The ankle strap is finished with Velcro for an easy fit. While quantities last, this shoe is also created in black, check out our Livie and Luca page! |,|$43.50$|,||,|LIVIE-AND-LUCA-GIRLS-RED-PETAL-SHOES-SUEDE|,|$URL$livie-and-luca-girls-red-petal-shoes-suede.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-girls-red-petal-shoes-in-suede-22.jpg||-||Livie and Luca Girls Ruched Leather Shoes in Gold|,|Livie and Luca is now offering this adorable little girls shoes as a part of their fall and winter collection. These golden shoes are created with leather for a classic look. The ankle strap is secured with Velcro and dressed with fringe lining. A ruched ruffle sits on the top of her foot and finishes with a scallop edge. The rubber honeycomb sole is styled with stitching around the edge. This sole is made from Stroebel construction, increasing the shoes flexibility. |,|$43.50$|,||,|LIVIE-AND-LUCA-GIRLS-RUCHED-LEATHER-SHOES-GOLD|,|$URL$livie-and-luca-girls-ruched-leather-shoes-gold.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-girls-ruched-leather-shoes-in-gold-12.jpg||-||Livie and Luca Girls Ruched Leather Shoes in Shimmer Magenta|,|Designed with love, these new Live and Luca girls shoes are a sweet creation that can be worn for any occasion. The comfortable fit is created by the soft leather lining and the Velcro ankle strap. The honeycomb sole has a great grip and is a flexible fit that moves with her every step. The shimmering magenta leather catches the light and is easy to pair with her outfit. The ruched ruffle accents the top of her foot while a touch of fringe edges the strap. |,|$43.50$|,||,|LIVIE-AND-LUCA-GIRLS-RUCHED-LEATHER-SHOES-SHIMMER-MAGENTA|,|$URL$livie-and-luca-girls-ruched-leather-shoes-shimmer-magenta.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-girls-ruched-leather-shoes-in-shimmer-magenta-6.jpg||-||Livie and Luca Girls Shoes Fuschia Toi Toi|,|In fun pink, these new designer girls shoes have arrived as a part of the Livie and Luca fall and winter collection. The shoe is made with a pink suede while patent leather creates the braided accent on the top of her foot. The Velcro strap is easy for her to use on her own. The show is lined with soft leather while the sole is made of gripping rubber. Please note that the sizes 10 and larger have a different rubber sole that alters the shape of the shoe slightly. |,|$43.50$|,||,|LIVIE-AND-LUCA-GIRLS-SHOES-FUSCHIA-TOI-TOI|,|$URL$livie-and-luca-girls-shoes-fuschia-toi-toi.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-girls-shoes-fuschia-toi-toi-6.jpg||-||Livie and Luca Girls Shoes Knoll Cloud (Size 4 & 5)|,|^|An inspired style from Livie and Luca, these new little girls shoes are a fabulous floral. The toe has a rounded square look as a single strap runs across the top of her foot to the Velcro found on the outer side. The rose pink is complimented with a flower pattern and light grey. A beehive textured rubber grips the flour and the faux leather insole offers the perfect level of comfort for her feet.SIZE 4 & 5 LEFT. ^||,|$39.00$|,||,|LIVIE-LUCA-GIRLS-SHOES-KNOLL-CLOUD|,|$URL$livie-luca-girls-shoes-knoll-cloud.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-girls-shoes-knoll-cloud-2.jpg||-||Livie and Luca Girls Yellow Leather Shoes with Hedgehog|,|An adorable design from Livie and Luca, these little girl shoes are a playful twist to add to her wardrobe. The bright yellow leather is a bold pop of color while the shoe is lined in pink. A cute little friend is found on the front. The hedgehog is made with grey patent leather and grey suede. The strap is finished with Velcro. |,|$42.00$|,||,|LIVIE-AND-LUCA-GIRLS-YELLOW-LEATHER-SHOES-HEDGEHOG|,|$URL$livie-and-luca-girls-yellow-leather-shoes-hedgehog.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-girls-yellow-leather-shoes-with-hedgehog-12.jpg||-||Livie and Luca Gray Patent Leather Shoes with Blossom|,|From designer Livie and Luca, these baby girls shoes are a real cutie. The shoes are dressed in stone gray patent leather. This leather is accented with white stitching and a soft outer sole. The strap is secured with Velcro while the back stretches with a touch of elastic for a comfortable fit with every step. A teal flower sits on the top of her toes while silver glitter is found at the center. These shoes are lined in pink and are sure to add the perfect color to her fall and winter wardrobe. |,|$29.25$|,||,|LIVIE-AND-LUCA-GRAY-PATENT-LEATHER-SHOES-BLOSSOM|,|$URL$livie-and-luca-gray-patent-leather-shoes-blossom.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-gray-patent-leather-shoes-with-blossom-17.jpg||-||Livie and Luca Green Girls Shoes Opal (Size 6)|,|^|A rich grass green, these new little girls shoes are from Livie and Luca. The velcro ankle strap is perfect for her to put on her shoes all by herself! A small touch of watermelon red trims the fancy design that accents the top of the shoe. The rounded toe has a small peep hole. The rubber sole is firm and sure of its grip. SIZE 6 ONLY LEFT.  ^||,|$39.00$|,||,|LIVIE-LUCA-GREEN-GIRLS-SHOES-OPAL|,|$URL$livie-luca-green-girls-shoes-opal.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-green-girls-shoes-opal-1.jpg||-||Livie and Luca Leather Boots for Little Girls in Olive|,|^|The ""Stitcher"" boot from Livie and Luca is a fabulous blend of textures as they have created this new fall boot for girls. The boat is created with an embossed leather in olive green. The white stitching is a sweet accent while three straps wrap around the boot. A simple woven cotton flower creates a sweet accent on this boot. The embossed design on the leather is floral and fabulous! A zipper is found on the inner side of the boot, making it easy for her to pull them on her self! The closer you look at this boot, the more details you will find and love! ^||,|$51.00$|,||,|LIVIE-AND-LUCA-LEATHER-BOOTS-LITTLE-GIRLS-OLIVE|,|$URL$livie-and-luca-leather-boots-little-girls-olive.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-leather-boots-for-little-girls-in-olive-19.jpg||-||Livie and Luca Light Blue Bloom Shoes for Girls|,|A style worthy of your princess, this light blue shoe from Livie and Luca is a popular style in a fresh new color. The light pastel blue is complimented with the purple flower found on the toe. A touch of glittering blue is found at the center of the flower while a peep toe makes this shoe trendy. A strap wraps around her ankle and is secured with Velcro. The faux leather insole is sure to keep her foot comfortable all day long. A rubber out sole gives her foot a secure grip. |,|$39.00$|,||,|LIVIE-LUCA-LIGHT-BLUE-BLOOM-SHOES-GIRLS|,|$URL$livie-luca-light-blue-bloom-shoes-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-light-blue-bloom-shoes-for-girls-1.jpg||-||Livie and Luca Little Girls Suede Boots in Mocha|,|In a rich mocha brown, these new girls boots are designed by the beloved brand, Livie and Luca. The suede boots have an adorable, comfortable fit created by the satiny swan lining that was custom designed for these shoes. The toe is dressed with a stitched accent. The pink laces are a rawhide leather and boast of their tassels. The honeycomb sole is flexible and offers great grip! |,|$51.00$|,||,|LIVIE-AND-LUCA-LITTLE-GIRLS-SUEDE-BOOTS-MOCHA|,|$URL$livie-and-luca-little-girls-suede-boots-mocha.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-little-girls-suede-boots-in-mocha-19.jpg||-||Livie and Luca Merry Bell Lavender Girls Shoes|,|A light lavender shade covers her foot with these new Livie and Luca merry bells. A matching faux leather insole is comfortable while dark scallop trim edges the shoe. The Velcro strap is accented with a bow and two cut out flowers. A rubber sole gives great grip to the floor while she plays. Match these with her little baby sisters new pair of Livie and Lucas for the perfect spring photo! |,|$39.00$|,||,|LIVIE-LUCA-MERRY-BELL-LAVENDER-GIRLS-SHOES|,|$URL$livie-luca-merry-bell-lavender-girls-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-merry-bell-lavender-girls-shoes-1.jpg||-||Livie and Luca Merry Bell Light Blue Girls Shoes|,|A sky blue shoe, these new arrivals come from Livie and Luca. The sandal features a peep toe and quaint scallops that are found trimming the edges. A Velcro straps is styled with a contrasting bow, the tails dangling cut out flowers. The shoe is made with faux leather and a firm sole is made from rubber for a great grip. |,|$39.00$|,||,|LIVIE-LUCA-MERRY-BELL-LIGHT-BLUE-GIRLS-SHOES|,|$URL$livie-luca-merry-bell-light-blue-girls-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-merry-bell-light-blue-girls-shoes-1.jpg||-||Livie and Luca Mint Girls Shoes Merry Bell|,|Bright and filled with spring, these new Livie and Luca shoes are sure to rival the new life blooming from the ground. The light mint green is coordinated with aqua and purple accents. The scallop trimming is perfect for small details while the small bow boasts of two cut out flowers on both tails. A velcro strap helps to secure her foot along with the rubber sole grip. The faux leather insole is soft and comfy. |,|$39.00$|,||,|LIVIE-LUCA-MINT-GIRLS-SHOES-MERRY-BELL-MINT|,|$URL$livie-luca-mint-girls-shoes-merry-bell-mint.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-mint-girls-shoes-merry-bell-1.jpg||-||Livie and Luca Moccasin Boots for Girls in Grape|,|A bright and fun creation, these new boots are from Livie and Luca. The grape suede is dressed with a stitching accent on the toe. The bold green laces are a rawhide leather and are finished with tassels. The honeycomb sole is flexible for her every step. A convenient zipper is found on the inner side of both shoes while the lining is a custom designed pattern of elegant swans. These boots are easy to pair with outfits and are a run creation she will rock! |,|$51.00$|,||,|LIVIE-AND-LUCA-MOCCASIN-BOOTS-GIRLS-GRAPE|,|$URL$livie-and-luca-moccasin-boots-girls-grape.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-moccasin-boots-for-girls-in-grape-19.jpg||-||Livie and Luca Opal Purple Girls Shoes (4, 5, 7 & 8)|,|The tuxedo of new shoes, these fancy new arrivals come from Livie and Luca,. The dark purple shade is both unique and loved. The Velcro strap is easy for her little hands to use while a cut out pattern is found on the top of her foot. A small little peep hole is found on the toe of both shoes. This style is also available in green and watermelon red. |,|$39.00$|,||,|LIVIE-LUCA-OPAL-PURPLE-GIRLS-SHOES|,|$URL$livie-luca-opal-purple-girls-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-opal-purple-girls-shoes-1.jpg||-||Livie and Luca Opal Shoes for Girls Watermelon|,|A unique color for summer or spring, the watermelon red shoes come from Livie and Luca. The deep color is rich and warm. The velcro strap is secured on the outer side of both feet. A light trim outlines the cutout pattern that falls down from the strap to the top of her foot. The round toe is finished with a small peep hole cut out found in the center. These shoes are positively darling and are perfect for both the every day outfit and a special occasion! |,|$39.00$|,||,|LIVIE-LUCA-OPAL-SHOES-GIRLS-WATERMELON|,|$URL$livie-luca-opal-shoes-girls-watermelon.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-opal-shoes-for-girls-watermelon-1.jpg||-||Livie and Luca Petal Shoes Sky Blue (Size 4)|,|^|One of the most popular Livie and Luca styles, these petal shoes are in a cool new shade for spring. The light blue patent leather has a great shine that reflects the lights. The toe of the shoe has a fun cut out petal pattern lined with stitching. A rubber outsole and a faux leather insole creates both comfort and a secure step. SIZE 4 REMAINING.  ^||,|$40.50$|,||,|LIVIE-LUCA-PETAL-SHOES-SKY-BLUE|,|$URL$livie-luca-petal-shoes-sky-blue.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-petal-shoes-sky-blue-1.jpg||-||Livie and Luca Pink Blossom Infant Girls Shoes|,|A sweet arrival, these new baby shoes from designer Livie and Luca are perfect for your sweet girl. These patent leather shoes are made in a soft baby pink shade. The comfortable collar has elastic for a stretch fit around her ankle. Both toes are adorned by a fuchsia flower completed by a glitter center. The strap is secured with Velcro while the shoe is finished with a soft outer sole. |,|$29.25$|,||,|LIVIE-AND-LUCA-PINK-BLOSSOM-INFANT-GIRLS-SHOES|,|$URL$livie-and-luca-pink-blossom-infant-girls-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-pink-blossom-infant-girls-shoes-12.jpg||-||Livie and Luca Pro Tempore Blue Girls Shoes (4 Infant & 13)|,|^|Such an adorable new arrival, this fabulous girls summer shoe comes from the beloved brand Livie and Luca. Livie and Luca offers her a quality shoe that is filled with a unique and beautiful style. This mary jane is styled with their classic ruche look. The name comes from the scallop fabric that wraps around on top of the toes! The pale cornflower blue is a fun pop of color that will draw out similar tones from her outfit. The grip sole is a honeycomb texture while the ankle strap is fastened easily with Velcro. This style is a special limited quantity offer, so don't delay! SIZE 4 AND 13 ONLY LEFT. ^||,|$39.00$|,||,|LIVIE-AND-LUCA-PRO-TEMPORE-BLUE-GIRLS-SHOES|,|$URL$livie-and-luca-pro-tempore-blue-girls-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-pro-tempore-blue-girls-shoes-1.jpg||-||Livie and Luca Ruche Purple Shoes (Size 6)|,|^|Livie and Luca has released this orchid purple summer time shoe as part of a limited quantity item for the summer! The punch of purple looks great with her sunny day outfits while the comfortable fit and unique style make this show a must have piece for every day wear! A scallop finished accent wraps around the top of the toe, lending the name ""ruche"" to this style. An easy Velcro strap fastens around her ankle and along with the rubber bottom sole give a firm fit and grip. The sole is a honeycomb texture. Look for this shoe in limited time pink and blue while quantities last! ^||,|$39.00$|,||,|LIVIE-AND-LUCA-RUCHE-PURPLE-SHOES|,|$URL$livie-and-luca-ruche-purple-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-ruche-purple-shoes-3.jpg||-||Livie and Luca Suede Boots for Girls Marchita Taupe|,|A warm brown boot perfect to welcome fall weather, this new shoe comes from fabulous Livie and Luca. The faux suede is the perfect texture in a taupe brown shade. A long zipper runs up the inner side of both boots for a classic fit. The outer side is ruffled and adorned by three metal buttons that look like old clock faces. |,|$51.00$|,||,|LIVIE-LUCA-SUEDE-BOOTS-GIRLS-MARCHITA-TAUPE|,|$URL$livie-luca-suede-boots-girls-marchita-taupe.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-suede-boots-for-girls-marchita-taupe-27.jpg||-||Livie and Luca Toi Toi Shoes for Girls in Turquoise|,|Created with a lovely vintage feel, these new little girls shoes are from designer Livie and Luca. The turquoise suede is a hot color for the season while boasting of great texture. The braided accent on the top of her foot is created in a patent leather. The ankle strap is threaded through the braids and secured with Velcro. The outer sole is different for sizes 10 and up, altering the shape of the shoe slightly. No matter the style of the sole, this shoe offers a grip with every step! |,|$43.50$|,||,|LIVIE-AND-LUCA-TOI-TOI-SHOES-GIRLS-TURQUOISE|,|$URL$livie-and-luca-toi-toi-shoes-girls-turquoise.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-toi-toi-shoes-for-girls-in-turquoise-12.jpg||-||Livie and Luca Vintage Gold Charm Sandal (Size 4)|,|^|Ready to be shown off this spring and summer, these new designer sandals for girls comes from Livie and Luca. The golden faux leather has a great metallic shimmer and texture. Two straps run across her toes accented with a rose in the center. The ankle strap is closed with easy to use Velcro on the outer side. The outer sole is a grip rubber to secure her feet as she walks, runs, or plays. SIZE 4 & 9 ONLY LEFT.  ^||,|$39.00$|,||,|LIVIE-AND-LUCA-VINTAGE-GOLD-CHARM-SANDAL|,|$URL$livie-and-luca-vintage-gold-charm-sandal.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-vintage-gold-charm-sandal-1.jpg||-||Love U Lots Casual Summer Outfit Aqua|,|Created in a trendy color, this new summer outfit for girls comes from designer Love U Lots. The tunic is covered with two tone stripes and boasts of a single shoulder neckline. A ruffle wraps around the neck and a thin shoulder strap is placed on her left shoulder. The cute little flowers that sit upon the neck introduce new colors to the piece. The hemline of the tunic is finished with a ruffle. The solid capri leggings worn beneath are finished with three bows on both legs. |,|$29.00$|,||,|LOVE-U-LOTS-CASUAL-SUMMER-OUTFIT-AQUA|,|$URL$love-u-lots-casual-summer-outfit-aqua.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-casual-summer-outfit-aqua-1.jpg||-||Love U Lots Designer Cropped Denim Jacket for Girls|,|^|A fabulous way to compliment her new outfits, this designer vest is from Love U Lots. The vest is created in a dark wash, boasting of its true blue tone and slight distressing. Large metal buttons fasten the front and close the two flap pockets. The cropped cut accents an empire waistline perfectly. Whether it is over a dress or a designer top, this vest is sure to look darling! Cotton/Spandex Blend. Machine Wash in Cold Water. Line Dry. THIS VEST RUNS SMALL, PLEASE CONSIDER ORDERING (1) ONE SIZE UP.  ^||,|$23.25$|,||,|LOVE-U-LOTS-DESIGNER-CROPPED-DENIM-JACKET-GIRLS|,|$URL$love-u-lots-designer-cropped-denim-jacket-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-designer-cropped-denim-jacket-for-girls-1.jpg||-||Love U Lots Fleece Leopard Coat for Girls|,|Creating a memorable look she will rock all season long, this new winter coat for girls comes from designer Love U Lots. The coat is covered in a snow leopard print and created with soft, warm fleece. A large pink rose accent sits upon the front while matching buttons are camouflaged, closing the front. The style of the coat is finished with three tiers of ruffles to match the cuffs on her long sleeves. Whether it is paired over her every day look or a special occasion dress, this coat is a must have! 100% Polyester. Machine wash cold with like colors. Hang to dry. |,|$30.75$|,||,|LOVE-U-LOTS-FLEECE-LEOPARD-COAT-GIRLS|,|$URL$love-u-lots-fleece-leopard-coat-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-fleece-leopard-coat-for-girls-1.jpg||-||Love U Lots Floral Chiffon Girls Dress with Belt (Size 4)|,|^|From designer Love U Lots, this new girls dress is a flowy delight. The sheer chiffon fabric is striped with waving floral vines from neck to hem. The peasant neckline offers the classic gathers and a single keyhole in the front. A matching green slip is provided to wear beneath. The chiffon ruffles at the hem to finish off the darling style. A brown braided belt complete with large beads and tassles accompanies the dress to tie around her waist in a bow. Made with polyblend and rayon blend fabrics. Machine wash and hang to dry. SIZE 4 REMAINING. ^||,|$28.00$|,||,|LOVE-U-LOTS-FLORAL-CHIFFON-GIRLS-DRESS-BELT|,|$URL$love-u-lots-floral-chiffon-girls-dress-belt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-floral-chiffon-girls-dress-with-belt-32.jpg||-||Love U Lots Girls White Summer Dress (2T, 4T)|,|^|New from designer Love U Lots, this fabulous girls dress is sure to fill summer with a sweet scent. The white flare dress boasts of the bold floral print that runs down the center. Dark pink shoulder straps are threaded through the neckline giving it a gathered look. Pair this dress with her favorite casual shoes for every day play! Made with rayon blend. Machine wash cold, line dry. SIZE 2T & 4T REMAINING. ^||,|$44.00$|,||,|LOVE-U-LOTS-GIRLS-WHITE-SUMMER-DRESS|,|$URL$love-u-lots-girls-white-summer-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-girls-white-summer-dress-1.jpg||-||Love U Lots Girls Capri Outfit Black and White Stripe - 2T, 4 & 6|,|A new design from Love U Lots, this designer girls summer outfit is sure to fit any occasion. The black and white stripes race across the soft fabric horizontally. The straight neckline is wrapped in sweet, colorful rosettes. Matching shoulder straps are about an inch wide. A solid pair of capri leggings are paired beneath the top in black. The outer side of both legs are accented thin bows. Made with cotton blend. Machine wash cold, line dry. |,|$39.00$|,||,|LOVE-U-LOTS-GIRLS-CAPRI-OUTFIT-BLACK-WHITE-STRIPE|,|$URL$love-u-lots-girls-capri-outfit-black-white-stripe.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-girls-capri-outfit-black-and-white-stripe-1.jpg||-||Love U Lots Girls Designer Tights in Fuchsia|,|Looking great beneath her new fall dresses, these little girls tights come from Love U Lots. The tights are in a bold shade of fuchsia pink; this color will help pull out the pink details in her outfit or to contrast neutral shades. A sweet decoration is found on the ankle and finishes this look. These tights have a classic stretch fit that adds warmth during the colder months of fall and winter. Cotton/Nylon/Spandex. Machine wash warm with like colors. Hang to dry. |,|$14.25$|,||,|LOVE-U-LOTS-GIRLS-DESIGNER-TIGHTS-FUCHSIA|,|$URL$love-u-lots-girls-designer-tights-fuchsia.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-girls-designer-tights-in-fuchsia-1.jpg||-||Love U Lots Girls Dolman Top and Pant in Ladybug (6)|,|^|An irresistible creation new from Love U lots, this darling girls outfit stands far above all others. The top is cut in a dolman sleeve shape, giving a looser fit up top, batwing sleeves, and a fitted hem to flatter her shape. The front is a red orange spotted in black while the green polka dot bow found on the hemline matches the back. Her cuffs match the grey and black striped knit hem. Paired with solid black yoga pants boasting of the roll down waist and triple ruffle legs. Top: Made with acrylic blend. Machine wash cold, gentle cycle. Pants: Made with a cotton blend. Machine wash cold, line dry. ONE 6 LEFT. ^||,|$38.50$|,||,|LOVE-U-LOTS-GIRLS-DOLMAN-TOP-PANT-LADYBUG|,|$URL$love-u-lots-girls-dolman-top-pant-ladybug.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-girls-dolman-top-and-pant-in-ladybug-2.jpg||-||Love U Lots Girls Navy Striped Dress with Flowers|,|Love U Lots is now offering this adorable little girls dress in their fall 2014 collection. The dress boasts of an empire waist decorated with a fun pink ruffle. The navy and white straps wrap around the piece and her long sleeves. Four spiral rosettes create a beautiful bouquet upon the bodice. Her skirt opens in shape and is styled by changing the direction of the stripes. Each panel on the skirt is edged with a ruffle to match the hemline. Cotton/Spandex. Machine wash cold with like colors. Hang to dry. |,|$36.75$|,||,|LOVE-U-LOTS-GIRLS-NAVY-STRIPED-DRESS-FLOWERS|,|$URL$love-u-lots-girls-navy-striped-dress-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-girls-navy-striped-dress-with-flowers-1.jpg||-||Love U Lots Girls Striped Dress in Fuchsia and Navy|,|Part of their darling fall collection, this new Love U Lots dress is a sweet piece she will love to show off to her friends at school! The dress is created with stripes of navy and pink. The soft fabric is perfect for the season while the straight shape allows her to wear this dress nearly anywhere! A green ribbon ties around the waist with cute ribbon bows. This dress will look darling with tights paired beneath. Cotton/Polyester Blend. Machine Wash in Cold Water. Line Dry. |,|$36.75$|,||,|LOVE-U-LOTS-GIRLS-STRIPED-DRESS-FUCHSIA-NAVY|,|$URL$love-u-lots-girls-striped-dress-fuchsia-navy.