|name|,|description|,|price|,|category|,|offer_id|,|product_url|,|image_url||-||9's Girls One Piece Swimsuit Mint|,|^|In the same cool shade as several other pieces, To The Nine's has created this fabulous and stylish suit for your tween. The one piece suit boasts of an open back that creates the illusion of a bikini. The front has a ruffled top that accents the fun one shoulder designer. The light mint green shade stands out amongst all of the other designs and will perfectly fit family vacations or summer fun! Polyamide stretch blend. Lay flat to dry. SIZE 10 AND 12 ONLY LEFT.  ^||,|$54.00$|,||,|9-S-ONE-PIECE-SWIMSUIT-MINT|,|$URL$9-s-one-piece-swimsuit-mint.html|,|http://ep.yimg.com/ay/yhst-17102259411242/9-s-girls-one-piece-swimsuit-mint-1.jpg||-||9's Jeweled Print Girls Bikini|,|A real gem, this new swimsuit comes from fabulous tween swimwear designer To The Nines. The top features a custom fit allowed by the knot that is tied on her back. The straight hems are given slight shape by that draw string center that continues to become the thin halter straps. The suit is covered with a unique jewel print in rich colors. The matching bottoms are a simple cut in order to not detract from the gorgeous style of the top. Created in a polyamide blend. Hand wash and lay flat to dry. |,|$52.00$|,||,|9S-JEWELED-PRINT-GIRLS-BIKINI|,|$URL$9s-jeweled-print-girls-bikini.html|,|http://ep.yimg.com/ay/yhst-17102259411242/9-s-jeweled-print-girls-bikini-1.jpg||-||9's Ombre Ruffled Bikini Swimsuit|,|^|Covered with a fun print, this new tween bikini comes from To The Nine's swimwear line for 2014. The speckled top is in an ombre, exotic blue and features a dramatic ruffle on the neckline and a trendy halter strap. The back ties in a knot and offers her an individual fit. The matching bottoms are accented with a single knot tied on both hips. Polyamide and elastane blend fabric, rinse in cold water after use. Hand wash only and lay flat. SIZE 16 LEFT.  ^||,|$54.00$|,||,|9-S-OMBRE-RUFFLED-BIKINI-SWIMSUIT|,|$URL$9-s-ombre-ruffled-bikini-swimsuit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/9-s-ombre-ruffled-bikini-swimsuit-1.jpg||-||9's One Piece Tween Swimsuit in Ombre|,|^|Made by the trendy tween swimwear designer, To The 9's, this fabulous one piece swimsuit is gorgeous! The halter straps tie in a bow behind her neck while the soft V neckline is draped with a wide ruffle. The back is open and features a thin strap that ties in a bow. The unique print blends fun shades with a soft speckle. The swimsuit is lined and made with a polyamide blend. Hand wash and lay flat. SIZE 10, 12 AND 14 REMAINING. ^||,|$56.00$|,||,|9S-ONE-PIECE-TWEEN-SWIMSUIT-OMBRE|,|$URL$9s-one-piece-tween-swimsuit-ombre.html|,|http://ep.yimg.com/ay/yhst-17102259411242/9-s-one-piece-tween-swimsuit-in-ombre-1.jpg||-||9's Ruffles Lilac Bikini|,|A trendy design that is loved by all, this girls bikini was designed by To The Nine's. The dreamy lilac fabric has a slight sheen to it while the one shoulder style creates a beautiful neckline. Her left shoulder has a thin strap while ruffles layer from the top to the hem. The matching bikini bottoms are skirted with two similar ruffles. Both pieces are lined fully. Fabric is a polyamide and elastane blend. Rinse in cold water after each use. Hand wash and line dry. |,|$52.00$|,||,|9-S-RUFFLED-LILAC-BIKINI|,|$URL$9-s-ruffled-lilac-bikini.html|,|http://ep.yimg.com/ay/yhst-17102259411242/9-s-ruffles-lilac-bikini-1.jpg||-||A Bird Cream and Stripe Abbie Reversible Belt|,|^|A new reversible belt from A. Bird, this piece is created to match almost any of her new fall pieces. The belt features a side striped with light pink and brown while the solid cream is textured. The fabric measures about 19 inches and the bow wraps back around the front to tie in front of the fabric. Total length is roughly 36.5"". ^||,|$9.00$|,||,|A-BIRD-CREAM-STRIPE-ABBIE-REVERSIBLE-BELT|,|$URL$a-bird-cream-stripe-abbie-reversible-belt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/a-bird-cream-and-stripe-abbie-reversible-belt-15.jpg||-||A Bird Girls Linen Pants with Triple Ruffle Hem|,|^|Designer A. Bird Baby is now offering these over the top fantastic linen pants for girls. The pants feature an elastic waist for an easy fit while the wide legs are hemmed with three tiers of ruffles. The ivory linen adds to the vintage feel, dry clean. Proudly made in the USA. SIZE 3 REMAINING. ^||,|$19.00$|,||,|A-BIRD-GIRLS-LINEN-PANTS-TRIPLE-RUFFLE-HEM|,|$URL$a-bird-girls-linen-pants-triple-ruffle-hem.html|,|http://ep.yimg.com/ay/yhst-17102259411242/a-bird-girls-linen-pants-with-triple-ruffle-hem-16.jpg||-||A Bird Girls Sylvia Tunic in Floral|,|^|Designed in a shorter length to pair with her favorite leggings, this new girls dress comes from designer A.Bird. The bodice features long sleeves, an empire waist, and three buttons to close the back. The skirt opens up a bit in fit to accent her shape. Made in the US, 100% polyester. Dry clean if needed. SIZE 4 ONLY LEFT.  ^||,|$19.00$|,||,|A-BIRD-GIRLS-SYLVIA-DRESS-FLORAL|,|$URL$a-bird-girls-sylvia-dress-floral.html|,|http://ep.yimg.com/ay/yhst-17102259411242/a-bird-girls-sylvia-tunic-in-floral-15.jpg||-||A Bird Reversible Abbie Belt for Girls in Black|,|^|The perfect accessory for her new designer A. Bird outfit, this girls fabric belt is reversible. The fabric part of the belt measures roughly 19"" and features one side in a black plaid while the other is in a soft, solid velvet. The string wraps back around the front to tie in a bow. Total length is roughly 36.5"". ^||,|$9.00$|,||,|A-BIRD-REVERSIBLE-ABBIE-BELT-GIRLS-BLACK|,|$URL$a-bird-reversible-abbie-belt-girls-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/a-bird-reversible-abbie-belt-for-girls-in-black-16.jpg||-||Amiana Glitter Shoes in Pewter Sequins|,|Amiana is now offering these adorable girls flats that are great for dressing up her every day look! These flats are styled like comfortable boating shoes with toe that covers the majority of the top of her foot. A touch of elastic on both sides allow her comfortable fit to stretch with ease on her every step, removing stress from the top of the toe to help avoid creases. The dark pewter glitter covers the entire shoe, adding shimmer. The black rubber outsole grips the floor as she runs and walks. |,|$56.00$|,||,|AMIANA-GLITTER-SHOES-PEWTER-SEQUINS|,|$URL$amiana-glitter-shoes-pewter-sequins.html|,|http://ep.yimg.com/ay/yhst-17102259411242/amiana-glitter-shoes-in-pewter-sequins-1.jpg||-||Amiana Glitter Shoes in Pink|,|A pop of color, these designer girls shoes come from the Euro brand, Amiana. The rich magenta shade is added with shimmering glitter that covers the entire body of the shoe. The boat shoe style is a comfortable choice for all day wear while a touch of elastic on both sides allow the shoes to move with her as she walks. A gripping rubber sole finishes this shoe perfectly! |,|$56.00$|,||,|AMIANA-GLITTER-SHOES-PINK|,|$URL$amiana-glitter-shoes-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/amiana-glitter-shoes-in-pink-1.jpg||-||Amiana Kids Pewter Boots|,|From the fabulous designer Amiana LTD, these new girls boots are a welcomed arrival for fall. These boots feature a matte metallic silver that adds a touch of shimmer without outshining her fabulous outfit. The clean style of these shoes lends to only two seams, one on the front and one that wraps around the sides. The pull on style is easy to wear and offers her handles to get the boots on with ease. Rubber side walls line the rounded toe while a rubber outer sole gives her an easy grip. |,|$69.00$|,||,|AMIANA-KIDS-PEWTER-BOOTS|,|$URL$amiana-kids-pewter-boots.html|,|http://ep.yimg.com/ay/yhst-17102259411242/amiana-kids-pewter-boots-1.jpg||-||Amiana Mirror Sneaker in Silver|,|New from designer Amiana, these fabulous girls shoes are sure to be a favorite addition to her fall closet! Whether she is going to school or out running errands with mom, these sneakers are both stylish and comfortable for all day wear. The outside of the shoe boasts of an iridescent mirror finish on the metallic silver. The toe of the shoe is a basic white while the rubber sole provides grip. The shoes are laced up with a sheer white ribbon with a shimmer sheen. |,|$62.00$|,||,|AMIANA-MIRROR-SNEAKER-SILVER|,|$URL$amiana-mirror-sneaker-silver.html|,|http://ep.yimg.com/ay/yhst-17102259411242/amiana-mirror-sneaker-in-silver-1.jpg||-||Amiana Purple Glitter Shoes|,|A brilliant new design by Amiana, these girls flats are the perfect sneakers for school and play! The rich purple glitter catches every ray of light sent its way while complimenting her outfit. The rubber side wall lining the shape of the shoe is in a matching purple. Elastic slits are found on both sides of the shoe to allow for a more comfortable fit as she moves about. These shoes are available only in limited quantities so don't miss out! |,|$56.00$|,||,|AMIANA-PURPLE-GLITTER-SHOES|,|$URL$amiana-purple-glitter-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/amiana-purple-glitter-shoes-1.jpg||-||Amiana Shoes Girls High Tops in Black|,|For your trendsetter daughter who is into fashion at a young age, the girls black high tops by Amiana Shoes will be the perfect addition to her wardrobe. The black sneakers feature an easy zipper closure that climbs up the inner side of both shoes. Four straps wrap up the front of these fun shoes and are adorned with metal buckles. These sneakers look great with skinny jeans or leggings. Dress down your favorite dress with these cute shoes for a trendy new look. |,|$59.00$|,||,|AMIANA-SHOES-GIRLS-HIGH-TOPS-BLACK|,|$URL$amiana-shoes-girls-high-tops-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/amiana-shoes-girls-high-tops-in-black-24.jpg||-||Amiana Shoes Girls Sneakers Gold High Tops|,|Catching eyes wherever she travels, these new girls sneakers by Amiana Shoes will be the talk of her friends. The gold metallic shimmers with every ray of light that bounces off the shoe while the toe and soles bring in the classic sneaker look. Four buckled straps run up the front but a zipper runs up the inner side of her shoe to make it easier to get them on and off. |,|$59.00$|,||,|AMIANA-SHOES-GIRLS-SNEAKERS-GOLD-HIGH-TOPS|,|$URL$amiana-shoes-girls-sneakers-gold-high-tops.html|,|http://ep.yimg.com/ay/yhst-17102259411242/amiana-shoes-girls-sneakers-gold-high-tops-26.jpg||-||Amiana Shoes Leopard Print Girls High Top Sneakers|,|For her wild side, these new sneakers come from designer Amiana Shoes. Perfect to shoe off this school year, the light brown sneakers are covered with leopard sposts and trimmed in black. The black strings lace up the front while a zipper is located on the inner side of both feet. Try pairing with jeans, skirts, and even dresses for a unique finishing touch. |,|$39.00$|,||,|AMIANA-SHOES-LEOPARD-PRINT-GIRLS-HIGH-TOP-SNEAKERS|,|$URL$amiana-shoes-leopard-print-girls-high-top-sneakers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/amiana-shoes-leopard-print-girls-high-top-sneakers-26.jpg||-||Amiana Shoes Little Girls Gold Ballet Flats|,|Sophisticated and glamorous, these dress flats for girls come from Amiana Shoes. The shimmering metallic gold is trimmed with black patent leather on the toe and heal. The top edge is a line of soft black velvet to match the darling bow on her toe. Pairs wonderfully with many special occasion outfits including her holiday dresses. |,|$59.00$|,||,|AMIANA-SHOES-LITTLE-GIRLS-GOLD-BALLET-FLATS|,|$URL$amiana-shoes-little-girls-gold-ballet-flats.html|,|http://ep.yimg.com/ay/yhst-17102259411242/amiana-shoes-little-girls-gold-ballet-flats-2.jpg||-||Amiana Shoes Silver High Top Sneakers for Girls|,|Running with style, these new girls high top sneakers come from Amiana Shoes. The shoes are dressed in metallic silver that shimmers in the sunlight. The classic sneaker toes mimic vintage shoes while four straps with buckles run up the shoes. The inner side of her foot is completed by a zipper to make it easier to get on and off. |,|$59.00$|,||,|AMIANA-SHOES-SILVER-HIGH-TOP-SNEAKERS-GIRLS|,|$URL$amiana-shoes-silver-high-top-sneakers-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/amiana-shoes-silver-high-top-sneakers-for-girls-32.jpg||-||Amiana Sparkle Boots in Navy|,|A brilliant look for fall and winter, these new fabulous hi top sneakers come from European brand, Amiana. The boots are trimmed with a navy suede and laced with a standard shoe string. The body of the shoe is covered in dark navy sequins that shimmer as they catch every ounce of light. The tall style of these shoes make them the perfect companion for her skinny jeans and leggings! |,|$72.00$|,||,|AMIANA-SPARKLE-BOOTS-NAVY|,|$URL$amiana-sparkle-boots-navy.html|,|http://ep.yimg.com/ay/yhst-17102259411242/amiana-sparkle-boots-in-navy-1.jpg||-||Amiana Sparkle Boots in Silver|,|From the European girls shoe designer, Amiana, these new sneaker boots are a real gem. The grey boot rises past the ankle and is laced up with a grey, rope shoe string. With trimmings of flat grey, the eye catching silver glitter pops out, dancing with the light. The bottom sole is a great rubber grip as she walks and runs about. These boots are great paired with skinny jeans or leggings! |,|$72.00$|,||,|AMIANA-SPARKLE-BOOTS-SILVER|,|$URL$amiana-sparkle-boots-silver.html|,|http://ep.yimg.com/ay/yhst-17102259411242/amiana-sparkle-boots-in-silver-1.jpg||-||Arabella Rose Oversized Flower Hair Clip for Girls|,|New from accessory designer Arabella Rose, this adorable new hair clip is sure to become a quick favorite! The large flower ebs and flows between the different rich shades of pink that grace the petals. The size of the flower adds a unique feature and it pops out in her hair. Use this girls hair accessory to accent your favorite new designer outfits that fill her closet! This hair piece also looks great in photographs! Be sure to check out all of the beautiful hair accessories to compliment all of her new tops and dresses!  |,|$16.50$|,||,|ARABELLA-ROSE-OVERSIZED-FLOWER-HAIR-CLIP-GIRLS|,|$URL$arabella-rose-oversized-flower-hair-clip-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/arabella-rose-oversized-flower-hair-clip-for-girls-1.jpg||-||Arabella Rose Secret Garden Girls Dress|,|^|Becoming one of her favorite new dresses, this elegant girls summer dress is part of the ""Secret Garden"" collection created by designer Arabella Rose. The bodice features a wide neckline and short puffy cap sleeves. A stretch of elastic is found on the hem of both sleeves as well as on the back of the neckline. The small pink magenta polka dots cover the entire bodice. The waistline is complimented with a touch of ivory lace and a green ribbon bow while the floral sash ties on the back. The feminine skirt is filled with frills! A trio of matching, wide ruffles wrap the back and both sides. The hemline brings back the pink dots while a sheer georgette fabric ruffle peaks out from underneath. This fabric is a fun pink gingham print. This dress is meant for summer adventures, weddings, and photos that you won't ever forget! Be sure to check out the matching glamorous headband! This designer girls dress is made in the USA with 100% cotton. Hand wash with care and hang to dry. ^||,|$89.00$|,||,|ARABELLA-ROSE-SECRET-GARDEN-GIRLS-DRESS|,|$URL$arabella-rose-secret-garden-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/arabella-rose-secret-garden-girls-dress-28.jpg||-||Arabella Rose Yesteryear Handmade Headband|,|Matching one of the most fabulous pieces in the spring and summer season, this new girls oversized headband comes from Arabella Rose. The large flower is filled with a rich pink town and small touches of green. It is placed upon a wide stretch headband made of darling lace that is finished with scallop edges. The bloom is accented with ribbon bows and touches of country lace. This piece looks great with most any outfit, but is specifically matched to the elegant Arabella Rose Secret Garden Girls Dress. |,|$24.00$|,||,|ARABELLA-ROSE-YESTERYEAR-HANDMADE-HEADBAND|,|$URL$arabella-rose-yesteryear-handmade-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/arabella-rose-yesteryear-handmade-headband-6.jpg||-||Ashely Anne Red and White Crinkled Velvet Holiday Clip|,|The perfect finishing touch for that special holiday outfit, this new hair clip from Ashley Anne is mad from crinkled velvet and boasts of a sparkling flower-shaped jewel center. Attached to an alligator clip for easy use. |,|$5.50$|,||,|ASHLEY-ANNE-CRINKLED-HOLIDAY-CLIP|,|$URL$ashley-anne-crinkled-holiday-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/ashely-anne-red-and-white-crinkled-velvet-holiday-clip-11.jpg||-||Ashley Anne Striped Red Flower Head Band|,|This pink, red, white, and green striped headband is decorated with a red flower on the side. Pink and red sequins make a flashy center to the flower. Adorable hair accessory! |,|$9.00$|,||,|ASHLEYANNEREDFLOWERHEADBAND|,|$URL$ashleyanneredflowerheadband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/ashley-anne-striped-red-flower-head-band-10.jpg||-||Ashley Anne Velvet Petals White Girls Hair Clip|,|In white, this smaller girls hairclip has a velvety feel. Beads and sequins at the center, about 2 inches across, by Ashley Anne. |,|$5.00$|,||,|ASHLEY-ANNE-WHITE-VELVET-PETALS|,|$URL$ashley-anne-white-velvet-petals.html|,|http://ep.yimg.com/ay/yhst-17102259411242/ashley-anne-velvet-petals-white-girls-hair-clip-7.jpg||-||Ashley Anne White Crinkle Hair Clip|,|Ashley Anne hair clip with white velvet crinkle flower. Silver gems make a flower shape to form a classy center. SOLD OUT 12/21/10 |,|$5.00$|,||,|ASHLEYANNEWHITECRINKLEHAIRCLIP|,|$URL$ashleyannewhitecrinklehairclip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/ashley-anne-white-crinkle-hair-clip-7.jpg||-||Ashley Anne White Headband Pink Flowers|,|Easy to wear white mesh headband is touched with 3 soft pink roses and a light pink tulle. |,|$10.00$|,||,|ASHLEY-ANNE-WHITE-HEADBAND-PINK-FLOWERS|,|$URL$ashley-anne-white-headband-pink-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/ashley-anne-white-headband-pink-flowers-10.jpg||-||Baby Biscotti Baby Booties in Pink|,|Fancy and elegant, these baby booties come from designer Baby Biscotti to match several of the arrivals in their fall and winter collection. A satin strap runs across the top of her foot to help secure the hold and stretches with the touch of elastic. A cute lace tulle bow is found on both toes. Light pink tulle ruffles run around the bootie for a final touch in style! 100% Cotton. Hand Wash in Warm Water. Lay Flat to Dry. |,|$18.00$|,||,|BABY-BISCOTTI-BABY-BOOTIES-PINK|,|$URL$baby-biscotti-baby-booties-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-baby-booties-in-pink-1.jpg||-||Baby Biscotti Baby Girls Wrap Set Pink Rolling Ruffles|,|^|Keeping her stylish in the fall and winter months, this long sleeve top and pant set comes from Baby Biscotti. The wrap top is covered with pink sheer ruffles. The neckline is accented quaintly and hides the secure closure. Paired with matching pants in the solid pink. The fabric is delicate on her precious skin. 100% cotton. Ruffle overlay is 100% polyester. Machine wash cold, tumble dry low. SIZE NEWBORN AND 9 MOS ONLY LEFT. ^||,|$24.00$|,||,|BABY-BISCOTTI-BABY-GIRLS-WRAP-SET-PINK-ROLLING-RUFFLES|,|$URL$baby-biscotti-baby-girls-wrap-set-pink-rolling-ruffles.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-baby-girls-wrap-set-pink-rolling-ruffles-3.jpg||-||Baby Biscotti Baby Sachet Booties|,|Keeping her feet warm and stylish, these new infant booties come from designer Baby Biscotti. The light pink cotton is shaped around each foot and is held on by a single stretch strap that ruffles across the top of both feet. A pale yellow flower created with a light, sheer fabric is found upon the toes with a decorated center. Other matching accessories include a hat and blanket, be sure to check out the Baby Biscotti brand page to see all of the possibilities! 100% cotton. Hand wash cold, line dry. |,|$13.50$|,||,|BABY-BISCOTTI-BABY-SACHET-BOOTIES|,|$URL$baby-biscotti-baby-sachet-booties.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-baby-sachet-booties-1.jpg||-||Baby Biscotti Baby Sachet Pink Infant Hat|,|^|Going with her new ""Sachet"" footed romper or fun dress, this Baby Biscotti hat is a new arrival. The pale pink cotton boasts of a folded brim with a scallop thread hem. Two flowers in yellow and pink are found off to the left side of the hat. These accents match perfectly to the other creations from the collection. The light colors are perfect for any time from spring through summer! 100% cotton. Hand wash cold, line dry. ^||,|$12.00$|,||,|BABY-BISCOTTI-BABY-SACHET-PINK-INFANT-HAT|,|$URL$baby-biscotti-baby-sachet-pink-infant-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-baby-sachet-pink-infant-hat-1.jpg||-||Baby Biscotti Cherished Heirloom White Christening Gown|,|New from designer Baby Biscotti, this graceful christening gown is one that she is sure to cherish for years and years to come. The dress features an exquisite raw silk look that is timeless in fashion. White rosettes and ruffles accent the bodice and the hemline, adding a subtle, dainty elegance! The matching bonnet finishes the look and makes her picture perfect! 100% silk, dry clean for best results. |,|$94.50$|,||,|BABY-BISCOTTI-CHERISHED-HEIRLOOM-WHITE-CHRISTENING-GOWN|,|$URL$baby-biscotti-cherished-heirloom-white-christening-gown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-cherished-heirloom-white-christening-gown-2.jpg||-||Baby Biscotti Christening Gown with Bonnet|,|Surely elegant and graceful, Baby Biscotti is now offering this fabulous christening gown for spring and summer. The empire waist is fastened on her back and accented with sheer waves and a cluster of flowers. The short puffy sleeves are sheer and reminiscent of a princess gown. Long strips of sheer fabric cascade in rich waves down the skirt, completely to the hemline. A matching bonnet comes with this gorgeous girls christening gown. 100% polyester. Delicate hand wash cold, line dry. |,|$66.75$|,||,|BABY-BISCOTTI-CHRISTENING-GOWN-BONNET|,|$URL$baby-biscotti-christening-gown-bonnet.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-christening-gown-with-bonnet-11.jpg||-||Baby Biscotti Footie in Baby Sachet Pink|,|^|A new baby romper, this designer infant outfit comes from fabulous Baby Biscotti. The long sleeve bodice features a light pink shade and quaint scallop thread edging. The front is dressed with gorgeous ruffles. The sheer tulle goes from light yellow to light pink while a few small flowers are sprinkled around. The solid cotton creates the legs of this romper down to the cute little feet. A row of snaps is found in the inseam for dressing. Be sure to look at all of the matching pieces from the ""Sachet"" collection for spring. 100% polyester. Machine wash cold, tumble dry low. ^||,|$42.00$|,||,|BABY-BISCOTTI-FOOTIE-BABY-SACHET-PINK|,|$URL$baby-biscotti-footie-baby-sachet-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-footie-in-baby-sachet-pink-1.jpg||-||Baby Biscotti Hide and Seek White Baby Blanket|,|^|Baby Biscotti is now offering this fabulous baby girls blanket as a part of their ""Hide and Seek"" collection. The cotton is soft and finished with a classic straight stitch on the hemline. A single corner of the blanket features a trio of flowers with decorated centers! Be sure to find the other matching accessories and create an ultimate baby girls gift for the next shower you attend! 100% cotton. Machine wash cold, tumble dry low. ^||,|$31.50$|,||,|BABY-BISCOTTI-HIDE-SEEK-WHITE-BABY-BLANKET|,|$URL$baby-biscotti-hide-seek-white-baby-blanket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-hide-and-seek-white-baby-blanket-8.jpg||-||Baby Biscotti Hide and Seek White Newborn Gown|,|^|Also available in pink, this new baby girls gown comes from famous designer, Baby Biscotti. The long sleeves found on the gown offer her flip paw cuffs that fold to help protect her from scratching herself. A bouquet of sweet flowers ring around the neckline in white. The wrap style of the gown is fastened with a row of snaps that fall down the front completely to the hem. The fabric is selected carefully so that it is sure not to irritate her skin and a touch of accent around the hemline adds elegance with the sheer white. Be sure to check out all of the other pieces from the ""Hide and Seek"" collection for spring and summer! Body: 100% cotton. Overlay: 100% polyester. Hand wash cold, line dry. ^||,|$43.50$|,||,|BABY-BISCOTTI-HIDE-SEEK-WHITE-NEWBORN-GOWN|,|$URL$baby-biscotti-hide-seek-white-newborn-gown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-hide-and-seek-white-newborn-gown-1.jpg||-||Baby Biscotti Infant Dress in Pink and Yellow|,|^|A sweet infant dress, this new creation comes from designer Baby Biscotti for spring or summer fun. The sleeveless dress is fastened on her back and has a shapeless A fit. The ruffles that dance across the front are layered like frosting and fall from pale yellow to a soft pink. Matching small flowers are found sprinkled about. Solid pink bloomers are worn beneath the dress. They offer her a stretch waistband with elastic while both legs are finished with a ruffle. This piece is part of the ""Sachet"" collection. Made with cotton blend. Machine wash cold, tumble dry low. ^||,|$42.00$|,||,|BABY-BISCOTTI-INFANT-DRESS-PINK-YELLOW|,|$URL$baby-biscotti-infant-dress-pink-yellow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-infant-dress-in-pink-and-yellow-1.jpg||-||Baby Biscotti Ivory Infant Top with Skirted Legging|,|^|Matching the other new arrivals designed by Baby Biscotti as a part of their ""Pom Pom Petals"" collection, this infant set is so adorable! The long sleeves on the top have puffu shoulders while tulle flowers ring around the neckline. The fabric is soft on her skin and keeps her warm and comfortable. THe matching leggings are skirted by rows of quaint ruffles. Matching pink and ivory flowers grace the skirt. Created with 100% cotton and polyester embellishments. Machine wash on cold and tumble dry on low to keep this gown looking its best. SIZE 12 MOS ONLY AVAILABLE.  ^||,|$24.00$|,||,|BABY-BISCOTTI-IVORY-INFANT-TOP-SKIRTED-LEGGING|,|$URL$baby-biscotti-ivory-infant-top-skirted-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-ivory-infant-top-with-skirted-legging-3.jpg||-||Baby Biscotti Ivory Take Home Gown|,| |,|$58.00$|,||,|BABY-BISCOTTI-IVORY-TAKE-HOME-GOWN|,|$URL$baby-biscotti-ivory-take-home-gown.html|,|||-||Baby Biscotti Little Girls Holiday Dress Silver Spoon|,|^|A shimmering delight, this new infant and toddler dress comes from Baby Biscotti's holiday collection ""Silver Spoon."" The long sleeve bodice is a soft velour complimented by the silver satin edges. Large petal flowers are found beneath the neck for a splendid garnish. The sheer silver tulle shines by catching the light. Perfect for family holiday photos or parties. Made with a polyester blend. Hand wash cold, line dry. ^||,|$29.00$|,||,|BABY-BISCOTTI-LITTLE-GIRLS-HOLIDAY-DRESS-SILVER-SPOON|,|$URL$baby-biscotti-little-girls-holiday-dress-silver-spoon.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-little-girls-holiday-dress-silver-spoon-2.jpg||-||Baby Biscotti Little Girls Ivory Christening Gown Cherished Heirloom|,|With a darling raw silk look, this new little girls gown by designer Baby Biscotti is sure to become a cherished heirloom. The gown boasts of its rosette trimmed bodice and matching pink ruffles lining the hem. The accompanied bonnet matches perfectly! 100% polyester, dry clean recommended. |,|$94.50$|,||,|BABY-BISCOTTI-GIRLS-IVORY-GOWN-CHERISHED-HEIRLOOM|,|$URL$baby-biscotti-girls-ivory-gown-cherished-heirloom.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-little-girls-ivory-christening-gown-cherished-heirloom-14.jpg||-||Baby Biscotti Macherie Amour Pink Baby Blanket|,|A perfect gift for the newborn princess in your life, this boutique baby blanket is sure to celebrate the special occasion with grace and elegance! The soft shade of pink covers this blanket, perfect for any baby girl! A small scallop accent is created on the edge of this blanket. A heart adorns a single corner, created with ruffles of tulle and touches of velvet ribbon. 100% Cotton. Machine Wash in Cold Water. Tumble Dry Low. Measures 27 inches wide and 36 inches long. |,|$42.00$|,||,|BABY-BISCOTTI-MACHERIE-AMOUR-PINK-BABY-BLANKET|,|$URL$baby-biscotti-macherie-amour-pink-baby-blanket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-macherie-amour-pink-baby-blanket-11.jpg||-||Baby Biscotti Macherie Amour Pink Infant Hat|,|In a sweet pink, this adorable baby cap from Baby Biscotti is designed to be a perfect match to the Pink Infant Ruffle Gown. The hat is made with a soft cotton fabric in the pale shade. The only adornment is a large bow found in the front created with a lacey tulle. The style of this hat is sure to stand out from the rest and look fabulous in photographs! 100% Cotton. Machine Wash in Cold Water. Lay Flat to Dry. |,|$16.00$|,||,|BABY-BISCOTTI-MACHERIE-AMOUR-PINK-INFANT-HAT|,|$URL$baby-biscotti-macherie-amour-pink-infant-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-macherie-amour-pink-infant-hat-1.jpg||-||Baby Biscotti Newborn Gown in Pink|,|^|New from designer Baby Biscotti, this baby girls gown is an elegant choice for most any occasion. The long sleeve gown features a wrap neckline accented with matching flowers. The cuffs have flip paws to help protect her from scratches. A row of small snaps un down the front, fastening it closed. The hemline is accented with sheer pale pink accents. The gown looks stunning in photographs and is sure to make a great baby shower gift! Body: 100% cotton. Overlay: 100% polyester. Hand wash cold, line dry. SIZE NEWBORN ONLY REMAINING.  ^||,|$43.50$|,||,|BABY-BISCOTTI-NEWBORN-GOWN-PINK|,|$URL$baby-biscotti-newborn-gown-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-newborn-gown-in-pink-1.jpg||-||Baby Biscotti Pink Girls Blanket|,|^|A solid new designer blanket for your new baby girl, this design comes from Baby Biscotti. The light pink cotton is found on both sides of this blanket, making it extremely comfortable on her delicate skin. The only decoration is found in a single corner. Three flowers are grouped together in a coordinating fabric and a sparkling center. This baby girls blanket matches the new outfits found in Baby Biscotti's ""Hide and Seek"" collection! 100% cotton. Machine wash cold, tumble dry low. ^||,|$31.50$|,||,|BABY-BISCOTTI-PINK-GIRLS-BLANKET|,|$URL$baby-biscotti-pink-girls-blanket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-pink-girls-blanket-1.jpg||-||Baby Biscotti Pink Blanket Baby Sachet|,|^|A perfect match to four other new arrivals, this baby girls blanket was designed by Baby Biscotti. The blanket is made completely with cotton in the pale pink that fills the ""Sachet"" collection for spring and summer. A single corner of the blanket is decorated with two light yellow and a single pink flower that are grouped together. A light pink blanket is a must have staple for all new baby girls! CachCach fills every design with both style and quality. 100% cotton. Machine wash cold, tumble dry low. ^||,|$31.50$|,||,|BABY-BISCOTTI-PINK-BLANKET-BABY-SACHET|,|$URL$baby-biscotti-pink-blanket-baby-sachet.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-pink-blanket-baby-sachet-1.jpg||-||Baby Biscotti Pink Infant Birthday Girl Dress|,|This new Baby Biscotti designer is the perfect special occasion dress for infants, sure to look lovely at birthday or wedding celebrations! The pale pink shades this entire piece while the empire bodice has a raw satin sheen. Her classic neckline is fastened close in the back and is framed by cap sleeves. A row of chiffon flowers are finished with pearl bead centers and line the waist. From the waist, the sheer fabric flows into an elegant skirt. Silk/Polyester Blend. Dry Clean Only. |,|$82.00$|,||,|BABY-BISCOTTI-PINK-INFANT-BIRTHDAY-GIRL-DRESS|,|$URL$baby-biscotti-pink-infant-birthday-girl-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-pink-infant-birthday-girl-dress-1.jpg||-||Baby Biscotti Pink Infant Outfit - Hide and Seek|,|Created by Baby Biscotti, this adorable new infant outfit is a sure hit. The fitted top is cut with a sleeveless neckline that fastens in the back. Two quaint flowers sit off to her left while small scallops of thread edge the piece. The bottom of the top is ruffled with sheer pink accents. Solid bloomer shorts are paired with the top. They have an easy pull on fit with the stretch waistband that matches the ruffled hem found on both legs. Body: 100% cotton. Overlay: 100% polyester. Hand wash cold, line dry. |,|$42.00$|,||,|BABY-BISCOTTI-PINK-INFANT-OUTFIT-HIDE-SEEK|,|$URL$baby-biscotti-pink-infant-outfit-hide-seek.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-pink-infant-outfit-hide-and-seek-1.jpg||-||Baby Biscotti Pink Infant Ruffle Gown|,|Baby Biscotti now offers this fabulous infant gown that is perfect for her take home outfit or for her photo debut! The light pink fabric is a soft cotton while the long sleeves are finished with a flip paw cuff. The flip paw cuff allows you to protect her from fingernail scratches while she sleeps. The front of the gown features glorious cascades of ruffles in various fabrics for a great textured look. A trio of buttons fasten on the back of the gown. Matching accessories are also available while supplies last. 100% Cotton. Machine Wash in Cold Water on Gentle Cycle. Line Dry. |,|$59.00$|,||,|BABY-BISCOTTI-PINK-INFANT-RUFFLE-GOWN|,|$URL$baby-biscotti-pink-infant-ruffle-gown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-pink-infant-ruffle-gown-1.jpg||-||Baby Biscotti Pom Pom Petals Girls Dress with Legging|,|^|Dress your infant in soft, sweet style with this darling girls dress designed by Baby Biscotti. The neckline is wrapped with tulle flowers while the long sleeves block chilly air. The skirt falls in a classic A line for a sophisticated look. The three small ruffles run around the hemline and is garnished in matching flowers. Cute solid leggings are paired beneath. Match with other pieces in the ""Pom Pom Petals"" collection for darling sister outfits. Created with 100% cotton. Machine wash on cold and tumble dry on low to keep this gown looking its best. (1) 18 MONTH AVAILABLE ONLY. ^||,|$24.00$|,||,|BABY-BISCOTTI-POM-POM-PETALS-GIRLS-DRESS-LEGGING|,|$URL$baby-biscotti-pom-pom-petals-girls-dress-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-pom-pom-petals-girls-dress-with-legging-3.jpg||-||Baby Biscotti Rose Crush Baby Romper|,| |,|$62.00$|,||,|BABY-BISCOTTI-ROSE-CRUSH-BABY-ROMPER|,|$URL$baby-biscotti-rose-crush-baby-romper.html|,|||-||Baby Biscotti Rose Crush Infant Hat in Ivory|,| |,|$16.00$|,||,|BABY-BISCOTTI-ROSE-CRUSH-INFANT-HAT-IVORY|,|$URL$baby-biscotti-rose-crush-infant-hat-ivory.html|,|||-||Baby Biscotti Summer Capri Set Little Sprite|,|^|Matching older styles that come from Biscotti as a part of the ""Water Sprite"" collection, this baby girls set is sure to fit in to the new life that sweeps through spring. Blue top is fastened in the back with snaps while the light blue fabric is covered with a small pink flower print. A petal flower is found off centered on the neckline while the cap sleeves feature two fun ruffles! The hemline is cut in a scallop pattern that is accented with cute ruffles and three petal flowers. Pants are paired below in the same sweet fabric. The relaxed fit opens slightly at the scallop hem of both legs. Made with cotton blend. Machine wash cold, tumble dry low. SIZE NEWBORN AND 9 MOS ONLY LEFT. ^||,|$39.00$|,||,|BABY-BISCOTTI-SUMMER-CAPRI-SET-LITTLE-SPRITE|,|$URL$baby-biscotti-summer-capri-set-little-sprite.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-summer-capri-set-little-sprite-11.jpg||-||Baby Biscotti White Bow Hat Wrapped in Ruffles|,|From designer Biscotti, this wrapped in ruffles hat in white is the perfect adornment. The soft cotton features a ruffled bow in a satin finish. Hand wash, line dry. |,|$6.00$|,||,|BABY-BISCOTTI-WHITE-BOW-HAT-WRAPPED-RUFFLES|,|$URL$baby-biscotti-white-bow-hat-wrapped-ruffles.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-white-bow-hat-wrapped-in-ruffles-21.jpg||-||Baby Biscotti White Newborn Hat|,|^|A solid white hat, this new arrival from designer Baby Biscotti comes to match the new ""Hide and Seek"" gown. The hat is made with a great cotton that is perfect for a new little princess. Two matching flowers are set off to one side. When creating the perfect baby shower gift, pair this hat with its gown to really thrill the mom-to-be! A designer gown and accessory are always a quality choice for her first day home or sweet newborn photos! 100% cotton. Delicate hand wash cold, reshape and line dry. ^||,|$12.00$|,||,|BABY-BISCOTTI-WHITE-NEWBORN-HAT|,|$URL$baby-biscotti-white-newborn-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-white-newborn-hat-1.jpg||-||Baby Biscotti White Velour Baby Blanket Winter Wonderland|,|A wonderful pair for her new Baby Biscotti Winter Wonderland dress, this baby girls blanket is one she'll love to carry wherever she goes. The soft white velour is like heaven on her delicate skin. A satin ruffle runs around the outside of the blanket. A trio of silver butterflies have made a single corner their home. Made with a cotton blend. Machine wash cold, tumble dry low. |,|$19.00$|,||,|BABY-BISCOTTI-WHITE-VELOUR-BABY-BLANKET-WINTER-WONDERLAND|,|$URL$baby-biscotti-white-velour-baby-blanket-winter-wonderland.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-white-velour-baby-blanket-winter-wonderland-2.jpg||-||Baby Biscotti Winter Wonderland Infant Dress with Legging|,|^|A velour holiday dress filled with wonder and dreams, this creation is a part of Baby Biscotti's ""Winter Wonderland"" collection. Small little dots are sprinkled on the bodice while a dainty scallop hem is found on both cuffs and the neckline. Silver fluttering butterflies rest on the bodice and on both layers of the sheer skirting that finishes with a twisting ribbon hemline. Paired with matching solid leggings worn underneath. Made with a cotton blend. Machine wash cold, tumble dry low. SIZE NEWBORN ONLY AVAILABLE.  ^||,|$29.00$|,||,|BABY-BISCOTTI-WINTER-WONDERLAND-INFANT-DRESS-LEGGING|,|$URL$baby-biscotti-winter-wonderland-infant-dress-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-winter-wonderland-infant-dress-with-legging-3.jpg||-||Baby Biscotti Wrapped in Ruffles Pink Hat|,|^|The perfect addition to all of her pink wrapped in ruffles outfits, this hat is from designer Biscotti. The soft cotton hat is adorned with a beautiful ruffled bow on the front in a satin finish. Hand wash, line dry. ONE SIZE 3/9 MONTH LEFT.  ^||,|$6.00$|,||,|BABY-BISCOTTI-WRAPPED-RUFFLES-PINK-HAT|,|$URL$baby-biscotti-wrapped-ruffles-pink-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-biscotti-wrapped-in-ruffles-pink-hat-12.jpg||-||Baby Bling White Hairclip with Rhinestone|,|The floral center of this girls hairclip is a chunky rhinestone. White bow is about 2.5 inches across. By Baby Bling. |,|$9.00$|,||,|WHITE-BABY-BLING-BOW|,|$URL$white-baby-bling-bow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-bling-white-hairclip-with-rhinestone-10.jpg||-||Baby Nay Infant Girls Dress English Garden|,|From designer Baby Nay, this new infant dress is part of their spring collection. The empire bodice has short, puffy sleeves while a large rose print covers the cotton fabric. The dress hides its onesie fit underneath the light lime skirt. The skirt is broken up into three tiers that have a full circle shape and are covered with large polka dots. Three changing snaps are found on the onesie underneath. Made with cotton blend. Machine wash cold, tumble dry low. |,|$24.00$|,||,|BABY-NAY-INFANT-GIRLS-DRESS-ENGLISH-GARDEN|,|$URL$baby-nay-infant-girls-dress-english-garden.