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-girls-striped-dress-in-fuchsia-and-navy-1.jpg||-||Love U Lots Girls Striped Tunic with Leggings in Cranberry|,|^|A new creation by Love U Lots, this fabulous set for girls comes from their fall collection. The rich colors on the tunic are found throughout the fall season and boasts of the color block trendy in creating wide stripes. Her neckline and long sleeves are covered with a thinner stripe. Cute fabric flowers are placed upon leaf appliques off centered by the neckline. Her sharkbite hem is the perfect style to pair with the sweet matching leggings that come with the top. These leggings are in cranberry and feature an elastic waistband and a ruffled hem. Acrylic/Wool Blend. Hand Wash in Cold Water. Line Dry. SIZE 5 AND 6 ONLY LEFT.  ^||,|$46.50$|,||,|LOVE-U-LOTS-GIRLS-STRIPED-TUNIC-LEGGINGS-CRANBERRY|,|$URL$love-u-lots-girls-striped-tunic-leggings-cranberry.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-girls-striped-tunic-with-leggings-in-cranberry-1.jpg||-||Love U Lots Girls Summer Skort Oufit|,|A bright new designer girls outfit, this creation from Love U Lots is simply adorable. The warm orange top features a soft cotton fabric. The neckline is trimmed with pink flowers. The black and white striped skort is paired beneath. The two front pockets are accented with swooping ruffles. |,|$29.00$|,||,|LOVE-U-LOTS-GIRLS-SUMMER-SKORT-OUFIT|,|$URL$love-u-lots-girls-summer-skort-oufit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-girls-summer-skort-oufit-1.jpg||-||Love U Lots Little Girls Owl Dress with Tights - Size 4|,|^|Created by designer Love U Lots, this new little girls dress will quickly become her favorite. The red orange bodice is made with a soft ribbed knit and features long sleeves and a large owl applique resting on the front. The fun skirt is made with layers of ruffled plaid coordinating perfectly to compliment the orange. Accompanied by matching brown tights with colored polka dots. Made with polyester blend and 100% cotton, hand wash with care. SIZE 4 ONLY LEFT.  ^||,|$36.50$|,||,|LOVE-U-LOTS-LITTLE-GIRLS-OWL-DRESS-TIGHTS|,|$URL$love-u-lots-little-girls-owl-dress-tights.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-little-girls-owl-dress-with-tights-11.jpg||-||Love U Lots Sangria Ruffle Heart Set - 4T|,|^|New from trendy girls designer Love U Lots, this sangria ruffle heart tee, skirt, and leggings set is adorable. She'll love the bright long sleeve tee with its ruffle hem and cuffs, along with the large ruffle heart in the center that is decorated with assorted rosettes. Finishing off this stylish outfit, the swingy multi-colored striped skirt with ruffled hem and indigo stitching detail is beautiful over the adorable denim knit ruffle yoga pants. Knit from a poly blend, the blue denim knit pants have a curved ruffled hem with a higher ankle and soft pink cotton rosettes with green leaves details on each ankle. The perfect addition to any fall wardrobe, she'll stay comfy and cute in this cotton/spandex blend outfit. Machine wash, line dry. (1) 4T ONLY LEFT.  ^||,|$39.00$|,||,|LOVE-U-LOTS-SANGRIA-RUFFLE-HEART-SET|,|$URL$love-u-lots-sangria-ruffle-heart-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-sangria-ruffle-heart-set-11.jpg||-||Love U Lots Swimsuit Coverup in Tropical Print|,|Ready for any spring or summer vacation, this new girls swimsuit coverup is part of the Love U Lots collection. The fabulous tropical print is a classic choice in pattern while mixing pink, orange, and green effortlessly. With a relaxed, comfortable fit, the top offers short sleeves and a unique, keyhole neckline. Small pink pom poms outline the shape of the neck. |,|$29.25$|,||,|LOVE-U-LOTS-SWIMSUIT-COVERUP-TROPICAL-PRINT|,|$URL$love-u-lots-swimsuit-coverup-tropical-print.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-swimsuit-coverup-in-tropical-print-7.jpg||-||Luna Luna Girls Dress White Seaurchin (Size 2T)|,|^|As dreamy as a cloud, this new seaurchin dress from designer Luna Luna is perfect for a birthday celebration. The dress features a metallic silver ruched neckline with adjustable straps that criss cross in the back. The back offers an easy stretch fit while the skirt is covered with several layers of white tulle and spotted with tulle circle flowers. The gown finishes off with a small ruffle peaking from the hem, and is fully lined. Made with polyester, hand wash. ONE SIZE 2T ONLY LEFT. ^||,|$39.00$|,||,|LUNA-LUNA-GIRLS-EASTER-DRESS-WHITE|,|$URL$luna-luna-girls-easter-dress-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/luna-luna-girls-dress-white-seaurchin-11.jpg||-||Luna Luna Pierette Tween Girls Sweater Set|,|^|A comfy new outfit with plenty of style, this tween girls sweater set from designer Luna Luna is adorable. The cardigan top features a black stripe pattern, long sleeves, and jeweled snaps running up the front. Slight gathering is found from the center while the matching shorts feature a pleated skirt overlay. Top is fully lined, both made with rayon blend, machine washable. ALL SOLD OUT 12/8/14. ^||,|$39.00$|,||,|LUNA-LUNA-PIERETTE-TWEEN-GIRLS-SWEATER-SET|,|$URL$luna-luna-pierette-tween-girls-sweater-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/luna-luna-pierette-tween-girls-sweater-set-11.jpg||-||Luv U Lots Blush Pink Girls Flower Dress|,|^|Your blushing girl will fall in love with this blush pink girls flower dress from Luv U Lots. It is too gorgeous and perfect for twirling! The sleeveless bodice in blush pink sits above an empire waist blooming with brightly colored flowers of blue, orange, and green. Ruffles of green run between the flowers. The full skirt is done in horizontal panels of blush pink with purled edges. The same purl edging can be found along the hemline. Made of cotton/spandex. Machine wash cold, line dry. ALL SOLD OUT 5/24/14.  ^||,|$34.00$|,||,|LUV-U-LOTS-BLUSH-PINK-GIRLS-FLOWER-DRESS|,|$URL$luv-u-lots-blush-pink-girls-flower-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/luv-u-lots-blush-pink-girls-flower-dress-14.jpg||-||Luv U Lots Girls Coral Seersucker Bikini (Size 2T & 6X)|,|^|From designer Luv U Lots, this girls bikini is right in style. The seersucker fabric in coral minicheck is just divine. The halter style top ties at the neck. A coral rosette adorns the front along with two leaves of green. The matching bottoms repeat the coral seersucker fabric. The suit is lined. Made from polyester/lycra/nylon. Hand wash cold, line dry. SIZE 2T & 6X LEFT. ^||,|$19.00$|,||,|LUV-U-LOTS-GIRLS-CORAL-SEERSUCKER-BIKINI|,|$URL$luv-u-lots-girls-coral-seersucker-bikini.html|,|http://ep.yimg.com/ay/yhst-17102259411242/luv-u-lots-girls-coral-seersucker-bikini-13.jpg||-||Mack and Co Fancy Girls Fleece Coat Ivory Bow (Size 5 & 7)|,|^|A sweet new design by Mack and Co, this fabulous girls winter coat is a darling look! The coat is made with a soft, warm black fleece. The neck is wrapped with a ruffle collar that drapes down the front and is dressed with a single, large ivory bow with a decoration placed on the center. The bell ruffle cuffs mimic the look of her hemline and the pin tucks on the back create the shape. Buttons are fastened in the front of this coat and a matching hat is available while quantities last. This hat is found on the Mack and Co page named ""Mack and Co Girls Fancy Winter Hat Ivory Bow."" 100% Polyester. Machine wash lukewarm. Dry on low. ONE EACH SIZE 5 & 7 ONLY LEFT.  ^||,|$46.50$|,||,|MACK-CO-FANCY-GIRLS-FLEECE-COAT-IVORY-BOW|,|$URL$mack-co-fancy-girls-fleece-coat-ivory-bow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mack-and-co-fancy-girls-fleece-coat-ivory-bow-17.jpg||-||Mack and Co Fleece and Faux Fur Coat for Girls Pink Fox|,|A darling winter dress coat from designer Mack and Co, this new arrival is a fabulous look to compliment all of her new designer outfits. The light pink fleece is a soft color that compliments her rose winter cheeks. The collar is dressed in a faux fur to match the cuffs on the sleeves. This coat is accompanied by a fun fox scarf. The fox boasts of a matching faux fur tail while his face is accented with touches of pink and darling button eyes. 100% Polyester. Machine Wash in Cold Water. Tumble Dry Low. |,|$79.50$|,||,|MACK-CO-FLEEC-FAUX-FUR-COAT-GIRLS-PINK-FOX|,|$URL$mack-co-fleec-faux-fur-coat-girls-pink-fox.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mack-and-co-fleece-and-faux-fur-coat-for-girls-pink-fox-1.jpg||-||Mack and Co Girls Faux Fur Winter Coat Dusty Rosette|,|A luxurious winter coat for your sweet daughter, this new faux fur design comes from Mack and Co. The coat boasts of a soft pink blended with the jet black. The black faux fur trims at the collar and creates the wide bubble hem ruffle. The light pink faux fur is covered with a trellis pattern. This pattern is created with sheer dusty pink fabric and accented with circle rosettes. 100% Polyester. Hand wash in warm water. Hang to dry. |,|$96.75$|,||,|MACK-CO-GIRLS-FAUX-FUR-WINTER-COAT-DUSTY-ROSETTE|,|$URL$mack-co-girls-faux-fur-winter-coat-dusty-rosette.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mack-and-co-girls-faux-fur-winter-coat-dusty-rosette-1.jpg||-||Mack and Co Girls Fleece Ruffle Coat Classy Charcoal|,|^|A new creation by designer Mack and Co, this fabulous girls winter coat is a part of their new winter 2014 line and is named as the ""pearl fleece ruffle."" The charcoal grey shade is textured with raw fiber while her wide sleeves are finished with a dancing bell ruffle. A whimsical edge is found on her collar and at the hemline. A row of buttons fall down the front hedged by ruffles on both sides. These ruffles have pearl bead accents found among their folds. The top of the coat has a more fitted look that relaxed at the waist. 100% Polyester. Machine Wash in Cold Water on Gently Cycle. Tumble Dry Low. ^||,|$51.75$|,||,|MACK-CO-GIRLS-FLEECE-RUFFLE-COAT-CLASSY-CHARCOAL|,|$URL$mack-co-girls-fleece-ruffle-coat-classy-charcoal.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mack-and-co-girls-fleece-ruffle-coat-classy-charcoal-1.jpg||-||Mack and Co Hi-Low Winter Coat Lattice Girl|,|Mack and Co has created this adorable girls winter coat as a part of their 2014 collection. The grey background is covered with a light pink lattice pattern. Large pink buttons run down the front to fasten the fit. The shape of the coat flares out from an empire waist and a collar decorates the neck. This jacket is sure to keep her cozy and warm on the chilly winter days! Acrylic/Polyester Blend. Machine Wash in Cold Water. Hang to Dry. |,|$76.50$|,||,|MACK-CO-HILO-WINTER-COAT-LATTICE-GIRL|,|$URL$mack-co-hilo-winter-coat-lattice-girl.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mack-and-co-hi-low-winter-coat-lattice-girl-1.jpg||-||Mack and Co Little Girls Winter Coat in Bubble Hem|,|New from Mack and Co, this designer winter coat for girls is a gorgeous piece she will adore wearing all winter long. The light pink faux fur is covered with a rose print. Large, sparkly buttons run in a line on the front of the coat and fasten for a warm fit. A large ruffle in leopard print creates the luxurious collar. The swing fit of this coat ruffles out from the empire waist and is finished with a fun bubble hemline. 100% Polyester. Machine wash lukewarm. Dry on low. |,|$48.00$|,||,|MACK-CO-LITTLE-GIRLS-WINTER-COAT-BUBBLE-HEM|,|$URL$mack-co-little-girls-winter-coat-bubble-hem.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mack-and-co-little-girls-winter-coat-in-bubble-hem-1.jpg||-||Mack and Co Polka Dot Puffer Coat for Girls (2T, 3T & 6X)|,|Part of their new 2014 creations, this fabulous little girls winter coat is dotted with fun! The black coat is covered with large white polka dots. The cozy fit is finished with a bubble hemline. A large hood is wrapped with a ruffle trim that falls down the front of the coat. This coat is lined with a soft fleece in bold pink. 100% Polyester. Machine Wash in Cold Water on Gently Cycle. Tumble Dry Low. |,|$64.50$|,||,|MACK-CO-POLKA-DOT-PUFFER-COAT-GIRLS|,|$URL$mack-co-polka-dot-puffer-coat-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mack-and-co-polka-dot-puffer-coat-for-girls-1.jpg||-||Mack and Co Ruffle Fleece Coat for Girls in Blue|,|In a gorgeous tiffany blue, this new designer coat for girls is from Mack and Co. The coat features two rows of double ruffles that frame the large buttons that fall down the front of this coat. Pearl beads are found accenting these ruffles. The hemline and the collar are finished with a twisting ruffle while her sleeves have ruffle bells. The fit relaxes at her waist, allowing the fabric to move freely with her steps. 100% Polyester. Machine wash lukewarm. Dry on low. |,|$49.50$|,||,|MACK-CO-RUFFLE-FLEECE-COAT-GIRLS-BLUE|,|$URL$mack-co-ruffle-fleece-coat-girls-blue.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mack-and-co-ruffle-fleece-coat-for-girls-in-blue-41.jpg||-||Mack and Co Winter Coat for Little Girls Polka Dot Pink|,|An adorable design, this new polka dot winter coat for girls comes from Mack and Co. The black fleece is covered with a large, white polka dot print. A wide ruffle creates a collar and falls gracefully upon the front. A cute pink fleece bow is found decorating the design and complimenting the large pink buttons that her fingers fasten up the front. The ruffled hemline is accented by the bell ruffle cuffs on both sleeves. 100% Polyester. Machine wash lukewarm. Dry on low. |,|$43.50$|,||,|MACK-CO-WINTER-COAT-LITTLE-GIRLS-POLKA-DOT-PINK|,|$URL$mack-co-winter-coat-little-girls-polka-dot-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mack-and-co-winter-coat-for-little-girls-polka-dot-pink-1.jpg||-||Made to Match Black Rosettes and Lace Headband|,|A perfect compliment to her designer holiday gown, this new handmade girls headband is just splendid! The sweet ivory lace band stretches to fit on her head and boasts of its floral design. A trio of flowers sits off centered on her head. The largest flower is made with layered black lace and silky satin while a two tone rosette is created with ivory tulle and black chiffon to match the small flower caught in the middle. Made to match Biscotti Standing Ovation and Cach Cach Bowtique Dresses and Outfits. |,|$21.75$|,||,|GIRLS-HOLIDAY-HEADBAND-LACE-ROSETTES|,|$URL$girls-holiday-headband-lace-rosettes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/made-to-match-black-rosettes-and-lace-headband-12.jpg||-||Made to Match Headband Tutu Du Monde|,|Made to match any of this season's Tutu Du Monde looks, this handmade headband is a LaBella Flora exclusive. On a super soft white lace headband, it will stay comfortably on her head. Two sea foam green satin rosettes embrace the sides while a larger emerald green sparkly flower sits in the middle. A white tuft of lace accents the top while thin frayed fabric edges complete the look. Proudly made in the USA. |,|$24.00$|,||,|MADE-MATCH-HEADBAND-TUTU-DU-MONDE|,|$URL$made-match-headband-tutu-du-monde.html|,|http://ep.yimg.com/ay/yhst-17102259411242/made-to-match-headband-tutu-du-monde-1.jpg||-||Mae Li Rose Designer Party Skirt for Girls|,|She will simply be the cutest in this sweet skirt from Mae Li Rose. This soft pink tulle skirt has a ful circle shape. The top layer of tulle is accented with two rows of satin ribbon while the bottom layer has delicate embroidery. The stretchy wide elastic waistband ensures a comfortable fit making this one of her favorite wardrobe pieces. Polyester/Cotton. Machine wash inside out in cold water. Hang to dry. |,|$21.00$|,||,|MAE-LI-ROSE-DESIGNER-PARTY-SKIRT-GIRLS|,|$URL$mae-li-rose-designer-party-skirt-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mae-li-rose-designer-party-skirt-for-girls-1.jpg||-||Mae Li Rose Elegant Faux Fur Vest for Girls (2T, 4, 6/6X)|,|A fabulous new look from Mae Li Rose, this gorgeous designer girls vest is filled with chic elegance. The vest is covered in a cut faux fur that is soft to the touch. A darling ivory ribbon is tied into a bow around the center. Chiffon accents are found on her left shoulder while the darling embroidered, scalloped lace decorates the neck and hemline. This vest is the perfect finishing touch to her darling Mae Li Rose outfits! 100% Polyester. Machine wash inside out in cold water. Hang to dry. |,|$24.00$|,||,|MAE-LI-ROSE-ELEGANT-FAUX-FUR-VEST-GIRLS|,|$URL$mae-li-rose-elegant-faux-fur-vest-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mae-li-rose-elegant-faux-fur-vest-for-girls-18.jpg||-||Mae Li Rose Fancy Flutter Sleeve Girls Dress|,|With it's subtle floral and lace details, this new girls boutique dress comes from designer Mae Li Rose. The bodice features a warm, ivory knit with a classic floral embroidered lace overlay. Her fluttery tulle short sleeves are created with a cute ruffle while they are finished with a crocheted lace hem. The skirt boasts of its fairytale tulle ruffles in matching ivory. Made of a cotton/poly blend. Machine wash inside out in cold water on gentile cycle. Hang to dry. |,|$24.00$|,||,|MAE-LI-ROSE-FANCY-FLUTTER-SLEEVE-GIRLS-DRESS|,|$URL$mae-li-rose-fancy-flutter-sleeve-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mae-li-rose-fancy-flutter-sleeve-girls-dress-40.jpg||-||Mae Li Rose Girls Fancy Glitter Leggings|,|A cute touch beneath her new skirts or dresses, these elegant girls leggings come from Mae Li Rose. The cream fabric is created with gold glitter and a soft stretch that hugs her skin. The waist also offers stretch with the elastic band. The hem of both legs is dressed with a quaint crochet ruffle finished with a golden edge. A single leg is decorated with a cute satin bow with a gold gemstone just above the hem. Cotton/Spandex Blend. Machine wash inside out in cold water. Hang Dry. |,|$11.25$|,||,|MAE-LI-ROSE-GIRLS-FANCY-GLITTER-LEGGINGS|,|$URL$mae-li-rose-girls-fancy-glitter-leggings.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mae-li-rose-girls-fancy-glitter-leggings-1.jpg||-||Mae Li Rose Girls Fancy Winter Skirt Ivory Ribbon|,|Pairing wonderfully with the new tops in their fall and winter collections, this new designer girls skirt is from Mae Li Rose. The skirt features a great elastic waist that has a comfortable stretch fit. The tulle skirt is created with a full circle shape while two stripes of ivory ribbon accent the top layer. Beneath the tulle we find a touch of scalloped lace. This touch brings in the loved vintage inspiration with its embroidered design. Polyester/Cotton. Machine wash inside out in cold water. Hang to dry. |,|$21.00$|,||,|MAE-LI-ROSE-GIRLS-FANCY-WINTER-SKIRT-IVORY-RIBBON|,|$URL$mae-li-rose-girls-fancy-winter-skirt-ivory-ribbon.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mae-li-rose-girls-fancy-winter-skirt-ivory-ribbon-1.jpg||-||Mae Li Rose Girls Ivory Leggings with Flowers|,|A cute touch beneath her new skirts or dresses, these elegant girls leggings come from Mae Li Rose. The fabric is created with a soft stretch that hugs her skin. The waist also offers stretch with the elastic band. The hem of both legs is dressed with a quaint crochet ruffle finished with a glitter edge. A single leg is decorated with a cute floral design just above the hem, layered with glitter tulle and finished with a gleaming center. Cotton/Spandex Blend. Machine wash inside out in cold water. Hang Dry. |,|$11.25$|,||,|MAE-LI-ROSE-GIRLS-IVORY-LEGGINGS-FLOWERS|,|$URL$mae-li-rose-girls-ivory-leggings-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mae-li-rose-girls-ivory-leggings-with-flowers-17.jpg||-||Mae Li Rose Girls Pink Designer Vest Holiday Pearl|,|A cozy design from vintage inspired Mae Li Rose, this darling girls vest is a part of their new fall collection. The dusty rose pink is a popular, trendy color for both fall and winter. The hood is lined in soft faux fur that is comfortable and warm. The outside of the vest is textured in floral lace overlay. Two large pearl buttons close the fit while a hidden pocket is found on both sides. Pair this darling vest over her new Mae Li Rose tunics and dresses! Rayon/Nylon/Spandex. Machine wash inside out in cold water. Hang to dry. |,|$25.50$|,||,|MAE-LI-ROSE-GIRLS-PINK-DESIGNER-VEST-HOLIDAY-PEARL|,|$URL$mae-li-rose-girls-pink-designer-vest-holiday-pearl.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mae-li-rose-girls-pink-designer-vest-holiday-pearl-18.jpg||-||Mae Li Rose Girls Pink Legging with Bows (12/18 Mos, 4T)|,|^|Designed by Mae Li Rose, these new girls leggings are simply cute! The pink cotton fabric has a slightly peachy tone to its hue, a perfect compliment to many skin types. Both knees are dressed with a crochet butterfly applique. Two bows flutter by the wings to complete the decoration. The leggings are long and are made with a fabric that allows stretch. Pair these leggings with the Mae Li Rose Fancy Pink Sweater for Girls! Fabric: 95% cotton, 5 % spandex. Machine wash and hang to dry. SIZE 12/18 MOS & 4T ONLY LEFT. ^||,|$9.75$|,||,|MAE-LI-ROSE-GIRLS-PINK-LEGGING-BOWS|,|$URL$mae-li-rose-girls-pink-legging-bows.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mae-li-rose-girls-pink-legging-with-bows-1.jpg||-||Mae Li Rose Girls Ruffle Lace Top Soft Pink (4T)|,|^|This darling sweater from designer Mae Li Rose is perfect for the cooler weather. This soft pink cable knit has a button keyhole closure. Soft ivory bows sit off to the left of the neckline. A romantic tulle ruffle completes the look at the hemline with delicate embroidery to complete the look. 100% Acrylic. Machine wash inside out in cold water. Hang to dry. SIZE 4T ONLY LEFT.  ^||,|$21.00$|,||,|MAE-LI-ROSE-GIRLS-RUFFLE-LACE-TOP-SOFT-PINK|,|$URL$mae-li-rose-girls-ruffle-lace-top-soft-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mae-li-rose-girls-ruffle-lace-top-soft-pink-1.jpg||-||Mae Li Rose Girls Special Occasion Dress Pink|,|^|An adorable new dress from designer Mae Li Rose, this dreamy tutu dress is certain to be one of her favorites! The bodice of this dress has a classic sleeveless fit. Gorgeous beading covers the bodice and creates a garden pattern. A wide sash is tied around the waist into a large bow. The star of this design is found in the full sized tutu skirt. This skirt adds elegance and whimsy to her look! 100% Polyester. Hand Wash in Cold Water. Hang to Dry. ALL SOLD OUT 12/14/14. ^||,|$30.75$|,||,|MAE-LI-ROSE-GIRLS-SPECIAL-OCCASION-DRESS-PINK|,|$URL$mae-li-rose-girls-special-occasion-dress-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mae-li-rose-girls-special-occasion-dress-pink-17.jpg||-||Mae Li Rose Ivory Cable Knit Tunic for Girls Winter Wonderland|,|New from Mae Li Rose, this darling sweater will have her looking chic all fall and winter long. The sweater is a warm ivory knit textured with the classic cable look upon the front. A single keyhole is closed with a button on her back. A flower applique sits off to the left side of her wide neckline. A dreamy tulle ruffle is found layered underneath the hem. Along with the tulle we find a touch of embroidered lace. 100% Acrylic. Machine wash inside out in cold water. Hang to dry. |,|$21.75$|,||,|MAE-LI-ROSE-IVORY-CABLE-KNIT-TUNIC-GIRLS-WINTER-WONDERLAND|,|$URL$mae-li-rose-ivory-cable-knit-tunic-girls-winter-wonderland.