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-nay-infant-girls-dress-english-garden-1.jpg||-||Baby Nay Newborn Take Home Gown and Hat|,|A sweet new arrival, this adorable baby girls take home gown comes from the infant designer Baby Nay. The fabric of the gown is selected to be soft and delicate on her newborn skin while the long sleeves offer protection both from a chill in the air and from scratches with the flip paw sleeves. The neckline is a classic onesie cut while the hem is finished with a small bit of elastic which gathers the fabric. A matching hat accompanies the gown and is finished with a knot tied at the top. The light pink print is a trendy bird complete with a quaint heart. Made with cotton blend. Made in USA. Machine wash cold, delicate tumble dry low. |,|$29.25$|,||,|BABY-NAY-NEWBORN-TAKE-HOME-GOWN-HAT|,|$URL$baby-nay-newborn-take-home-gown-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-nay-newborn-take-home-gown-and-hat-1.jpg||-||Baby Sara Adorable Little Girls Outfit|,|Baby Sara has designed this wonderful new outfit for little girls. The ivory top boasts of its fun sheer ruffle tiers that cover the front. Soft vintage rose pink flowers accent the sleeveless neckline. The back of the top is a solid blend fabric that allows stretch in its pull over fit. The top is paired with light rose pink shorts. The waist has a drawstring tie and a thin ribbon that wraps completely around. Whether she has casual summer or spring day plans, she will certainly enjoy this wonderful designer girls outfit. 95% cotton 5% spandex. Hand wash cold, dry flat. |,|$34.00$|,||,|BABY-SARA-ADORABLE-LITTLE-GIRLS-OUTFIT|,|$URL$baby-sara-adorable-little-girls-outfit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-adorable-little-girls-outfit-27.jpg||-||Baby Sara Animal Print Dress and Legging with Faux Fur|,|From Baby Sara's new fall 2013 collection, this designer girls dress will have her seeing spots! The ivory dress features solid long sleeves and a layered neckline. The empire waistline features a flower and bow centered on the front as a garnish. The skirt opens to an A line shape and boasts of the dual patterned hemline in two tiers. The leopard print leggings are made with a stretch fabric that allows for a comfortable fit perfect for all day wear. The faux fur mocks the look of leg warmers in a plush ivory. Made with polyester blend. Hand wash cold, flat dry. |,|$46.00$|,||,|BABY-SARA-ANIMAL-PRINT-DRESS-LEGGING-FAUX-FUR|,|$URL$baby-sara-animal-print-dress-legging-faux-fur.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-animal-print-dress-and-legging-with-faux-fur-17.jpg||-||Baby Sara Creme Ruffle Dress with Leopard Leggings PREORDER|,|^|Darling and sweet this creation comes from beloved designer Baby Sara. Baby Sara is known for their comfortable outfits and on trend styles, and this outfit is no different! The long sleeve dress is in ivory and features fabric flower appliques that frame the neckline. The sleeves are finished with slight gathering. The skirt of this dress is created with two layers in a chiffon fabric with different prints. Paired beneath are the matching leopard print leggings. The hem of the leggings is decorated with layers of alternating sheer fabrics. Please note that this item is a PreOrder and is not currently in stock. This item is expected to arrive around September 30, 2014. ^||,|$94.00$|,||,|BABY-SARA-CR-ME-RUFFLE-DRESS-LEOPARD-LEGGINGS|,|$URL$baby-sara-cr-me-ruffle-dress-leopard-leggings.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-creme-ruffle-dress-with-leopard-leggings-2.jpg||-||Baby Sara Flower Tunic with Ruffle and Pink Leggings PREORDER|,|^|A warm look that is full of style, this fabulous Baby Sara outfit is a part of their new fall and winter line. The sweater knit bodice is made with a rich brown coloring while a handmade rose applique is found next to the neckline complimented with two coordinating leaves. The long sleeves have a button cuff accent while the sweater fabric is unlined on the sleeves for an elegant touch. The layered hemline features two chiffon ruffles, one in pink and one in sweet ivory. Solid light pink leggings are paired beneath with a small touch of lace found near the hem of both legs. Please note that this item is a PreOrder and is not currently in stock. This item is expected to arrive around September 30, 2014. ^||,|$89.00$|,||,|BABY-SARA-FLOWER-TUNIC-RUFFLE-PINK-LEGGINGS|,|$URL$baby-sara-flower-tunic-ruffle-pink-leggings.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-flower-tunic-with-ruffle-and-pink-leggings-2.jpg||-||Baby Sara Girls Black Dress with Stars|,|New from Baby Sara, this fabulous girls dress is a welcome arrival for the back to school season. The black bodice features a wide neckline and long sleeves. A group of dazzling stars decorate the front created with gems, sequins, and leopard fabric. The skirt is a larger leopard print featuring a wide black hemline and black tulle overlay. This dress is fastened with a hidden zipper that runs up the back. 100% Rayon. Hand Wash in Cold Water. Lay Flat to Dry. |,|$66.00$|,||,|BABY-SARA-GIRLS-BLACK-DRESS-STARS|,|$URL$baby-sara-girls-black-dress-stars.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-girls-black-dress-with-stars-11.jpg||-||Baby Sara Girls Dress in Chiffon|,|^|From fabulous Baby Sara, this new girls dress is a gem for this coming Easter celebration! The bodice of the dress has two thin straps and five large, alternating flowers that sit upon the front of the neckline. The light weight fabric is perfect for the blouson fit that is introduced by the elastic gathered waistline. The skirt continues in the same silky chiffon fabric. The floral print is made mostly with shades of pink, inspired by the blooms of spring. If a slight chill is in the air, this dress looks fabulous with a light sweater! Polyester. Hand wash inside out, dry flat. ONE EACH SIZE 4 AND 6X.  ^||,|$49.50$|,||,|BABY-SARA-GIRLS-EASTER-DRESS-CHIFFON|,|$URL$baby-sara-girls-easter-dress-chiffon.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-girls-dress-in-chiffon-1.jpg||-||Baby Sara Girls Faux Fur Vest with Rosettes|,|A great way to complete her favorite new Baby Sara outfits, this new designer vest for little girls will not last for long! The ivory faux fur is soft to the touch while lined with a pink and black polka dot. A ruffle wraps around the neck and hemlines. Fabric rosettes add accents and color to this new piece. 100% Polyester. Spot dry clean or hand wash inside out in cold water. Hang to dry. |,|$64.00$|,||,|BABY-SARA-GIRLS-FAUX-FUR-VEST-ROSETTES|,|$URL$baby-sara-girls-faux-fur-vest-rosettes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-girls-faux-fur-vest-with-rosettes-24.jpg||-||Baby Sara Girls Faux Fur Vest with Wooden Buttons|,|^|Looking stylish with her new Baby Sara outfits, this faux fur vest is part of the ""Dancing Petals"" collection from fall and winter. The vest features a collar and a fun floral fabric in the lining. Two large wooden buttons with a lace ribbon fasten in the front. The shaggy style of the faux fur is colored with multiple natural shades and compliments the style of the brand. 100% Polyester. Hand Wash in Cold Water. Lay Flat to Dry. ^||,|$69.00$|,||,|BABY-SARA-GIRLS-FAUX-FUR-VEST-WOODEN-BUTTONS|,|$URL$baby-sara-girls-faux-fur-vest-wooden-buttons.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-girls-faux-fur-vest-with-wooden-buttons-23.jpg||-||Baby Sara Girls Lace Flower Top and Skirt|,|^|A darling creation, this new girls outfit is positively lovely! The long sleeve top is a light pink and is styled with a ""U"" shaped neckline. The front of the top is covered with a sheer ivory tulle overlay that is dressed with flowers. A grouping of sequins is found on the center of each flower. The back of the top is plain. The paired skirt has a fun tutu inspiration with the layers of ivory tulle ruffles. The metallic waistband stretches for an easy and comfortable fit! Rayon/Spandex Blend. Hand Wash in Cold Water. Lay Flat to Dry. ^||,|$104.00$|,||,|BABY-SARA-GIRLS-LACE-FLOWER-TOP-SKIRT|,|$URL$baby-sara-girls-lace-flower-top-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-girls-lace-flower-top-and-skirt-28.jpg||-||Baby Sara Girls Pink Party Dress|,|In popular pink, this new dress for little girls is a creation of Baby Sara. The empire bodice is wrapped with thin pink stripes. The straps are covered with flower appliques that fall down the sides of the bodice just past the waistline. The skirt has a small flower pattern and is broken into three tiers. The skirt boasts of a sheer overlay that is covered with fun, large polka dots. This dress is sure to make her feel carefree and fun during the spring and summer months! Hand wash cold, dry flat. |,|$48.00$|,||,|BABY-SARA-GIRLS-PINK-PARTY-DRESS|,|$URL$baby-sara-girls-pink-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-girls-pink-party-dress-17.jpg||-||Baby Sara Girls Puppy Top and Pink Skirt Set|,|A new little girls outfit from Baby Sara, this arrival is sure to be loved no matter where she is! The long sleeve top is a soft, solid white fabric. Upon the front of this shirt we find a cut puppy screen print accented with a crochet hat applique. The top is paired with a bubblegum pink tutu skirt created with layers of tulle. The metallic gold waistline is a comfortable stretch fit. Top: Cotton/Spandex Blend. Bottom: 100% Polyester. Hand Wash in Cold Water. Lay Flat to Dry. |,|$88.00$|,||,|BABY-SARA-GIRLS-PUPPY-TOP-PINK-SKIRT-SET|,|$URL$baby-sara-girls-puppy-top-pink-skirt-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-girls-puppy-top-and-pink-skirt-set-28.jpg||-||Baby Sara Girls Tunic and Legging in Rose Dot|,|Making her look even cuter than she already is, this little girls designer outfit comes from Baby Sara for fall 2013. The light rose shade of the fabric is sweet and welcoming while boasting of the dark tiny dots that spot all the way around. The long sleeves are finished with a double ruffle cuff, a classic small detail that adds volumes to the style. The empire bodice is garnished by a large flower applique with several rosettes made from different fabrics and colors. the tiers of the skirt are separated by small ruffles all the way down to the straight and timeless hemline. Beneath the hem are the solid black leggings with a matching pink floral applique placed upon her left leg. Tunic: Made with a polyester blend. Legging: Made with a rayon blend. Hand wash cold. |,|$41.00$|,||,|BABY-SARA-GIRLS-TUNIC-LEGGING-ROSE-DOT|,|$URL$baby-sara-girls-tunic-legging-rose-dot.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-girls-tunic-and-legging-in-rose-dot-2.jpg||-||Baby Sara Girls Tunic with Tulle and Matching Pants|,|Created by designer Baby Sara, this new little girls outfit is sure to be a welcome look for her back to school wardrobe. The Top features a wide neckline framed with the gold glitter short sleeves. Small flower accents are found upon the front of this grey top. The hemline is skirted with a sweet light pink tulle ruffle. Paired beneath the top we find a grey and white stripe legging completed with a ruched bottom. Cotton/Spandex/Polyester. Hand wash inside out in cold water. Hang to dry. |,|$82.00$|,||,|BABY-SARA-GIRLS-TUNIC-TULLE-MATCHING-PANTS|,|$URL$baby-sara-girls-tunic-tulle-matching-pants.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-girls-tunic-with-tulle-and-matching-pants-33.jpg||-||Baby Sara Gray Little Girls Dress with Ruched Yoke|,|^|Whether you are celebrating a holiday or just another day of the week, this new Baby Sara dress will suit her style well. The bodice is embellished by a ruched yoke neckline and soft gathers that fall from neck to empire waistline. A large multi flower applique sits off centered on the front. The skirt has a trendy sharkbite hem which is characterized by a longer length on both sides. The entire piece is overlayed by a sheer grey fabric covered with a quaint dot print. Polyester and spandex blend, allows stretch. Hand wash in cold water and lay flat to dry. SIZE 5 AVAILABLE  ^||,|$26.00$|,||,|BABY-SARA-GRAY-LITTLE-GIRLS-DRESS-RUCHED-YOKE|,|$URL$baby-sara-gray-little-girls-dress-ruched-yoke.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-gray-little-girls-dress-with-ruched-yoke-2.jpg||-||Baby Sara Green Stripe Dress with Lace Trim|,||,|$43.00$|,||,|BABY-SARA-GREEN-STRIPE-DRESS-LACE-TRIM|,|$URL$baby-sara-green-stripe-dress-lace-trim.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-green-stripe-dress-with-lace-trim-1.jpg||-||Baby Sara Infant and Toddler Dress in Chevron|,|A wacky design filled with summer, this designer girls dress is designed by Baby Sara. The bodice offers two fabric flowers that rest upon both shoulder straps. The scoop neckline is edged with a thin lined pink fabric. The back of the bodice has a racer back fit. The skirt continues in the unique chevron print that is filled with hullabaloo. The tiers are divided with smocked ruffles. The fabric is light weight for the heat of the sun. 100% polyester. Hand wash cold, lay flat to dry. |,|$36.75$|,||,|BABY-SARA-INFANT-TODDLER-DRESS-CHEVRON|,|$URL$baby-sara-infant-toddler-dress-chevron.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-infant-and-toddler-dress-in-chevron-1.jpg||-||Baby Sara Little Girls Capri Outfit|,|By fabulous Baby Sara, this new designer girls outfit is positively darling! The top features a strappy scoop neckline. The back of the top has small cutout found in the center. Fabric layers in cute ruffles. The sheer ivory into grey polka dots, leading to the black sequin mesh all bring in a different texture. The top is lined for her comfort. Solid capris are paired beneath in midnight black. The stretch fit is comfortable for all day wear. Cotton/poly blend. Hand wash inside out, dry flat. |,|$51.00$|,||,|BABY-SARA-LITTLE-GIRLS-CAPRI-OUTFIT|,|$URL$baby-sara-little-girls-capri-outfit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-little-girls-capri-outfit-1.jpg||-||Baby Sara Little Girls Dress in Leopard|,|For the fashionista with a wild style, this new little girls dress is sure to spark her imagination. The bodice has a soft ribbed knit texture and is covered with the dark leopard spots. Short sleeves frame the wide neckline while a lacey bow becomes the bed for a wrapped rosette. The dress has a pull over fit which is assisted by the slight stretch found in the fabric. The skirt is right from a princess dream. The upper half is a sheer light pink with polka dots while a rose ruffle defines the end of one color into the next. The dark magenta pink has a crinkle texture but boasts of the same polka dots shining through. She will want to wear this dress for photos, birthdays, and every day fun! Hand wash cold, dry flat. |,|$49.00$|,||,|BABY-SARA-LITTLE-GIRLS-DRESS-LEOPARD|,|$URL$baby-sara-little-girls-dress-leopard.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-little-girls-dress-in-leopard-17.jpg||-||Baby Sara Little Girls Gray Jacket with Gold Sequins|,|A fun new design, this blazer was created by the Sara Sara sister brand, Baby Sara. The grey jacket has long sleeves to add warmth to her outfit. The fabric is colored in a light grey while the front is an open style, free from buttons or zippers. Shimmering sequins line the piece and add a dazzling touch upon a bed of tulle ruffles. This blazer matches perfectly to the Girls Tunic with Tulle and Matching Pants. Cotton/Polyester. Hand wash inside out in cold water. Hang to dry. |,|$58.00$|,||,|BABY-SARA-LITTLE-GIRLS-GRAY-JACKET-GOLD-SEQUINS|,|$URL$baby-sara-little-girls-gray-jacket-gold-sequins.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-little-girls-gray-jacket-with-gold-sequins-19.jpg||-||Baby Sara Little Girls Ruffled Dress|,|From Baby Sara, this girls dress will be one that she wears all the time. The light bodice is covered with a thin grey stripe while a cute lace applique is adorned by small roses and accents the shape of the neckline. Two pink straps that run across her back are styled to mimic darling bows. The skirt is layered with a soft floral pattern and a pink mesh overlay. The layers of ruffles continue from her uneven waist down to the straight hemline. Made with a polyester blend. Hand wash cold, lay flat to dry. |,|$46.50$|,||,|BABY-SARA-LITTLE-GIRLS-RUFFLED-DRESS|,|$URL$baby-sara-little-girls-ruffled-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-little-girls-ruffled-dress-1.jpg||-||Baby Sara Little Girls Sequin Heart Tunic with Pants|,|This new designer girls outfit comes from the Baby Sara brand and is sure to be loved at first sight! The long sleeve top is a stylish casual, perfect for days back at school! The soft fabric is finished with a shark bite hemline. A large heart accent is placed front and center, color blocked in shimmering sequins. The top is accompanied by black leggings with a gold snake skin accent that runs down both sides and covers the knees. Polyester/Spandex. Hand wash inside out in cold water. Hang to dry. |,|$74.00$|,||,|BABY-SARA-LITTLE-GIRLS-SEQUIN-HEART-TUNIC-PANTS|,|$URL$baby-sara-little-girls-sequin-heart-tunic-pants.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-little-girls-sequin-heart-tunic-with-pants-28.jpg||-||Baby Sara Pink and Gray Striped Tunic with Pants|,|New from Baby Sara, this little girls outfit is both comfortable and stylish. The long sleeve tunic is covered with thin grey and light pink stripes. Three wrap rosettes with beaded centers are placed upon the long sleeve bodice. The fit opens from the empire waistline while two tiers are defined by the quaint ruffles. A comfortable pair of leggings accompanies the top to be worn beneath. Matching fabric flowers are found on both legs. Cotton/Spandex Blend. Hand Wash in Cold Water. Lay Flat to Dry. |,|$82.00$|,||,|BABY-SARA-PINK-GRAY-STRIPED-TUNIC-PANTS|,|$URL$baby-sara-pink-gray-striped-tunic-pants.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-pink-and-gray-striped-tunic-with-pants-6.jpg||-||Baby Sara Pink Dress with Dotted Sequins PREORDER|,|^|Absolutely gorgeous! This new designer dress for girls comes from Baby Sara as a part of their ""Twinkle Toes"" collection for the fall and winter season. Whether she is at a wedding, birthday, or holiday celebration, this special occasion dress is sure to fit the event! The sleeveless bodice features a racerback with a single button keyhole while the neckline is trimmed with satin. The peachy pink bodice is covered with a tulle overlay on the front dressed with roses and sparkling sequins. The waistline is decorated with a large bow while the darker cocoa pink is layered in polka dot tulle ruffles. This dress looks fabulous in person and in photographs! Please note that this item is a PreOrder and is not currently in stock. This item is expected to arrive around September 30, 2014. ^||,|$78.00$|,||,|BABY-SARA-PINK-DRESS-DOTTED-SEQUINS|,|$URL$baby-sara-pink-dress-dotted-sequins.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-pink-dress-with-dotted-sequins-17.jpg||-||Baby Sara Pink Faux Fur Coat for Girls|,|Created by Baby Sara, this little girls winter coat is beautiful in pink! The coat is covered in a soft faux fur that is textured with sweet roses. The front of the coat is fastened with a row of large, hidden snaps from the hem to the collar. The coat is lined for both warmth and comfort! Faux Fur/Polyester. Spot dry clean or hand wash inside out in cold water. Hang to dry. |,|$88.00$|,||,|BABY-SARA-PINK-FAUX-FUR-COAT-GIRLS|,|$URL$baby-sara-pink-faux-fur-coat-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-pink-faux-fur-coat-for-girls-18.jpg||-||Baby Sara Pink Tank and Flower Skirt Set for Girls|,|Baby Sara is now offering this pretty pink girls outfit as a part of their fall and winter collection. The pink tank top is cut for a more fitted look and features a classic neckline. The solid top is free from adornments to better compliment the fabulous skirt it is paired with. The skirt features a metallic stretch waistline with an easy pull on fit. The tulle overlay is decorated with sequin centered flowers and a double ruffle hem. The pink lining is seen through this sheer fabric. Rayon/Spandex. Hand wash inside out in cold water. Hang to dry. |,|$74.00$|,||,|BABY-SARA-PINK-TANK-FLOWER-SKIRT-SET-GIRLS|,|$URL$baby-sara-pink-tank-flower-skirt-set-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-pink-tank-and-flower-skirt-set-for-girls-7.jpg||-||Baby Sara Polka Dot Pink and Black Tunic and Pant|,|An adorable look for back to school, this new girls boutique outfit was designed by Baby Sara. The tunic top is striped in black and white and offers long sleeves for the cooler air of the fall and winter seasons. Two flowers decorate the neckline. A black polka dot skirt creates the hem of this top. The paired pant is a solid black fabric that allows stretch and has an elastic waistband. The hem of these pants are a sweet triple ruffle. Cotton/Spandex/Polyester. Hand wash inside out in cold water. Hand to dry. |,|$86.00$|,||,|BABY-SARA-POLKA-DOT-PINK-BLACK-TUNIC-PANT|,|$URL$baby-sara-polka-dot-pink-black-tunic-pant.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-polka-dot-pink-and-black-tunic-and-pant-29.jpg||-||Baby Sara Silver Icing Dress for Little Girls|,|A dreamy new creation from the Baby Sara line by Sara Sara. The grey bodice features a sleevless neckling enhanced by a white tulle overlay dressed with sequins. The grey waist is garnished by sparkling gems in the center. The oh so gorgeous skirt is created by two tiers of sheery white tulle covered with a shimmering swiss dot print. Both tiers of the skirt are full circle in shape so the extra fabric dances with a free spirit as she moves. The lining of the skirt is a white blended fabric. Whether you pair it with a bolero cardigan or feminine tights and patent leather flats, this dress is sure to shine during the holiday season. Cotton and polyester blend. Hand wash in cold water and lay flat to dry. |,|$37.00$|,||,|BABY-SARA-SILVER-ICING-DRESS-LITTLE-GIRLS|,|$URL$baby-sara-silver-icing-dress-little-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-silver-icing-dress-for-little-girls-13.jpg||-||Baby Sara Sweater Knit Tunic with Pink Legging|,|With a multi patterned look, this little girls tunic from Baby Sara is part of their fall 2013 line. The long sleeve tunic features a slightly wider neckline and a loose fit. The colorful prints are made with a soft sweater knit that is delicate and comfortable on her skin. Two scoop pockets on the front are a bright light blue that pops out and is a great accent. The accompanying leggings are a bright rose pink that allows stretch in the fit. The bottom of both legs boast of a ruched or gathered look. Top: 100% cotton. Leggings: Made with cotton blend. Hand wash cold, flat dry. |,|$33.00$|,||,|BABY-SARA-SWEATER-KNIT-TUNIC-PINK-LEGGING|,|$URL$baby-sara-sweater-knit-tunic-pink-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/baby-sara-sweater-knit-tunic-with-pink-legging-2.jpg||-||Babys in Bloom Baby Girls Romper Dress in Pink Ruffles|,|A sweet baby romper from designer Babys in Bloom, this wonderful new arrival looks fabulous at weddings or in photographs! The ivory romper is dressed with scallop lace ruffles. The empire bodice offers two quaint fabric flowers with a single rhinestone decoration. The top hem is an elastic stretch for a strapless look to the straight neckline while the straps boast of the elegant ruffles in pink tulle and ivory lace. The same soft pink tulle creates a skirt overlay tiered in ruffles. This piece is timeless! Made with blended fabrics. Hand wash with care and hang to dry. |,|$58.00$|,||,|BABYS-IN-BLOOM-BABY-GIRLS-ROMPER-DRESS-PINK-RUFFLES|,|$URL$babys-in-bloom-baby-girls-romper-dress-pink-ruffles.html|,|http://ep.yimg.com/ay/yhst-17102259411242/babys-in-bloom-baby-girls-romper-dress-in-pink-ruffles-18.jpg||-||Babys in Bloom Infant Romper Dress in Ivory and Pink|,|Exquisite and beautiful, this new baby girls romper comes from the charming designer Babys in Bloom. The romper boasts of its vintage inspiration found in the ivory lace ruffles that fall from the neck down to the hem finished with a scallop edge. The empire bodice is dressed with tulle and iridescent sequins along with a trio of pink blooms. The elastic top hem is finished with a straight neck while the ruffled lace shoulder straps allow stretch. Both legs are finished with matching accents to tie in the bodice. A dusty rose pink lace creates a skirt overlay. Made with soft blends, hand wash with care and hang to dry. |,|$58.00$|,||,|BABYS-IN-BLOOM-INFANT-ROMPER-DRESS-IVORY-PINK|,|$URL$babys-in-bloom-infant-romper-dress-ivory-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/babys-in-bloom-infant-romper-dress-in-ivory-and-pink-1.jpg||-||Babys in Bloom Pink Ruffles Little Girls Dress|,|^|Matching perfectly to her younger sisters romper dress, this new girls birthday dress also comes from Babys in Bloom. The empire bodice is a smocked, stretch fit. Ruffled accents with iridescent sequins and fabric flowers add to the charming style. The shoulder straps are dressed with tulle ruffles. The skirt is tiered with soft peachy pink tulle ruffles. A ivory lining is found beneath the sheer tulle. Made with blended fabrics. Hand wash this dress with care and hang to dry. THIS DRESS RUNS SMALL, PLEASE ORDER A SIZE UP. ^||,|$49.00$|,||,|BABYS-IN-BLOOM-PINK-RUFFLES-LITTLE-GIRLS-DRESS|,|$URL$babys-in-bloom-pink-ruffles-little-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/babys-in-bloom-pink-ruffles-little-girls-dress-18.jpg||-||Bari Lynn Fuchsia Satin Bow Clip|,|^|A pop of color for any hairdo, this new Bari Lynn bow clip is made from a bright fuchsia pink satin. The bow sits upon a bend-to-snap clip and is adorned by two rows of pink crystals in the center. The perfect finishing piece! Roughly 3"" long. ^||,|$13.00$|,||,|BARI-LYNN-FUCHSIA-BOW-CLIP|,|$URL$bari-lynn-fuchsia-bow-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bari-lynn-fuchsia-satin-bow-clip-12.jpg||-||Bari Lynn Red Crystalized Flower Clip|,|^|Sitting upon a wrapped alligator clip, this new hair accessory from designer Bari Lynn is an adorable finishing touch. The red petal rosette features several jeweled petals while the clip itself also boasts of red gems. The flower is 1.5"" across and the clip measures 2"" in length. ^||,|$14.00$|,||,|BARI-LYNN-RED-CRYSTALIZED-CLIP|,|$URL$bari-lynn-red-crystalized-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bari-lynn-red-crystalized-flower-clip-12.jpg||-||Bari Lynn Red Feel Good Flower Clip|,|^|Such a lovely piece to top off any style outfit, Bari Lynn now offers this red rosette flower clip. The petal rosette is adorned by light red crystals and sits upon a bend-to-snap clip covered with black felt and satin. The rosette roughly measures 2.5"" across. ^||,|$12.50$|,||,|BARI-LYNN-RED-FEEL-GOOD-FLOWER-CLIP|,|$URL$bari-lynn-red-feel-good-flower-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bari-lynn-red-feel-good-flower-clip-12.jpg||-||Bari Lynn Red Satin Bow Clip|,|^|You can never go wrong with a red satin bow adorning her beautiful hair. Bari Lynn is now offering this 3"" long satin bow adorned with two rows of red crystals in the center. Sits upon a bend-to-snap clip covered with black felt and satin for easy use and a firm hold. ^||,|$13.00$|,||,|BARI-LYNN-RED-SATIN-BOW-CLIP|,|$URL$bari-lynn-red-satin-bow-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bari-lynn-red-satin-bow-clip-9.jpg||-||Bari Lynn Red Thin Party Headband with Bow|,|Wrapped with a classic red satin ribbon, this thin, hard headband will dress her head in elegant beauty. The headband boast simply of its structured, matching bow adorned with red crystals in the center. |,|$19.00$|,||,|BARI-LYNN-RED-THIN-PARTY-HEADBAND-BOW|,|$URL$bari-lynn-red-thin-party-headband-bow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bari-lynn-red-thin-party-headband-with-bow-13.jpg||-||Bari Lynn Two Tone Berry Flower Clip with Crystals|,|^|A vibrant mix of colors perfect for her summer outfits, this new Bari Lynn flower hair clip is an adorable accessory. The layered flower boasts of its berry pink and red colors, sparkling tulle additions, and cute crystals shimmering. The flower measures roughly 2.5"" across and is set upon a snap clip that slides into her hair easily and offers a great grip. ^||,|$15.00$|,||,|BARI-LYNN-BERRY-TWO-TONE-FLOWER-CLIP|,|$URL$bari-lynn-berry-two-tone-flower-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bari-lynn-two-tone-berry-flower-clip-with-crystals-13.jpg||-||Bari Lynn White Diaper Cover with Pink Ruffled Seat|,|^|Bari Lynn is now offering this fun white diaper cover sure to add a new level of cute to any wardrobe. The cover features an elastic fit waist and pink tulle ruffles covering the backside. Small white crystals are found throughout the tulle for a quaint touch of shimmer. Perfect for her infant pictures! SIZE 6-18 MOS ONLY AVAILABLE. ^||,|$19.00$|,||,|BARI-LYNN-WHITE-PINK-DIAPER-COVER|,|$URL$bari-lynn-white-pink-diaper-cover.