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mae-li-rose-ivory-cable-knit-tunic-for-girls-winter-wonderland-18.jpg||-||Mae Li Rose Lace Ruffle Top for Girls Ivory Chic|,|A fancy new top from Mae Li Rose, this fabulous design boasts of its chic vintage inspiration. The ivory top has light pleating that falls from the neckline creating a fabulous blouson drape. An embroidered lace ruffles around her neckline. The long sleeves help to keep her warm during the cool months of winter. A dreamy sheer tulle ruffle adds volume to the darling embroidered lace at the hem. This lace is finished with a scallop hem and matches the lace at her neckline. Cotton/Spandex. Machine wash inside out in cold water. Hang to dry. |,|$21.00$|,||,|MAE-LI-ROSE-LACE-RUFFLE-TOP-GIRLS-IVORY-CHIC|,|$URL$mae-li-rose-lace-ruffle-top-girls-ivory-chic.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mae-li-rose-lace-ruffle-top-for-girls-ivory-chic-1.jpg||-||Mae Li Rose Leggings for Girls Scalloped Lace|,|New from Mae Li Rose, these fabulous girls leggings look great beneath her fancy skirts and dresses. The ivory leggings have a great stretch that is comfortable to wear. The waist also stretches with the elastic band. The bottom of both legs are finished with a fancy hemline. The layers of textured tulle fall down into a scallop hemline and decorated with silver beads. A single quaint bow is placed at the top of the hem. Cotton/Spandex Blend. Machine Wash Inside Out. Cold Water. Hang Dry. |,|$13.50$|,||,|MAE-LI-ROSE-LEGGINGS-GIRLS-SCALLOPED-LACE|,|$URL$mae-li-rose-leggings-girls-scalloped-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mae-li-rose-leggings-for-girls-scalloped-lace-17.jpg||-||Mae Li Rose Little Girls Ivory Leggings Winter Warm (Size 4T)|,|^|A beautiful look beneath her fabulous tunics from Mae Li Rose, these ivory leggings are sure to be a staple in her fall and winter wardrobe. The ivory leggings have a great stretch in their fabric and have a comfortable elastic waist. The cute leg warmer look is created with a matching ivory knit. This knit is gathered at the sides and adorned with a single bow on both legs. The trendy look of these leggings will pair fabulously with her new fancy flats! Cotton/Spandex. Machine wash inside out in cold water. Hang to dry.(2) SIZE 4T REMAINING.  ^||,|$13.50$|,||,|MAE-LI-ROSE-LITTLE-GIRLS-IVORY-LEGGINGS-WINTER-WARM|,|$URL$mae-li-rose-little-girls-ivory-leggings-winter-warm.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mae-li-rose-little-girls-ivory-leggings-winter-warm-1.jpg||-||Mae Li Rose Little Girls Knit Sweater Holiday Dress|,|Boasting of vintage inspiration, this new dress comes from designer Mae Li Rose. The bodice features a warm, ivory knit with a classic raised stitch and stripes of the darling cable. Her neckline is created with a cute ruffle while and a satin bow sits off centered on her waist. The skirt boasts of its fairytale tulle ruffles in matching ivory. The top overlay is finished with a floral, embroidered lace. 100% Cotton. Machine wash inside out in cold water. Hang to dry. |,|$31.50$|,||,|MAE-LI-ROSE-LITTLE-GIRLS-KNIT-SWEATER-HOLIDAY-DRESS|,|$URL$mae-li-rose-little-girls-knit-sweater-holiday-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mae-li-rose-little-girls-knit-sweater-holiday-dress-18.jpg||-||Mae Li Rose Mint Green Girls Dress|,|Gorgeous from neckline to hem, this new designer toddler dress was created with care by Mae Li Rose. The gown is created from a trendy color for spring and summer. The bodice features a lacey overlay and a sleeveless neckline. The large tulle bow found on the back is a perfect detail! The skirt is a fun flirty blend of layers of sugar sweet tulle finished with an uneven hemline. She can wear this dress to weddings, birthdays, dance recitals, and more! |,|$31.50$|,||,|MAE-LI-ROSE-MINT-GREEN-GIRLS-DRESS|,|$URL$mae-li-rose-mint-green-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mae-li-rose-mint-green-girls-dress-1.jpg||-||Mae Li Rose Peach Dress with Shoulder Ties (4)|,|^|Mae Li Rose is now offering this gorgeous designer party dress for girls as a part of their spring and summer collection. The peachy pink fabric resembles the beauty of new blooms while the unique style is sure to be loved by all! The sleeveless bodice completed with girly tulle ties placed upon both shoulders while the fabric gathers at the waistline. The skirt of the dress is covered with swirling rosettes that produce great texture and interest.The gown is finished with a fun bubble hemline. ONE SIZE 4 ONLY LEFT. ^||,|$31.50$|,||,|MAE-LI-ROSE-PEACH-DRESS-SHOULDER-TIES|,|$URL$mae-li-rose-peach-dress-shoulder-ties.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mae-li-rose-peach-dress-with-shoulder-ties-17.jpg||-||Mae Li Rose Pink Leggings for Little Girls|,|These sweet leg warmers from Mae Li Rose will keep her snuggly warm this winter season. This classic soft pink knit legging is completed by soft leg warmers at the bottom of each legging and accented with darling soft pink bows. Cotton/Spandex. Machine wash inside out in cold water. Hang to dry. |,|$13.50$|,||,|MAE-LI-ROSE-PINK-LEGGINGS-LITTLE-GIRLS|,|$URL$mae-li-rose-pink-leggings-little-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mae-li-rose-pink-leggings-for-little-girls-1.jpg||-||Maria Casero Chevron Stripe Girls Dress (Size 6)|,|^|A trendy new piece from designer Maria Casero, this girls dress is available in sizes 4 to 6X. The messina knit fabric is designed with a chevron or zig zag stripe including colors like yellow, pink, black, and green. The cut is a relaxed fit and the half sleeves are finished with a double bell. 100% polyester. Hand wash cold, hang to dry. (1) SIZE 6 REMAINING. ^||,|$39.00$|,||,|MARIA-CASERO-CHEVRON-STRIPE-GIRLS-DRESS|,|$URL$maria-casero-chevron-stripe-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/maria-casero-chevron-stripe-girls-dress-2.jpg||-||Meg Dana Cream Flower Clip - Girls Hair Clip|,|Classic and extremely chic, she'll adore this cream flower hair clip. The color is saturated in the center, fading to a lighter cream on the outer petals. The center of this beautiful three and a half inch flower is decorated with silver and white rhinestones. Simple satin covered alligator clip. |,|$15.00$|,||,|MEG-DANA-CREAM-FLOWER-CLIP-GIRLS-HAIR-CLIP|,|$URL$meg-dana-cream-flower-clip-girls-hair-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/meg-dana-cream-flower-clip-girls-hair-clip-10.jpg||-||Meg Dana Dazzle Coral Hairclip|,|About 2 inches across, this feminine girls hair clip features a pretty coral rose with shiny rhinestones. By Meg Dana. |,|$14.00$|,||,|MEG-DANA-DAZZLE-CORAL-HAIRCLIP|,|$URL$meg-dana-dazzle-coral-hairclip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/meg-dana-dazzle-coral-hairclip-6.jpg||-||Meg Dana Green Headband with Yellow Flowers|,|Yellow flowers and a green headband by Meg Dana. |,|$21.00$|,||,|MEG-DANA-GREEN-HEADBAND-YELLOW-FLOWER|,|$URL$meg-dana-green-headband-yellow-flower.html|,|http://ep.yimg.com/ay/yhst-17102259411242/meg-dana-green-headband-with-yellow-flowers-10.jpg||-||Meg Dana Silver Satin Bow with Rhinestones Headband|,|Covered with silver satin, this girls headband has a bow at one side. Rhinestones add pretty shimmer. By Meg Dana. |,|$22.13$|,||,|MEG-DANA-SILVER-BOW--HEADBAND|,|$URL$meg-dana-silver-bow--headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/meg-dana-silver-satin-bow-with-rhinestones-headband-11.jpg||-||Meg Dana Yellow Rose Hairclip|,|A single yellow rose is embellished with rhinestones in this pretty girls hairclip by Meg Dana. About 1.5 inches across. |,|$14.00$|,||,|YELLOW-ROSE-HAIRCLIP|,|$URL$yellow-rose-hairclip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/meg-dana-yellow-rose-hairclip-7.jpg||-||Mim Pi Baby Girls Star Top with Fringe Skirt|,|Matching her older sisters new outfits from Mim Pi, this baby set is too cute! The blue top offers her long sleeves finished with a scallop trim to match the neckline. The front of the top boasts of a sequin star made with all colors and sizes. Paired with a fitted skirt that boasts of a pull on fit waist. The tiers of fringe mix beautiful colors together while the fringe is sure to dance with her movement. Made from cotton/lycra, machine washable. |,|$39.00$|,||,|MIM-PI-BABY-GIRLS-STAR-TOP-FRINGE-SKIRT|,|$URL$mim-pi-baby-girls-star-top-fringe-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-baby-girls-star-top-with-fringe-skirt-2.jpg||-||Mim Pi Baby Girls Striped Tights|,|To go with her new top and fringe skirt set, these infant tights are unbeatable from Mim Pi. The grey tights boast of the blue stripes that are interrupted with bright colored stripes half way to her knee. Another punch of color is received on both the toe and the heel of both feet. Made from a cotton blend. Machine wash warm, do not tumble dry. |,|$12.60$|,||,|MIM-PI-BABY-GIRLS-STRIPED-TIGHTS|,|$URL$mim-pi-baby-girls-striped-tights.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-baby-girls-striped-tights-2.jpg||-||Mim Pi Back to School Dress Speckled Blue - Size 4|,|^|Filled with a creative new look that is fun and delightful, this girls dress is proud to accompany her on school days. From Mim Pi, this dress features a bodice with loose fit sleeves that have a faux long sleeve layer beneath in bright pink. The neckline is accented with two tassels and dainty pink scallop trimmings. A pink tie becomes a bow around her waist, giving shape to the dress. The same speckled blue fabric continues down the skirt to the pink hem. Made from cotton/lycra. Machine washable. SIZE 4 ONLY LEFT. ^||,|$34.00$|,||,|MIM-PI-BACK-SCHOOL-DRESS-SPECKLED-BLUE|,|$URL$mim-pi-back-school-dress-speckled-blue.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-back-to-school-dress-speckled-blue-2.jpg||-||Mim Pi Blue and White Flower Socks (Size 8-10)|,|^|From European designer Mim Pi, these blue and white flower socks will tickle her fancy. The petite flower design is done in white with a red center over a blue background. These knee high socks will be so cute with her favorite dress, skirt or shorts. Made from a cotton blend. Machine wash warm, do not tumble dry. (1) SIZE 8-10 ONLY LEFT.  ^||,|$5.33$|,||,|MIM-PI-BLUE-WHITE-FLOWER-SOCKS|,|$URL$mim-pi-blue-white-flower-socks.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-blue-and-white-flower-socks-13.jpg||-||Mim Pi Blue Gingham Girls School Dress (Size 4)|,|^|Filled with the fun and lively styles we can always count on from designer girls clothing brand Mim Pi, this new dress is perfect for all her planned fun this fall. The long sleeve dress features a bright colorful yoke with a zipper in the center. The collar and cuffs help define the style while a pink fabric bow is tied around her waist. The blue and white gingham print covers the entire piece. Made from cotton/lycra. Machine washable. SIZE 4 ONLY LEFT.  ^||,|$39.00$|,||,|MIM-PI-BLUE-GINGHAM-GIRLS-SCHOOL-DRESS|,|$URL$mim-pi-blue-gingham-girls-school-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-blue-gingham-girls-school-dress-2.jpg||-||Mim Pi Blue Girls Shirt with Fashionista - Size 4|,|^|From designer Mim Pi, this new girls top will be the talk of all her friends. The blue faux shorts sleeves features long sleeves in a solid grey. The pink trimming found around the neckline is also seen on the sleeves. The front of the shirt is graced by a doll-like print of a fashionable girl. Not only do we find embellishments on her outfit, but also on her extravagant hair, made mostly of fun sequins. Made from cotton/lycra, machine washable. (1) 4 ONLY LEFT. ^||,|$24.00$|,||,|MIM-PI-BLUE-GIRLS-SHIRT-FASHIONISTA|,|$URL$mim-pi-blue-girls-shirt-fashionista.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-blue-girls-shirt-with-fashionista-2.jpg||-||Mim Pi Blue Romper for Girls with Belt (4, 5, 8 & 9)|,|Unlike any other piece in her closet, this new girls romper is prepared for every kind of fun that she has planned this summer. From the center of the neckline we find a trio of features dangling on the bodice, accented with stitching and sequins. The thin shoulder straps are found on her shoulders while the waist is tied with a thin braided belt. The bottom of the romper continues in the light blue fabric. This piece is a killer outfit all on its own! 95% cotton 5% lycra. Wash inside out with similar colors. |,|$48.00$|,||,|MIM-PI-BLUE-ROMPER-GIRLS-BELT|,|$URL$mim-pi-blue-romper-girls-belt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-blue-romper-for-girls-with-belt-1.jpg||-||Mim Pi Blue Scarf|,|Matching new arrivals from designer Mim Pi, this adorable accessory is sure to be one of her favorites for the summer! The long scarf can be worn in several different ways. The ends are tied to create long tassels. The blue native print has touches of pink found throughout. 100% cotton. Wash separately inside out. |,|$14.00$|,||,|MIM-PI-BLUE-SCARF|,|$URL$mim-pi-blue-scarf.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-blue-scarf-1.jpg||-||Mim Pi Blue Summer Top for Girls - Size 4, 7 &10|,|A creative new top just in time for summer, this darling design is one from Mim Pi. The geometric pattern blends blues, pink, and lime with ease. The short flutter sleeves are covered with ruffles of fabric. The wide neckline is embellished by a light pink rick rack ribbon. Pair the short sleeve top with a new pair of Mim Pi shorts or a cute summer skirt. Viscose/Lycra. Hand wash inside out cold water. Dry flat. |,|$29.00$|,||,|MIM-PI-BLUE-SUMMER-TOP-GIRLS|,|$URL$mim-pi-blue-summer-top-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-blue-summer-top-for-girls-1.jpg||-||Mim Pi Braided Tank Top for Girls (Size 7 & 10)|,|^|New from Mim Pi, this girls tank top is a great piece that has a casual look without sacrificing her individual style. The top boasts of a ""A"" line fit and a single pocket that is placed upon the front. The neckline is slightly curved while framed with wide straps. The straps come together to create a thick braid down the center down her back. The small touch of lime green stitching coordinated with the cool, bright blue that is inspired by the sunny skies. 95% Cotton 5% Lycra. Wash inside out with like colors. SIZE 7 AND 10 ONLY LEFT. ^||,|$17.25$|,||,|MIM-PI-BRAIDED-TANK-TOP-GIRLS|,|$URL$mim-pi-braided-tank-top-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-braided-tank-top-for-girls-1.jpg||-||Mim Pi Chevron Stripe Girls Tights (Size 6-8)|,|^|Matching her new outfits from Mim Pi, these adorable girls tights are too cute to miss out on. The grey tights boast of a bright pink waist band to match the toes and heel of both feet. From the top of her ankles, the chevron stripes start building up her legs in fun bright colors. Made from a cotton blend. Machine wash warm, do not tumble dry.SIZE 6-8 LEFT.  ^||,|$8.33$|,||,|MIM-PI-CHEVRON-STRIPE-GIRLS-TIGHTS|,|$URL$mim-pi-chevron-stripe-girls-tights.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-chevron-stripe-girls-tights-3.jpg||-||Mim Pi Embroidered Tunic Top in White (4, 5, 7 & 8)|,|^|Carefree, this fabulous new Mim Pi girls tunic top is sure to look fabulous as she plays in the sun. The top features a flutter short sleeve that is created with a wide fabric that cascades down both sides. The front of the bodice has a soft ""V"" shape that is accented with embroidered flowers and a small touch of pink threading. The back of the top has a single button that closes the top of a narrow keyhole. The waistline is smocked with a comfortable stretch. The solid white fabric is light weight and easy to layer if needed. The colors and style speak to the individual look of all Mim Pi. 100% cotton. Wash separately with similar color. ^||,|$38.00$|,||,|MIM-PI-EMBROIDERED-TUNIC-TOP-WHITE|,|$URL$mim-pi-embroidered-tunic-top-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-embroidered-tunic-top-in-white-1.jpg||-||Mim Pi Flower Tank Top for Girls (6)|,|^|From the fabulously creative designer, Mim Pi, this new girls tank is covered with graceful flowers and a beautiful blend of colors. The scoop neckline features a unique version of the popular racer back style that boasts of its lime green trimming. The front of the top is divided down the front between two coordinating patterns of blooms. All of the colors found in this top are an easy match to many accessories or bottoms to create darling outfits. 95% cotton 5% Elasthan. Wash inside out with similar colors. SIZE 6 ONLY LEFT. ^||,|$19.00$|,||,|MIM-PI-FLOWER-TANK-TOP-GIRLS|,|$URL$mim-pi-flower-tank-top-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-flower-tank-top-for-girls-1.jpg||-||Mim Pi Girls Blue Legging (4/5 & 9/10)|,|Mim Pi has created these bold leggings specifically to go with their fabulous new creations. The bright blue is a similar shade to the sky while a pop of lime green is found in the accenting ribbon on the hem of both legs as well as around the waist. The fabric offers her a stretch fit that is comfortable and close to her skin. The side of her left leg has a small decoration in pink stitching topped with a button. 95% Cotton 5% Lycra. Wash inside out with similar colors. |,|$17.25$|,||,|MIM-PI-GIRLS-BLUE-LEGGING|,|$URL$mim-pi-girls-blue-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-girls-blue-legging-1.jpg||-||Mim Pi Girls Dress with Stripes|,|A casual dress for girls, this new summer creation comes from Mim Pi. The straight neckline is framed with thin straps that boast of the two circle chain links that are found on both shoulders. An embroidered design is found on the front of the neckline, creating a trendy chevron stripe. The dress is raced with the light pink stripes from front to back. Tucks in the fabric create the shaped fit. The hemline is ruffled and has a small pop of lime green found in its stitching. 95% Cotton. 5% Elasthan. Wash inside out with similar colors. |,|$39.00$|,||,|MIM-PI-GIRLS-DRESS-STRIPES|,|$URL$mim-pi-girls-dress-stripes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-girls-dress-with-stripes-1.jpg||-||Mim Pi Girls Romper in Blue - Size 5 & 7|,|^|A fun new creation, this girls romper comes from the whimsical brand Mim Pi. The bodice features a chevron strip found on the blue print fabric. The straight neckline has thin straps and is accented with a small tassel. The waistline is cinched with ties on both sides to give shape. The attached shorts carry on the native print. 100% cotton. Wash inside out. SIZE 5 AND 7 ONLY LEFT.  ^||,|$39.00$|,||,|MIM-PI-GIRLS-ROMPER-BLUE|,|$URL$mim-pi-girls-romper-blue.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-girls-romper-in-blue-1.jpg||-||Mim Pi Girls Skirt with Colored Fringe (Size 9)|,|^|A creative new arrival from the designer behind Mim Pi, this darling girls skirt is one that she will love to mix and match! The soft stretch fit found in the waist is provided by elastic. The bottom of the skirt tiered in vibrant fringe from light blue, pink, green, and navy. Cute little pom poms dangle just above. Be sure to look at all the new girls tops that will match perfectly! Made from cotton/lycra, machine washable. ONE SIZE 9 LEFT. ^||,|$34.00$|,||,|MIM-PI-GIRLS-SKIRT-COLORED-FRINGE|,|$URL$mim-pi-girls-skirt-colored-fringe.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-girls-skirt-with-colored-fringe-3.jpg||-||Mim Pi Girls Striped Skirt in Blue|,|^|The perfect pair to several of the new tops from their summer collection, designer Mim Pi is now offering this short girls skirt. The cut of the skirt has an ""A"" line that opens slightly from the waist to the hem. The elastic waistline is comfortable while the colorful belt is softly tied around her and finished with large tassels. The blue and white stripe around the skirt while two pockets are found upon the front. 100% cotton. Wash separately inside out. ^||,|$33.00$|,||,|MIM-PI-GIRLS-STRIPED-SKIRT-BLUE|,|$URL$mim-pi-girls-striped-skirt-blue.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-girls-striped-skirt-in-blue-1.jpg||-||Mim Pi Girls Summer Dress in White|,|Designer Mim Pi has newly created this wonderful girls summer dress that is sure to make her feel like a free spirit under the sun. The long sleeve bodice is created with a light weight, white fabric and is lined with pink scallop ribbon. Both sleeves are home to a garden of embroidered flowers. This decoration matches the ring of posies that run around the wide neckline. Pleats open from the front center of the neck. A pink ribbon is tied around her waist in a bow. The full circle shape drapes around her legs, with extra fabric that looks fabulous as she twirls about. The tiers of the skirt are subtly defined while the hem is wrapped with the same pink found on the bodice. 100% cotton. Wash inside out with similar colors. |,|$48.00$|,||,|MIM-PI-GIRLS-SUMMER-DRESS-WHITE|,|$URL$mim-pi-girls-summer-dress-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-girls-summer-dress-in-white-1.jpg||-||Mim Pi Girls T-Shirt with Sequin Star (4, 5 & 9)|,|With plenty of fun new pieces that match this top perfectly, it will not be hard to create your own dreamy outfits filled with Mim Pi fun. The long sleeve top boasts of a blue bodice and grey sleeves. Both cuffs add just a small touch of shimmer. The front of the top is bright from the radiant sequin star that makes its home in the center. Different colors and sizes of sequins create this masterpiece. The neckline is decorated by a sweet pink scallop. Made from cotton/lycra, machine washable. |,|$21.33$|,||,|MIM-PI-GIRLS-T-SHIRT-SEQUIN-START|,|$URL$mim-pi-girls-t-shirt-sequin-start.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-girls-t-shirt-with-sequin-star-3.jpg||-||Mim Pi Girls Top in Speckled Blue (Size 9)|,|^|Matching several other new arrivals from the Mim Pi fall 2013 collection, this new girls top is adorable. The speckles that cover the blue fabric are bright and add texture to the print. Just beneath the wide scallop neckline we find cute stitching details that finish with sweet falling hearts. The hemline is wrapped with a matching pink scallop garnish. Made from cotton/lycra, machine washable. SIZE 9 ONLY LEFT.  ^||,|$24.00$|,||,|MIM-PI-GIRLS-TOP-SPECKLED-BLUE|,|$URL$mim-pi-girls-top-speckled-blue.