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bari-lynn-white-diaper-cover-with-pink-ruffled-seat-13.jpg||-||Bari Lynn White Holiday Bow Hair Clip|,|From designer Bari Lynn, this new white satin bow clip is perfect for the upcoming holiday season. The structured bow catches the light beautifully as the center shines with its clear crystals. The pinch clip is easy to open and wrapped with ribbon. |,|$13.00$|,||,|BARI-LYNN-WHITE-HOLIDAY-BOW-HAIR-CLIP|,|$URL$bari-lynn-white-holiday-bow-hair-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bari-lynn-white-holiday-bow-hair-clip-13.jpg||-||Bebemonde Baby Girls White Socks with Ruffle|,|Sweet and adorable, these newborn socks from designer Bebemonde will beautifully adorn her tiny feet. The white cotton knit is classically comfortable while the roll down top of the sock is garnished by a mesh ruffle covered with sheer waves to add texture. Pair with your white newborn gowns for a finished look and added warmth! |,|$12.00$|,||,|BEBEMONDE-BABY-GIRLS-WHITE-SOCKS-RUFFLE|,|$URL$bebemonde-baby-girls-white-socks-ruffle.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bebemonde-baby-girls-white-socks-with-ruffle-3.jpg||-||Bebemonde Girls White Christening Gown and Headband|,|The rosette details will not go unnoticed. A sweet Christening gown for her special day, short puff sleeves with 3 tulle rosettes adorn the bodice. The tulle overlay fabric features tiny rosette detailing. Rear button closure with poly-cotton lining. The matching cotton knit headband is accented with a fabric bow and tulle rosette center. Hand or machine wash cold, line dry. Made in the USA. Please note the tag indicates size 3 Month, but fits like a 0-3 Month. |,|$89.00$|,||,|BEBEMONDE-GIRLS-WHITE-CHRISTENING-GOWN-HEADBAND|,|$URL$bebemonde-girls-white-christening-gown-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bebemonde-girls-white-christening-gown-and-headband-1.jpg||-||Bebemonde Infant Pink Fancy Gown with Headband|,|She will be ready for any photo op wearing this beautiful pink fancy gown from Bebemonde. Row after row of tiny tulle ruffles make this a one of a kind look. Tulle overlay short puff sleeves with rosette detailing form the bodice of the gown. Cotton-poly lining for comfort. A coordinating pink knit headband with tulle and a rosete finish the look. Hand or machine wash. Line dry. Made in the USA. Please note the tag indicates size 3 Month, but fits like a 0-3 Month. |,|$89.00$|,||,|BEBEMONDE-INFANT-PINK-FANCY-GOWN-HEADBAND|,|$URL$bebemonde-infant-pink-fancy-gown-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bebemonde-infant-pink-fancy-gown-with-headband-1.jpg||-||Bebemonde Pink Rose Garden Baby Blanket|,|She will look so sweet wrapped in this silky soft blanket from Bebemonde. The soft knit cotton has a pink tulle and rosette edging while the flip side is covered in pink satin. Adorned with a glimmering tulle rosette. 100% cotton. Made to match the Bebemonde Pink Rose Garden Newborn Take Home Gown. Machine washable, lay flat to dry. Made in the USA. |,|$39.00$|,||,|BEBEMONDE-PINK-ROSE-GARDEN-BABY-BLANKET|,|$URL$bebemonde-pink-rose-garden-baby-blanket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bebemonde-pink-rose-garden-baby-blanket-24.jpg||-||Bebemonde Pink Rose Garden Baby Socks|,|^|These new pink baby socks from Bebemonde are just what she needs to keep her toes warm. Adorned with a tulle and rosette ruffle and glimmering flower. Fits most newborns. These darling socks match the Bebemonde Pink Rose Garden Newborn Take Home Gown. 100% cotton. Machine washable, lay flat to dry. Made in the USA. 3 MOS ONLY LEFT.  ^||,|$12.00$|,||,|BEBEMONDE-PINK-ROSE-GARDEN-BABY-SOCKS|,|$URL$bebemonde-pink-rose-garden-baby-socks.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bebemonde-pink-rose-garden-baby-socks-13.jpg||-||Bebemonde Satin Pink Rosettes Infant Socks|,|^|Sized to fit newborns, these cute pink cotton socks have satiny ruffles with rosettes. By Bebemonde, these match the Bebemonde pink satin gown listed below. Machine wash. NEWBORN ONLY REMAINING.  ^||,|$11.00$|,||,|BEBEMONDE-PINK-SATIN-INFANT-SOCKS|,|$URL$bebemonde-pink-satin-infant-socks.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bebemonde-satin-pink-rosettes-infant-socks-7.jpg||-||Bebemonde White Baby Girls Gown with Headband|,|This darling white gown comes from designer Bebemonde. The cotton bodice is adorned with a lace and tulle flower that matches the headband bow while the gown is covered in tulle and soft white rosettes. Complete with elastic hemline and cuffed, long sleeves. Made with 100% cotton. Machine washable, hang to dry. Made in the USA. |,|$56.00$|,||,|BEBEMONDE-WHITE-BABY-GOWN|,|$URL$bebemonde-white-baby-gown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bebemonde-white-baby-girls-gown-with-headband-15.jpg||-||Bebemonde White Baby Specialty Blanket|,|^|This beautiful white blanket by Bebemonde makes a perfect gift. Soft terry is surrounded with a wide border of white tulle and rosettes with a single lace and tulle rosette accent in the corner. The reverse side has a satin center lining. 100% cotton. Machine washable, lay flat to dry. Made in the USA. (1) REMAINING.  ^||,|$39.00$|,||,|BEBEMONDE-WHITE-BABY-BLANKET|,|$URL$bebemonde-white-baby-blanket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bebemonde-white-baby-specialty-blanket-10.jpg||-||Bella Reese Fuchsia Braided Halo Headband|,|A bold pop of color to accessorize her hair, this fabulous designer headband comes from Bella Reese. The rich fabric is a fun fuchsia pink textured with its braided wrap and the raw edges. Created to be worn as a halo style, off to one side is a cute touch created with a knot. The back of the headband is a thin elastic band that stretches for a perfect fit. The front of the piece dazzles with its shimmering rhinestone adornment that is placed in a single row. |,|$32.00$|,||,|BELLA-REESE-FUCHSIA-BRAIDED-HALO-HEADBAND|,|$URL$bella-reese-fuchsia-braided-halo-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bella-reese-fuchsia-braided-halo-headband-1.jpg||-||Bella Reese Girls Braided Headband in Pink|,|A beautiful new accessory, this girls hair piece is new from designer Bella Reese. The light mauve pink is an endearing shade which compliments the braided texture. Off to the side is a cute knot with raw edge tails. The front of the braid is dressed with a row of sparkling rhinestone flowers. This halo stretches to fit her head with a thin elastic band that is found at the back. This hair accessory is available in other colors while supplies last, so take a peek at our Hair Bows page! |,|$32.00$|,||,|BELLA-REESE-GIRLS-BRAIDED-HEADBAND-PINK|,|$URL$bella-reese-girls-braided-headband-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bella-reese-girls-braided-headband-in-pink-1.jpg||-||Bella Reese Girls Flower Headpiece in Ivory|,|Gracing her head in style, this new girls headpiece comes from Bella Reese Bowtique. The thin metallic silver ribbons tie for a unique fit. A large ivory flower is attached and accented with a large jewel center. Two small ivory flowers sit to one side with quaint pearl centers. |,|$29.00$|,||,|BELLA-REESE-GIRLS-FLOWER-HEADPIECE-IVORY|,|$URL$bella-reese-girls-flower-headpiece-ivory.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bella-reese-girls-flower-headpiece-in-ivory-1.jpg||-||Bella Reese Headband for Girls with Pink Flowers|,|So sweet in style, this new Bella Reese headband is gorgeous accessory for her favorite everyday outfits or flower girl dresses! The light pink ribbon is finished with quaint pom pom accents in the same light pink shade. The headband ties at the back of her head with a custom fit. The two pink flowers sit off to one side of her head and boast of their complimenting shades of pink. The center of both flowers will sparkle as it catches any light. Just beneath the flower we find elegant accents with the pink French netting and the wispy boa feathers. |,|$26.00$|,||,|BELLA-REESE-HEADBAND-GIRLS-PINK-FLOWERS|,|$URL$bella-reese-headband-girls-pink-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bella-reese-headband-for-girls-with-pink-flowers-1.jpg||-||Bella Reese Ivory Girls Headband with Flowers|,|Gorgeous and elegant, this new girls hair accessory from Bella Reese is perfect for the flower girl or with her every day outfits. The headband is a delicate strand with small pom pom accents. The ribbon is tied at the back of her head for a personalized fit. Off to one side of her head a duo of sweet ivory flowers sit. Both flowers are finished with sparkling rhinestone accents while sparkling tulle is layered for a subtle addition to the style. |,|$26.00$|,||,|BELLA-REESE-IVORY-GIRLS-HEADBAND-FLOWERS|,|$URL$bella-reese-ivory-girls-headband-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bella-reese-ivory-girls-headband-with-flowers-1.jpg||-||Bella Reese Ivory Rhinestone Girls Headband|,|From Bella Reese, this new girls hair accessory is filled with charming elegance. The ivory fabric is braided and styled with raw edges. The halo headband stretches to fit around her head with the thin elastic band that is found at the back. Off to one side is a knotted accent while the front is dressed with shimmering rhinestones in a floral pattern. This piece is a perfect wedding hair accessory for the flower girl! |,|$32.00$|,||,|BELLA-REESE-IVORY-RHINESTONE-GIRLS-HEADBAND|,|$URL$bella-reese-ivory-rhinestone-girls-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bella-reese-ivory-rhinestone-girls-headband-1.jpg||-||Bella Reese Ivory Wrapped Headband with Blue Flower|,|A sweet accessory from Bella Reese, this piece adds the perfect amount of sugar to any outfit! The hard headband is covered with an ivory ribbon. A large blue tulle flower is layered with lace and boasts of a brilliant ivory satin rose that sits off to one side. A sparkling gem center adds a touch of shimmer to finish off the look. |,|$32.00$|,||,|BELLA-REESE-IVORY-WRAPPED-HEADBAND-BLUE-FLOWER|,|$URL$bella-reese-ivory-wrapped-headband-blue-flower.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bella-reese-ivory-wrapped-headband-with-blue-flower-1.jpg||-||Bella Reese Princess Pink Girls Headpiece|,|Bella Reese is now offering this fabulous take on a popular new trend in hair accessories. This halo headpiece boasts of a sparkling jewel front with shimmering pink gems found framed by smaller clear gems. Bright candy pink velvet ribbon coordinates beautifully and ties for a great fit! |,|$32.00$|,||,|BELLA-REESE-PRINCESS-PINK-GIRLS-HEADPIECE|,|$URL$bella-reese-princess-pink-girls-headpiece.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bella-reese-princess-pink-girls-headpiece-1.jpg||-||Bella Reese Silver Girls Headband Braided|,|A charming new piece from designer Bella Reese, this halo headband is sure to be loved. The braid is textured with raw edges while colored in a cool silver. Off to one side a knot is finished with tails that boast of their raw edges. A row of pearl and rhinestone flowers add sparkle to the front of the piece. The halo headbands are traditionally styled to be worn on the forehead. This particular style is available in other colors while supplies last, see the Hair Bows page for a full selection! |,|$32.00$|,||,|BELLA-REESE-SILVER-GIRLS-HEADBAND-BRAIDED|,|$URL$bella-reese-silver-girls-headband-braided.html|,|http://ep.yimg.com/ay/yhst-17102259411242/bella-reese-silver-girls-headband-braided-1.jpg||-||Biscotti Back to School Outfit with Flowers|,|^|New from designer Biscotti, this adorable girls outfit is a part of their ""School of Rock"" collection. The dress features an empire bodice in solid black with a row of buttons to run up the back and fasten closed. A color block look is introduced on the skirt as we see white, grey and red. Large flower cut out appliques are found sitting upon the bodice and sleeve. Paired beneath this dress we find a solid black pair of leggings with smaller versions of the flowers gracing both legs. Polyester/Rayon/Spandex Blend. Hand Wash in Cold Water. Hang to Dry. ^||,|$78.00$|,||,|BISCOTTI-BACK-TO-SCHOOL-OUTFIT-FLOWERS|,|$URL$biscotti-back-to-school-outfit-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-back-to-school-outfit-with-flowers-preorder-6.jpg||-||Biscotti Black and Ivory Toddler Dress|,|^|A unique design that she will certainly adore, this fabulous little girls dress comes from the beloved brand, Biscotti. The dress makes full use of the color blocking trend to bring back the mod prints with their alternating shapes. Three circles are found on the front, gradually gaining in size. The long sleeves are opposite colors while a hidden zipper runs up the back. This dress matches perfectly to an older style that is available for her sister while quantities last, ""Biscotti Long Sleeve Black Dress for Girls."" Polyester/Rayon/Spandex Blend. Dry Clean Recommended. ^||,|$66.00$|,||,|BISCOTTI-BLACK-IVORY-TODDLER-DRESS|,|$URL$biscotti-black-ivory-toddler-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-black-and-ivory-toddler-dress-preorder-6.jpg||-||Biscotti Coral Lace Dress for Girls |,|^|A delicate and dainty design, this tween dress is part of Biscotti's ""Meadow Roses"" collection. The strappy dress offers her a hidden zipper in the back and a sleeveless neckline. The dress is covered with layers of sweeping coral lace. The floral pattern is perfect for spring time while the tiers are defined by the scallop hems. This gorgeous lace is completely unique and sure to capture her love instantly! Wear this dress for Easter, birthdays, or almost any special occasion! 100% polyester. Machine wash cold, line dry. ^||,|$59.00$|,||,|BISCOTTI-CORAL-LACE-DRESS-TWEENS|,|$URL$biscotti-coral-lace-dress-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-coral-lace-dress-for-tweens-17.jpg||-||Biscotti Couture Dress for Tweens Silver Flapper PREORDER|,|^|Available only in tween sizes, this party dress from Biscotti is sure to be the start of the night. The dress has a shapeless fit, comfortable and relaxed. The straight neckline and straps are framed by silver sequins. The fun skirt is perfect for twirling as ribbons of tulle and sequins fall from neck to hemline. This dress matches several other new arrivals for the season, making it easy to matcher her sister! Please note that this is a PreOrder item and it is NOT currently in stock. This Biscotti item is expected to be in stock between August 4, 2014 and August 31, 2014. For further information on PreOrders, please visit the PreOrder tab on the top navigation menu. ^||,|$98.00$|,||,|BISCOTTI-COUTURE-DRESS-TWEENS-SILVER-FLAPPER|,|$URL$biscotti-couture-dress-tweens-silver-flapper.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-couture-dress-for-tweens-silver-flapper-preorder-1.jpg||-||Biscotti Dress Navy and White Long Sleeve|,|With sailor stripes, this new designer little girls dress was created by Biscotti as a part of their spring and summer line. The bodice offers an empire waist and thin navy stripes that run horizontally. The waist is adorned by three quaint bows and a hidden zipper fastens in the back. The skirt opens in fit and boasts of bold stripes to the straight hem. zz08 |,|$49.50$|,||,|BISCOTTI-DRESS-NAVY-WHITE-LONG-SLEEVE|,|$URL$biscotti-dress-navy-white-long-sleeve.html|,|||-||Biscotti Dresses for Girls Bella Butterfly|,|^|A pastel dream, this new Biscotti Girls dress is just in time for all of her spring time occasions. The sleeveless bodice has a wide neckline and an empire waist. The layered skirt is created with light colors of soft tulle that dangle down to an uneven hem of each tier. The butterflies that cover the bodice match the few that are found on the skirt. This dress is the pair of the new infant and toddler dress that will make a darling sister look for photographs. 100% polyester. Delicate hand wash cold, line dry. SIZE 6 ONLY AVAILABLE. ^||,|$58.50$|,||,|BISCOTTI-DRESSES-GIRLS-BELLA-BUTTERFLY|,|$URL$biscotti-dresses-girls-bella-butterfly.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-dresses-for-girls-bella-butterfly-1.jpg||-||Biscotti Easter Basket Girls Dress|,|^|Matching to a younger version, this girls dress from Biscotti was created for the light new life of spring. The dress features wide shoulder straps and a thin bow that ties on the back. A hidden zipper secures the fit while a garden of tulle rosettes cover the front of the empire waist bodice. The long skirt moves with her every step. This graceful effect is created from the layers of soft, sheer tulle in several different pastel colors. 100% polyester. Delicate hand wash cold, line dry. SIZE 5 AND 6X REMAINING. ^||,|$64.50$|,||,|BISCOTTI-EASTER-BASKET-GIRLS-TWEEN-DRESS|,|$URL$biscotti-easter-basket-girls-tween-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-easter-basket-girls-dress-1.jpg||-||Biscotti Falling for Dots Gold Holiday Dress|,|^|Matching her little sisters holiday gown, this new girls dress comes from designer Biscotti's ""Falling for Dots"" collection. The sleeveless style is great for an optional shrug while a zipper is found in the back to make the fit perfect! The dress is covered with an overlay of sheer shimmering gold. Round cutouts gather on the bodice with a few continuing down, traveling near the hem. Check out all of the pieces from the ""Falling for Dots"" collection on our Biscotti page or through the related items listed on the next tab. 100% polyester. Dry clean for best results. SIZE 5 ONLY REMAINING.  ^||,|$49.50$|,||,|BISCOTTI-FALLING-DOTS-GOLD-HOLIDAY-DRESS|,|$URL$biscotti-falling-dots-gold-holiday-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-falling-for-dots-gold-holiday-dress-3.jpg||-||Biscotti Falling for Dots Little Girls Red Dress|,|^|A dazzling red holiday gown, this new piece arrived from Biscotti in their ""Falling for Dots"" collection. A shimmering sheer red overlay falls down the skirt. A zipper closes in the back and the sleeveless style is perfect for pairing with a shrug to keep warm. Circle cutouts decorate the entire bodice while a few linger and fall down the skirt. A shimmering center is found on many of the dots. Matching with other dresses from Biscotti's ""Falling for Dots"" for a matching sister look. 12 MOS AND 24 MOS ONLY LEFT.  ^||,|$43.00$|,||,|BISCOTTI-FALLING-DOTS-LITTLE-GIRLS-RED-DRESS|,|$URL$biscotti-falling-dots-little-girls-red-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-falling-for-dots-little-girls-red-dress-3.jpg||-||Biscotti Fan Club Pale Pink Girls Dress|,|^|An elegant choice for all of her spring occasions, this pale pink girls dress is from designer Biscotti. The sleeveless neckline is done in the palest pink. A mesh overlay is filled with satin ribbons in pink and white and covers the entire dress. A keyhole opening at the back closes with a single button. The dress is fully lined. Made from 100% polyester. Dry cleaning recommended. SIZE 4 ONLY LEFT. ^||,|$58.00$|,||,|BISCOTTI-FAN-CLUB-PALE-PINK-GIRLS-DRESS|,|$URL$biscotti-fan-club-pale-pink-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-fan-club-pale-pink-girls-dress-16.jpg||-||Biscotti Fancy Girls Dress Holiday Petals|,|Uniquely beautiful, this new designer dress for girls is both lovely and elegant from Biscotti. The bodice is boasts of the traditional satin sheen decorated with sweet sequins. The sleeveless neckline is a wide shape while a zipper closes the back. The fanciful skirt is created with tiers of petal cutouts making full use of the ombre trend as they move from pale at the waist to a rich shade at the hem. 100% Polyester. Hand Wash in Cold Water. Line Dry. |,|$122.00$|,||,|BISCOTTI-FANCY-GIRLS-DRESS-HOLIDAY-PETALS|,|$URL$biscotti-fancy-girls-dress-holiday-petals.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-fancy-girls-dress-holiday-petals-preorder-6.jpg||-||Biscotti Fancy Girls Shrug|,| |,|$38.00$|,||,|BISCOTTI-FANCY-GIRLS-SHRUG|,|$URL$biscotti-fancy-girls-shrug.html|,|||-||Biscotti Fancy Holiday Dress in Red|,| |,|$82.00$|,||,|BISCOTTI-FANCY-HOLIDAY-DRESS-RED|,|$URL$biscotti-fancy-holiday-dress-red.html|,|||-||Biscotti Faux Fur Shrug for Girls in Dusty Rose|,|A delicious new piece that she will want to wear all season long, this new faux fur shrug is part of Biscotti's outerwear essentials collection for fall and winter. The cocoa color easily compliments pinks, browns, and gold. A single fastener is placed on the front just under the collar. A coordinating satin lines the shrug, making it easy to layer with other fabrics. |,|$62.00$|,||,|BISCOTTI-FAUX-FUR-SHRUG-GIRLS-BROWN|,|$URL$biscotti-faux-fur-shrug-girls-brown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-faux-fur-shrug-for-girls-in-brown-preorder-10.jpg||-||Biscotti Flower Girls Dress|,|Ready to take part in the wedding ceremony, this new designer girls dress is from Biscotti. The bodice features a pleated neckline and a hidden zipper. The waist is accented with a wide sash accented with a single flower. The wide skirt falls to a handkerchief hemline. The cotton fabric is light enough to keep her comfortable on a warm day. A few flowers fall on the skirt in light pastel colors. The sash ties in the back to give a great shape. Made with cotton blend. Machine wash cold, tumble dry low. |,|$59.00$|,||,|BISCOTTI-FLOWER-GIRLS-DRESS|,|$URL$biscotti-flower-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-flower-girls-dress-1.jpg||-||Biscotti Girls Black and White Checker Dress|,|Pulling from retro inspiration, this new Biscotti dress is available in tween sizes. The straight dress has a subtle shape and is cut for a more fitted look. A hidden zipper closes the back of the dress and the sleeveless neckline has a wide trendy shape. The bottom of the dress is covered in a fun checker pattern. Every so often the checkers introduce a soft pastel color to remind us of the new blooms of springtime. Made with polyester blend. Hand wash cold, line dry. |,|$55.50$|,||,|BISCOTTI-GIRLS-BLACK-WHITE-CHECKER-DRESS|,|$URL$biscotti-girls-black-white-checker-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-black-and-white-checker-dress-1.jpg||-||Biscotti Girls Black Dress Falling for Dots|,|^|Created by Biscotti, this new girls holiday gown comes as part of their ""Falling for Dots"" collection designed for winter 2013. The sleeveless bodice is covered with round cutouts, most adorned with a shimmering center. The dots continue down the skirt, becoming fewer near the hemline. The shimmering sheer overlay catches the light as she walks around and a zipper runs up the back for a great fit. 100% polyester. Dry clean for best results. ^||,|$49.50$|,||,|BISCOTTI-GIRLS-BLACK-DRESS-FALLING-DOTS|,|$URL$biscotti-girls-black-dress-falling-dots.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-black-dress-falling-for-dots-3.jpg||-||Biscotti Girls Chic Holiday Dress PREORDER|,|^|Bright as a star, this fabulous new girls dress is from Biscotti for the fall and winter holiday season. The dress is cut for a straight shape that looks fabulous with tights and shrugs. Bold silver stripes made with sequins wrap around the dress. A hidden zipper is found in the back to secure the sleeveless fit. The classic color palette of this dress is easy to match for family or sister photos! Please note that this is a PreOrder item and it is NOT currently in stock. This Biscotti item is expected to be in stock between August 4, 2014 and August 31, 2014. For further information on PreOrders, please visit the PreOrder tab on the top navigation menu. SHRUG not included.  ^||,|$68.00$|,||,|BISCOTTI-GIRLS-CHIC-HOLIDAY-DRESS|,|$URL$biscotti-girls-chic-holiday-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-chic-holiday-dress-preorder-1.jpg||-||Biscotti Girls Dress in White Once Upon A Princess|,|A fun off white dress that is sure to be seen wherever it goes, this new arrival is a creation by the fabulous and loved Biscotti brand. The shapeless dress falls gracefully and has a single button keyhole on the back. The wide boat neck hemline is covered with cute beads and dazzling gems. The off white tulle cascades down to the hemline. Each piece of layered tulle catches the wind and sways with her every step. 100% polyester. Delicate hand wash cold, line dry. |,|$49.00$|,||,|BISCOTTI-GIRLS-DRESS-WHITE-ONCE-UPON-PRINCESS|,|$URL$biscotti-girls-dress-white-once-upon-princess.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-dress-in-white-once-upon-a-princess-1.jpg||-||Biscotti Girls Dress Pink and White|,|^|A sweet new creation, this little girls dress was created by Biscotti Dress. The empire bodice features a high and wide neckline closed with the hidden zipper that runs up the back. The front of her waistline is dressed with pink and white flowers. Sheer cascading ruffles of white and a soft light pink fall from the waist and create an uneven hemline. The sheer fabric catches the wind and sways with her movement. The dress is lined fully. Wear this gem for a birthday celebration! 100% polyester. Machine wash cold, line dry. SIZE 24 MOS AND 2T ONLY LEFT.  ^||,|$64.50$|,||,|BISCOTTI-GIRLS-EASTER-DRESS-PINK-WHITE|,|$URL$biscotti-girls-easter-dress-pink-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-dress-pink-and-white-1.jpg||-||Biscotti Girls Dress Silver Snowflake PREORDER|,|^|Part of the festive ""Deck the Halls"" collection in Biscotti's fall and winter line, this new designer girls dress is drop dead gorgeous. Whether she is taking the yearly photos or socializing at parties, this dress will not fail to be the top style of the night. The sleeveless bodice has a fitted cut and a hidden zipper that runs up the back. Silver sequins cover the fabric and are safe guarded by the tulle overlay. The satin waistline is finished by the bow on her back. Layers of petals create the fun, flirty skirt in grey tulle. Please note that this is a PreOrder item and it is NOT currently in stock. This Biscotti item is expected to be in stock between August 4, 2014 and August 31, 2014. For further information on PreOrders, please visit the PreOrder tab on the top navigation menu. ^||,|$86.00$|,||,|BISCOTTI-GIRLS-DRESS-SILVER-SNOWFLAKE|,|$URL$biscotti-girls-dress-silver-snowflake.