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-girls-top-in-speckled-blue-3.jpg||-||Mim Pi Girls White and Pink Socks|,|^|Knee high with style, these girls socks are fresh from Europe from designer Mim Pi. White socks are pretty in pink with a lattice design. She'll adore wearing these with her summer shorts, skirts and dresses. Made from a cotton blend, machine washable. SIZE 4-6 ONLY REMAINING.  ^||,|$6.00$|,||,|MIM-PI-GIRLS-WHITE-PINK-SOCKS|,|$URL$mim-pi-girls-white-pink-socks.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-girls-white-and-pink-socks-13.jpg||-||Mim Pi Gray Sweat Pants for Girls (Size 10)|,|^|Cozy and impossible to take off, these new sweat pants will become of her favorite pieces from Mim Pi. The grey pants boast of a draw string waist with a wide knot that is off centered to her right. A pocket is found on both legs and boasts of a silver zipper lined in hot pink. The wide ribbed knit hem on both legs is striped with pink and creates a great shape with its fitted finish. 100% Cotton. Machine washable. (1) SIZE 10 LEFT.  ^||,|$29.00$|,||,|MIM-PI-GRAY-SWEAT-PANTS-GIRLS|,|$URL$mim-pi-gray-sweat-pants-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-gray-sweat-pants-for-girls-3.jpg||-||Mim Pi Green Faux Fur Girls Vest - Size 4|,|^|Unique, this new arrival comes from Mim Pi. The sleeveless shrug boasts of its green faux fur and collared neckline. This shrug is perfect to layer over her new Mim Pi tops! The piece is lined in a satin like fabric that is matching in green. Shell: Acrylic blend. Lining: 100% polyester. Machine wash cold, do not tumble dry. (1) 4 ONLY LEFT.  ^||,|$29.00$|,||,|MIM-PI-GREEN-FAUX-FUR-GIRLS-VEST|,|$URL$mim-pi-green-faux-fur-girls-vest.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-green-faux-fur-girls-vest-3.jpg||-||Mim Pi Infant Tutu Dress in Pink and Blue|,|One of the top new designs from Mim Pi, this tutu dress is new for the coming spring and summer. The blue bodice is slightly fitted and has a double strap. A thick braid is created from the shoulder straps and is found on the center of her back, inspired by a racer back cut. The skirt is made with the same blue fabric while a sheer pink overlay disguises the color. Fun tassels are found upon the skirt in differing, bright colors. 95% cotton 5% nylon. Hand wash inside out in cold water. Line dry. |,|$33.00$|,||,|MIM-PI-GIRLS-TUTU-DRESS-PINK-BLUE|,|$URL$mim-pi-girls-tutu-dress-pink-blue.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-girls-tutu-dress-in-pink-and-blue-11.jpg||-||Mim Pi Love Butterfly Top for Girls (Size 7 & 8)|,|^|The fanciful Mim Pi style is always filled with fun, color, and trendy pieces like this new top from their summer collection. The top is made in solid white and has short, flutter sleeves. The butterfly fit of this top is loved not only for its look, but also comfort. The neckline is accented with a pink rick rack ribbon. The front of this top reads ""LOVE"" which is created through various stitching and shimmering sequins. 95% Cotton 5% Lycra. Wash inside out with similar colors. SIZE 7 AND 8 LEFT. ^||,|$33.00$|,||,|MIM-PI-LOVE-BUTTERFLY-TOP-GIRLS|,|$URL$mim-pi-love-butterfly-top-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-love-butterfly-top-for-girls-1.jpg||-||Mim Pi Pink Skinny Jeans for Girls|,|Worn easily with any of the new tops found in Mim Pi's summer collection, this pair of girls skinny jeans will quickly become one of her favorites. The light pink denim boasts of slight fading found on the front and offers the classic five pockets. The button and zipper fly closes the fit while the waist has a set of loops in case she wishes to add a belt. The front of the skinny jeans have small touches of colorful embroidery to match the fluttering butterfly that is found on the back. |,|$48.00$|,||,|MIM-PI-PINK-SKINNY-JEANS-GIRLS|,|$URL$mim-pi-pink-skinny-jeans-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-pink-skinny-jeans-for-girls-1.jpg||-||Mim Pi Pink Striped Girls Skirt|,|Short in cut but not in style, this new arrival comes from boutique girls designer Mim PI. The skirt is wrapped with grey and pink stripes while the elastic waist has an easy pull on fit. A solid gray layer peaks out beneath the tied fringe and is finished with a lime scallop hem. Two pockets give a place for her hands to rest. Pair with a Mim Pi top and unique tights for a really stellar outfit! Made from cotton/lycra, machine washable. |,|$18.33$|,||,|MIM-PI-PINK-STRIPED-GIRLS-SKIRT|,|$URL$mim-pi-pink-striped-girls-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-pink-striped-girls-skirt-3.jpg||-||Mim Pi Striped Girls Skirt in Chevron - Size 6|,|^|Knit in style, this new girls skirt comes from the whimsical designer Mim Pi. The blue waist has a pull on fit with the stretch provided by elastic. The skirt itself is covered with a colorful chevron print with greens, blues, pinks, and gray. The knit pattern has rows of double holes that are in a line from waist to hem. Pair with her favorite new top and the chevron leggings. Outer: 100% Acrylic. Inner: Cotton blend. Machine wash cold, do not tumble dry. (1) 6 REMAINING. ^||,|$29.00$|,||,|MIM-PI-STRIPED-GIRLS-SKIRT-CHEVRON|,|$URL$mim-pi-striped-girls-skirt-chevron.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-striped-girls-skirt-in-chevron-3.jpg||-||Mim Pi White and Blue Girls Socks (Size 4-6)|,|^|A fun addition to any outfit, these white and blue girls socks are from designer Mim Pi. The white socks boast of a lattice pattern of blue with red accents. The knee length style will work well with a dress, skirt or shorts. Made from a cotton blend, machine washable.SIZE 4-6 REMAINING.  ^||,|$6.00$|,||,|MIM-PI-WHITE-BLUE-GIRLS-SOCKS|,|$URL$mim-pi-white-blue-girls-socks.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-white-and-blue-girls-socks-13.jpg||-||Mim Pi White Tunic Top with Colorful Details|,|Mim Pi is now offering this casual summer tunic that is light hearted and easy to wear. The white fabric is a light weight that allows her skin a small touch of protection from the sun without being warm. The top of the tunic has a relaxed cut that falls with a blouson fit as a result of the elastic gathered waist. The short sleeves and wide neckline are accented with colorful embroidering. A matching braided belt is tied at the waist while the skirt continues in the same solid white, adorned only with an embroidered hemline.  |,|$48.00$|,||,|MIM-PI-WHITE-TUNIC-TOP-COLORFUL-DETAILS|,|$URL$mim-pi-white-tunic-top-colorful-details.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-white-tunic-top-with-colorful-details-1.jpg||-||Mimi and Maggie Girls Party Dress Charcoal Gray (Size 4T, 4, 6 & 6X)|,|An unique and fancy new arrival from Mimi and Maggie, this girls tulle dress is sure to liven any party. The deep charcoal dress features pleated tulle straps and soft satin roses covering the front. The back of the bodice is made with a smocked stretch fabric for a perfect fit. The skirt is lined and features ruffles falling down to the matching hemline. The romantic feel of the dress comes from the dancing flow of the skirt as she moves and the unique hem shape. Hand wash with care, lined with cotton. |,|$28.33$|,||,|MIMI-MAGGIE-GIRLS-PARTY-DRESS-CHARCOAL-GRAY|,|$URL$mimi-maggie-girls-party-dress-charcoal-gray.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mimi-and-maggie-girls-party-dress-charcoal-gray-15.jpg||-||Mimi and Maggie Infant Romper for Girls in Fresh Bloom|,| |,|$48.00$|,||,|MIMI-MAGGIE-INFANT-ROMPER-GIRLS-FRESH-BLOOM|,|$URL$mimi-maggie-infant-romper-girls-fresh-bloom.html|,|||-||Mimi and Maggie Little Girls Dress with Flower Applique - 3/6 Mos & 12 Mos|,|^|As darling as can be, this new little girls dress comes from Mimi and Maggie as part of their ""Autumn Moon"" collection for the fall 2013 season. The long sleeve bodice boasts of its natural fiber grains that add texture to the fabric. The large flower applique upon the front sprouts up from the skirt and blooms with different fabric petals. The skirt is ruffled on the side and is layered with two printed fabrics. Upper: cotton-spandex blend. Lower: viscose-cotton blend. Machine wash inside out, tumble dry. SIZE 3-6 MOS AND 12 MOS ONLY AVAILABLE.  ^||,|$29.00$|,||,|MIMI-MAGGIE-LITTLE-GIRLS-DRESS-FLOWER-APPLIQUE|,|$URL$mimi-maggie-little-girls-dress-flower-applique.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mimi-and-maggie-little-girls-dress-with-flower-applique-2.jpg||-||Mimi and Maggie Little Girls Pink Pirouette Dress (4)|,|^|New from Mimi and Maggie, this adorbale little girls dress is available in sizes 2T to 6X. The long sleeve pink bodice boasts of an empire waist, fitted cut, and a wide neckline adorned by sweet embroidered flowers. The lining of the skirt is pink and peaks through the sheer layers in a shorter cut. The ivory sheer skirt falls down in a scalloped hemline and are trimmed from the rows of ruffles that fall down from the waist. Made with a rayon blend. Hand wash cold, lay flat to dry.ONE SIZE 4 ONLY LEFT. ^||,|$39.00$|,||,|MIMI-MAGGIE-LITTLE-GIRLS-PINK-PIROUETTE-DRESS|,|$URL$mimi-maggie-little-girls-pink-pirouette-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mimi-and-maggie-little-girls-pink-pirouette-dress-1.jpg||-||Mimi and Maggie Long Sleeve Dress for Infant Girls (3/6 mos)|,|^|Filled with the classic Mimi and Maggie style, this dress is as cozy as home. The long sleeve dress boasts of a drop waist bodice adorned with a bouquet of spiral rosettes growing tall. The different colors of flowers all mix together beautifully. The skirt is made with three tiers that are ruffled around her legs. With their tiny floral prints, all three fabrics coordinate well with the top. Upper: cotton-spandex blend. Lower: viscose-cotton blend. Machine wash inside out, tumble dry. ONE 3/6 MOS ONLY LEFT. ^||,|$34.00$|,||,|MIMI-MAGGIE-LONG-SLEEVE-DRESS-INFANT-GIRLS|,|$URL$mimi-maggie-long-sleeve-dress-infant-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mimi-and-maggie-long-sleeve-dress-for-infant-girls-2.jpg||-||Mimi and Maggie Navy Corps de Ballet Dress|,|A sweet dress created by Mimi and Maggie, this new arrival is sure to look darling on your little girl. The long sleeve bodice has an empire waistline and boasts of its comfortable light fabric with the natural fiber grains. The front of the bodice is embroidered with quaint flowers. The skirt is created with layers of navy tulle and a lining for her privacy. Made with a rayon blend. Hand wash cold, lay flat to dry. |,|$37.33$|,||,|MIMI-MAGGIE-NAVY-CORPS-DE-BALLET-DRESS|,|$URL$mimi-maggie-navy-corps-de-ballet-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mimi-and-maggie-navy-corps-de-ballet-dress-1.jpg||-||Mimi and Maggie Red Apron Patchwork Girls Dress - 12 Mos|,|^|New from Mimi and Maggie, this darling little girls dress comes in infant and toddler sizes. The sweet skirt is made by mixing different fabric prints together, draping from the empire waist to create the fabulous handkerchief hem. The soft red bodice is comfortable on her skin for all day wear while the long sleeves are perfect for fall. The fabric has great natural fiber stripes that run through out. The cotton blend bodice allows slight stretch. Skirt made with viscose blend, machine wash on delicate. SIZE 12 MOS ONLY LEFT. ^||,|$34.00$|,||,|MIMI-MAGGIE-RED-APRON-PATCHWORK-GIRLS-DRESS|,|$URL$mimi-maggie-red-apron-patchwork-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mimi-and-maggie-red-apron-patchwork-girls-dress-14.jpg||-||Mimi and Maggie Summer Dress for Girls in Red Stripes|,| |,|$58.00$|,||,|MIMI-MAGGIE-SUMMER-DRESS-GIRLS-RED-STRIPES|,|$URL$mimi-maggie-summer-dress-girls-red-stripes.html|,|||-||Mini Mini Baby Girl Leopard Print Tutu Dress|,|A new infant dress from Mini Mini, this piece is a sweet and sassy style. The empire bodice is covered completely with leopard spots and offers her long sleeves. A large heart placed upon the front is created by fabric rosettes. The animal print on the skirt shows through the overlay. The champagne tulle has a sheen as it catches rays of light. Polyester/Spandex/Nylon Blend. Machine wash in cold water. Tumble dry one low. Made in the USA. |,|$48.00$|,||,|MINI-MINI-BABY-GIRL-LEOPARD-PRINT-TUTU-DRESS|,|$URL$mini-mini-baby-girl-leopard-print-tutu-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mini-mini-baby-girl-leopard-print-tutu-dress-1.jpg||-||Mini Mini Baby Tunic Set in Pink Designer Stripe|,|For your adorable baby girl, this new outfit by Mini Mini is available in infant sizes. The tunic is covered with thin pink and ivory stripes. The handkerchief hemline is introduced with a crochet ribbon as it dances in ruffles on her sides. Just beneath the neckline we find a garden of fabric flowers and a single ribbon bow. Solid pink leggings are paired beneath with a raw fiber texture in the color. The hem of both legs is finished with three striped ruffles. Made in the USA. Polyester/Rayon. Machine wash in cold water. Tumble dry on low. |,|$47.00$|,||,|MINI-MINI-BABY-TUNIC-SET-PINK-DESIGNER-STRIPE|,|$URL$mini-mini-baby-tunic-set-pink-designer-stripe.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mini-mini-baby-tunic-set-in-pink-designer-stripe-1.jpg||-||Mini Mini by Little Mass Lace Top with Bubble Shorts|,|A simply adorable new outfit for little girls, this design comes from fabulous Mini Mini by Little Mass. The top boasts of its sweet embroidered lace in light ivory. The short sleeves are sheer while small flower accents are found just beneath her right shoulder. The top is a crop length and finishes with an uneven hemline. Paired with the top we find a pair of cute bubble shorts. The blue shorts are covered with a quaint polka dot while the bubble hemline on both legs really add character. A large sash is tied around her waist in a bow. Rayon/Cotton. Machine wash cold. |,|$39.00$|,||,|MINI-MINI-LITTLE-MASS-LACE-TOP-BUBBLE-SHORTS|,|$URL$mini-mini-little-mass-lace-top-bubble-shorts.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mini-mini-by-little-mass-lace-top-with-bubble-shorts-1.jpg||-||Mini Mini Infant Pink Tutu Dress Bow-Tacular|,|A cute new design by Mini Mini, this fabulous baby girls dress is perfect for the celebrations found within fall and winter. The light pink bodice is covered with small ribbon bows from the classic neckline to the waist. The long sleeves are a velour fabric, soft to the touch. The tutu skirt is created with many pieces of fun pink tulle. A large bow is found off centered on her waist, completed with a rosette center and gem accents. 100% Polyester. Machine Wash in Cold Water. Tumble Dry on Low. |,|$49.50$|,||,|MINI-MINI-INFANT-PINK-TUTU-DRESS-BOW-TACULAR|,|$URL$mini-mini-infant-pink-tutu-dress-bow-tacular.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mini-mini-infant-pink-tutu-dress-bow-tacular-1.jpg||-||Mini Mini Infant Tunic and Legging Set Puppy Love|,|From Mini Mini, a sister brand to Little Mass, this new baby girls outfit is absolutely adorable! The cute top is a perfect match to a design available from Little Mass in their fall line. The matching outfit will look cute on her older sister! The top has a large puppy screen print. The Yorkie is set in a cute purse and accented with studs. Leggings accompany the top and are covered in a leopard print. Polyester/Rayon/Spandex Blend. Machine Wash in Cold Water. Tumble Dry Low. |,|$39.00$|,||,|MINI-MINI-INFANT-TUNIC-LEGGING-SET-PUPPY-LOVE|,|$URL$mini-mini-infant-tunic-legging-set-puppy-love.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mini-mini-infant-tunic-and-legging-set-puppy-love-17.jpg||-||Mini Mini Infant Tutu Dress Red Heart Love|,|Whether its Valentine's day or not, this new heart-filled design from Mini Mini is a cute dress she will receive many compliments on. The bodice is covered with a small red heart print. Long sleeves and an empire waist style the shape while a single crochet flower is found beneath the neckline. The full skirt is created with layers of sheer red tulle. Ruffles divide the tiers of the skirt and accent the final hem. Polyester/Rayon/Spandex Blend. Machine Wash in Cold Water on Gently Cycle. Hang to Dry. |,|$54.00$|,||,|MINI-MINI-INFANT-TUTU-DRESS-RED-HEART-LOVE|,|$URL$mini-mini-infant-tutu-dress-red-heart-love.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mini-mini-infant-tutu-dress-red-heart-love-1.jpg||-||Mini Mini Ivory Tulle Infant Dress (24 Mos)|,|^|New from the Mini Mini line by Little Mass, this sweet new dress is as cute as can be. The light ivory is fully lined and offers long sleeves and a thin pink waist that ties in a bow in the back. Pink and ivory crochet flower appliques accent under her neckline. The fanciful skirt has ivory tulle layers in a fairy skirt cut. The light weight fabric is made with rayon, polyester, and spandex. Machine washable in cold water; tumble dry on low.SIZE 24 MOS LEFT.  ^||,|$29.33$|,||,|MINI-MINI-IVORY-TULLE-INFANT-DRESS|,|$URL$mini-mini-ivory-tulle-infant-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mini-mini-ivory-tulle-infant-dress-2.jpg||-||Mini Mini Little Girls Bailey Floral Lace Tutu Dress (Size 3 Mos)|,|^|Her twirling dreams will come true in this little girls tutu dress from the Mini Mini collection of designer Little Mass. The lace bodice boasts of a floral print on the lace. Fluttery lace sleeves are at the shoulders. A keyhole opening at the back closes with a single pink button. A large pink and white flower blooms on the drop waist. The fun tutu is created from layers of tiered pink tulle over a lining of pink. Dainty pink flowers are with sequin centers are scattered randomly across the skirt. Made from cotton/polyester. Machine wash cold, tumble dry low. SIZE 3 MONTH ONLY LEFT.  ^||,|$39.00$|,||,|MINI-MINI-LITTLE-GIRLS-BAILEY-FLORAL-LACE-TUTU-DRESS|,|$URL$mini-mini-little-girls-bailey-floral-lace-tutu-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mini-mini-little-girls-bailey-floral-lace-tutu-dress-14.jpg||-||Mini Mini Little Girls Dress Pink Symphony|,|A fun casual dress for your little girl, this new arrival was designed with love by the Mini Mini line from Little Mass. The lime striped dress features a cute shark bite hemline that is created by the ruffled sides accented with pink mesh. The bodice boasts of a detached sweater that is worn over top. This knit bolero has a pull over fit and is made with a light shade of pink. The long sleeves add warmth from the chilly wind while the front is covered with lime and pink petal flowers. Created with poly-cotton blends. Machine wash both pieces and tumble dry on low. |,|$29.33$|,||,|MINI-MINI-LITTLE-GIRLS-DRESS-PINK-SYMPHONY|,|$URL$mini-mini-little-girls-dress-pink-symphony.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mini-mini-little-girls-dress-pink-symphony-2.jpg||-||Mini Mini Little Girls Leopard Ruffle Dress (Size 18 Mos)|,|^|With a touch of the wild side, this adorable new dress comes from the Mini Mini line by Little Mass. The long sleeve bodice is covered with a grey leopard print while light pink rosettes ring around the neckline with a matching pink bow in the center. The skirt is made with three tiers of ruffles created with grey, zebra, and a fun pink plaid. Long sleeves help keep her warm in the cool months. Self: polyester and rayon blend with 5% spandex; Contrast: 100% cotton. ONE SIZE 18 MOS ONLY LEFT.  ^||,|$24.00$|,||,|MINI-MINI-LITTLE-GIRLS-LEOPARD-RUFFLE-DRESS|,|$URL$mini-mini-little-girls-leopard-ruffle-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mini-mini-little-girls-leopard-ruffle-dress-2.jpg||-||Mini Mini Little Girls Polka Dot Dress (3 Mos)|,|^|Such a sweet new arrival from designer Mini Mini, this darling little girls dress is available from 3MOS to 4T. The long sleeve bodice is made with a soft sweater fabric that boasts of its white polka dots. A pink rick rack ribbon falls down from the neckline and around the drop waist. Three black bows also adorn the bodice, finished with a sparkling button center. The soft pink skirt is made with soft, layered pink faux fur. Created with a stretch polyblend, faux fur is 100% polyester. Machine wash cold and hang to dry. SIZE 3 MOS ONLY LEFT. ^||,|$24.00$|,||,|MINI-MINI-LITTLE-GIRLS-POLKA-DOT-DRESS|,|$URL$mini-mini-little-girls-polka-dot-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mini-mini-little-girls-polka-dot-dress-2.jpg||-||Mini Mini Little Girls Ruffle Dress in Soft Peach|,|A truly sweet little dress, this new flower girl style comes from Little Mass. This dress is just precious with it's ruffles for days! The thin straps are ruffled with tulle and meet at the center of her back. The dress is made with layers upon layers of pluming ruffles in a peachy pink color, all the way down to the uneven hem. Cotton/Polyester. Machine wash in cold water. Tumble dry on low. |,|$74.00$|,||,|MINI-MINI-LITTLE-GIRLS-RUFFLE-DRESS-SOFT-PEACH|,|$URL$mini-mini-little-girls-ruffle-dress-soft-peach.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mini-mini-little-girls-ruffle-dress-in-soft-peach-1.jpg||-||Mini Mini Little Girls Tunic with Leggings Blush Rose|,|Such an adorable vintage inspired style for your little one! This new tunic and capri set from Little Mass is just darling with it's all over lace tank top. The top is accented with a tiny cluster of ruffled flowers at her shoulder and layers of adorable lace ruffles flowing down to the hem. The capri pants are a matching peachy color and offer and elastic waistband for easy fit and rouched legs. Polyester/Cotton Blend. Machine wash in cold water. Tumble dry on low. Made in the USA. |,|$76.00$|,||,|MINI-MINI-LITTLE-GIRLS-TUNIC-LEGGINGS-BLUSH-ROSE|,|$URL$mini-mini-little-girls-tunic-leggings-blush-rose.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mini-mini-little-girls-tunic-with-leggings-blush-rose-16.jpg||-||Mini Mini Pink Lace Flower Little Girls Dress|,|^|Perfect for all of her special occasions, this little girls dress is from the Mini Mini collection of Little Mass. The lace bodice plays host to a large rosette in the center, while the pink lining peaks through the lace. Ruffled lace cap sleeves and a keyhole opening at the back are other features. The tutu skirt begins at the drop waist. Double layers of pink ruffled tulle overlay a soft pink underskirt. Made from polyester/cotton. Machine wash cold, tumble dry low. SIZE 3, 6 AND 12 MONTH REMAIN. ^||,|$19.00$|,||,|MINI-MINI-PINK-LACE-FLOWER-LITTLE-GIRLS-DRESS|,|$URL$mini-mini-pink-lace-flower-little-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mini-mini-pink-lace-flower-little-girls-dress-14.jpg||-||Mini Mini Pink Tutu Dress for Girls with Denim Bodice - 18 Mos, 2T & 4T|,|From designer Mini Mini, this new little girls dress is a perfect casual piece for both spring and summer. The denim bodice features three buttons that fasten in the front and a high, empire waistline. A single light pink flower is found off centered on the front of the top. The skirt is layered with uneven tulle in the same soft pink. The layers drape elegantly around her legs and finish with a fairy hemline. This new dress can be paired wi