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-dress-silver-snowflake-preorder-1.jpg||-||Biscotti Girls Faux Fur Shrug in Pink|,|A design that adds warmth and style to her outfit, this new Biscotti girls shrug is just what she needs to pair with her new holiday dresses! The cropped cut accents dresses with an empire waistline. The collar and short sleeves complete the style while a single fastener is found, slightly hidden, on the front. The light pink faux fur is soft to the touch and makes this piece true luxury. Acrylic/Polyester Blend. Dry Cleaning Recommended. |,|$62.00$|,||,|BISCOTTI-GIRLS-FAUX-FUR-SHRUG-PINK|,|$URL$biscotti-girls-faux-fur-shrug-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-faux-fur-shrug-in-pink-23.jpg||-||Biscotti Girls Holiday Cape|,| |,|$49.00$|,||,|BISCOTTI-GIRLS-HOLIDAY-CAPE-|,|$URL$biscotti-girls-holiday-cape-.html|,|||-||Biscotti Girls Holiday Dress Falling Petals PREORDER|,|^|Part of the ""Good as Gold"" collection, this new special occasion dress is perfect not only for holidays, but also birthdays and weddings! The dress is created with an A-line shape and a wide neckline. The cap sleeves add a cute touch while a zipper runs up the back. The entire dress is covered with matching sequins behind a tulle overlay. This overlay helps protect the sequins from snagging other fabrics. Raining petals fall down the front and wrap around the hemline. Please note that this is a PreOrder item and it is NOT currently in stock. This Biscotti item is expected to be in stock between August 4, 2014 and August 31, 2014. For further information on PreOrders, please visit the PreOrder tab on the top navigation menu. ^||,|$94.00$|,||,|BISCOTTI-GIRLS-HOLIDAY-DRESS-FALLING-PETALS|,|$URL$biscotti-girls-holiday-dress-falling-petals.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-holiday-dress-falling-petals-preorder-1.jpg||-||Biscotti Girls Holiday Dress in Shimmering Rose|,|^|Filled with cheer and class, this new dress from Biscotti's ""Shimmering Rose"" collection is a stunner for the holiday season. The bodice boasts of long sleeves with a cute gathering by the cuff as large flowers with shining centers cover the empire bodice. The back closes up for a great fit while the skirt is made with folds of shimmering rose gold sheer fabric. The handkerchief hems add a wonder filled look. Created with both a polyester-rayon blend and 100% polyester. Hand wash with care and hang to dry. ^||,|$41.00$|,||,|BISCOTTI-GIRLS-HOLIDAY-DRESS-SHIMMERING-ROSE|,|$URL$biscotti-girls-holiday-dress-shimmering-rose.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-holiday-dress-in-shimmering-rose-3.jpg||-||Biscotti Girls Holiday Dress Red Falling for Dots|,|^|A comfortable and elegant holiday dress, this new arrival hails from Biscotti Dress. The bodice offers her long sleeves to keep her warm and a soft fabric that allows slight stretch. The cuffs and neckline are garnished by circle cutouts with shining centers. The classic A line shape of the skirt whispers around her legs as she moves about. Pair with other ""Falling for Dots"" pieces by designer Biscotti for your sister matches! Made with polyester blend. Machine wash cold, line dry. ^||,|$34.00$|,||,|BISCOTTI-GIRLS-HOLIDAY-DRESS-RED-FALLING-DOTS|,|$URL$biscotti-girls-holiday-dress-red-falling-dots.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-holiday-dress-red-falling-for-dots-23.jpg||-||Biscotti Girls Holiday Party Dress in Fuchsia PREORDER|,|^|A party dress she will adore, this new arrival was designed by Biscotti. The A line dress has a classic look while offering long sleeves to keep her arms safe from chilly air. The rich fuchsia shade is filled with contagious fun! Matching sequins accent the neckline and create the wide hem. Two front pockets are also trimmed in the shimmer. A hidden zipper runs up the back to fasten the fit. Please note that this is a PreOrder item and it is NOT currently in stock. This Biscotti item is expected to be in stock between August 4, 2014 and August 31, 2014. For further information on PreOrders, please visit the PreOrder tab on the top navigation menu. ^||,|$69.00$|,||,|BISCOTTI-GIRLS-HOLIDAY-PARTY-DRESS-FUCHSIA|,|$URL$biscotti-girls-holiday-party-dress-fuchsia.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-holiday-party-dress-in-fuchsia-preorder-1.jpg||-||Biscotti Girls Holiday Shrug PREORDER|,|^|Designed by Biscotti, this new holiday shrug is delightfully fun. The piece offers a classic cropped cut that coordinates well with most any style of dress. The long sleeves add a touch of warmth to her outfit while the solid black fabric is soft to the skin and allows slight stretch. The neckline is wrapped with fun faux fur accented with touches of metallic silver. Please note that this is a PreOrder item and it is NOT currently in stock. This Biscotti item is expected to be in stock between August 4, 2014 and August 31, 2014. For further information on PreOrders, please visit the PreOrder tab on the top navigation menu. ^||,|$48.00$|,||,|BISCOTTI-GIRLS-HOLIDAY-SHRUG|,|$URL$biscotti-girls-holiday-shrug.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-holiday-shrug-preorder-1.jpg||-||Biscotti Girls Holiday Shrug Silver Snowflake|,| |,|$38.00$|,||,|BISCOTTI-GIRLS-HOLIDAY-SHRUG-SILVER-SNOWFLAKE|,|$URL$biscotti-girls-holiday-shrug-silver-snowflake.html|,|||-||Biscotti Girls Luxurious Dress Tiered Princess|,|From designer Biscotti, this new couture girls dress is a luxurious style that she will love! The bodice features an angled neckline and a hidden zipper in the back. A cute bow is tied at the back of her waist while shimmering sequin accents are found on the front. The unique fabric is teeming with vintage inspiration. The layered skirt boasts of a shimmering iridescent overlay that catches the light perfectly! 100% Polyester. Hand Wash in Cold Water. Line Dry. |,|$109.00$|,||,|BISCOTTI-GIRLS-LUXURIOUS-DRESS-TIERED-PRINCESS|,|$URL$biscotti-girls-luxurious-dress-tiered-princess.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-luxurious-dress-tiered-princess-1.jpg||-||Biscotti Girls Party Dress Navy and White Stripes|,|A sophisticated style, this new Biscotti dress is just in time for spring! The bodice has a hidden zipper in the back. The wide neckline is sleeveless and easy to pair with a short bolero. A large bow has a red center and sits in the center of her waist. The skirt has a volume filled shape that is absolutely adorable and looks great with her fancy shoes. The dress is covered with an infections white and navy stripe. zMade with cotton blend. Machine wash cold, tumble dry low. |,|$49.00$|,||,|BISCOTTI-GIRLS-PARTY-DRESS-NAVY-WHITE-STRIPES|,|$URL$biscotti-girls-party-dress-navy-white-stripes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-party-dress-navy-and-white-stripes-1.jpg||-||Biscotti Girls Red Christmas Party Dress|,| |,|$86.00$|,||,|BISCOTTI-GIRLS-RED-CHRISTMAS-PARTY-DRESS|,|$URL$biscotti-girls-red-christmas-party-dress.html|,|||-||Biscotti Girls Red Sequin Shrug|,| |,|$38.00$|,||,|BISCOTTI-GIRLS-RED-SEQUIN-SHRUG|,|$URL$biscotti-girls-red-sequin-shrug.html|,|||-||Biscotti Girls Ruffle Dress Brown Iridescence|,|^|Flirty and fun, this creation from designer Biscotti will put a lasting smile on her face. The sleeveless dress falls down with a classic straight shape offering her a comfortable fit. The gown is covered with waves of iridescent brown ruffles cascading from her neckline down to the hem. Unique from all other dresses, this one is sure to stand out. 100% polyester. Hand wash cold, line dry. SIZE 5 AND 6X ONLY LEFT.  ^||,|$44.50$|,||,|BISCOTTI-GIRLS-RUFFLE-DRESS-BROWN-IRIDESCENCE|,|$URL$biscotti-girls-ruffle-dress-brown-iridescence.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-ruffle-dress-brown-iridescence-2.jpg||-||Biscotti Girls Shrug Pink with Beading|,|Pairing with the new Biscotti dresses, this girls shrug is a must have for the season. The light pink shrug offers her long sleeves and a soft cotton fabric. The front is dressed with pearl beads and shimmering sequins. A single button closes the neckline and creates the unique shape. This layering piece can go with many of her spring and summer outfits. Made with polyester blend. Delicate hand wash cold, flat to dry. |,|$28.50$|,||,|BISCOTTI-GIRLS-SHRUG-PINK-BEADING|,|$URL$biscotti-girls-shrug-pink-beading.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-shrug-pink-with-beading-1.jpg||-||Biscotti Girls Special Occasion Dress|,|A sweet new gown, this special occasion dress was created by fabulous designer Biscotti. The long dress features a sleeveless neckline and hidden tucks that shape the top. Matching petal flowers fall down the dress. The shape opens slightly near the end of the skirt as ruffles and a fairy hemline finish this gorgeous piece. The soft colors of the sheer fabric say farewell to the winter snow and welcome in the new life that fills springtime. This dress is perfect for weddings, recitals, or Easter! 100% polyester. Machine wash cold, hang to dry. |,|$66.75$|,||,|BISCOTTI-GIRLS-SPECIAL-OCCASION-DRESS|,|$URL$biscotti-girls-special-occasion-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-girls-special-occasion-dress-1.jpg||-||Biscotti Girls Winter Velvet Coat|,| |,|$89.00$|,||,|BISCOTTI-GIRLS-WINTER-VELVET-COAT|,|$URL$biscotti-girls-winter-velvet-coat.html|,|||-||Biscotti Glittering Infant Dress Pretty Princess Pink|,|^|A shimmering delight from head to hem, this new Biscotti girls holiday dress is gorgeous. The cap sleeve bodice features a silver empire waist adorned with four gems in the front and a satin bow to tie in the back. Small silver sequins cover the entire dress and feature a tulle overlay with a slight gleam. Zipper closes the back. Hand wash garment with care and line dry. (1) 12 MOS ONLY LEFT.  ^||,|$29.00$|,||,|BISCOTTI-GLITTERING-INFANT-DRESS-PRETTY-PRINCESS-PINK|,|$URL$biscotti-glittering-infant-dress-pretty-princess-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-glittering-infant-dress-pretty-princess-pink-14.jpg||-||Biscotti Gold Holiday Dress for Girls Falling for Dots|,|^|Ready for your perfect family holiday photo, this little girls dress comes from Biscotti. The bodice is sleeveless and features a zipper that closes at the back. Small circle cutouts completely cover the front of the bodice and rain down on the skirt. The shimmering gold fabric is sheer and overlays the skirt. Be sure to check out all the other items available from the ""Falling for Dots"" collection. SIZE 3T ONLY REMAINING. ^||,|$43.00$|,||,|BISCOTTI-GOLD-HOLIDAY-DRESS-GIRLS-FALLING-DOTS|,|$URL$biscotti-gold-holiday-dress-girls-falling-dots.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-gold-holiday-dress-for-girls-falling-for-dots-2.jpg||-||Biscotti Grey Faux Fur Shrug for Girls|,|Biscotti Dress is now offering this sweet faux fur shrug as a part of their fall and winter line. The grey holds a sweet sheen while it is beyond soft to the touch. The collar hides the single fastener slightly as it closes the front. Silver satin lining makes layering with other pieces a breeze by not catching other fabrics. Acrylic/Polyester Blend. Dry Cleaning Recommended. |,|$62.00$|,||,|BISCOTTI-GREY-FAUX-FUR-SHRUG-GIRLS|,|$URL$biscotti-grey-faux-fur-shrug-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-grey-faux-fur-shrug-for-girls-1.jpg||-||Biscotti Holiday Cape for Tweens|,| |,|$54.00$|,||,|BISCOTTI-HOLIDAY-CAPE-TWEENS|,|$URL$biscotti-holiday-cape-tweens.html|,|||-||Biscotti Holiday Dress for Girls Winter Wonderland PREORDER|,|^|A glamorous special occasion dress, this Biscotti design looks absolutely beautiful at any event. The drop waist bodice is dressed in shimmering sequins covered by a tulle overlay. The back fastens closed to provide the fitted look the bodice was cut for. The ivory satin waist introduces the petal skirt. Layers of tulle are filled with the snowy, free-spirit of the holiday season while a bow is tied at the back of the waist. Please note that this is a PreOrder item and it is NOT currently in stock. This Biscotti item is expected to be in stock between August 4, 2014 and August 31, 2014. For further information on PreOrders, please visit the PreOrder tab on the top navigation menu. ^||,|$86.00$|,||,|BISCOTTI-HOLIDAY-DRESS-GIRLS-WINTER-WONDERLAND|,|$URL$biscotti-holiday-dress-girls-winter-wonderland.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-holiday-dress-for-girls-winter-wonderland-preorder-5.jpg||-||Biscotti Holiday Pleather Skirt Set for Girls|,|A dressy look for any occasion this fall and winter, this new girls outfit was designed by Biscotti. The fitted top is made in deep navy, a classic look. Flower and gem accents are attached to the top just below her left shoulder. Her long sleeves are an elegant, sheer fabric that creates the overlay on the entire piece and a sweet row of buttons close the back. The top is paired with a pleather skirt with a full circle shape. The navy pleather is complimented by a tulle ruffle that peaks out of the hemline. Cotton/Polyester/Spandex Blend. Hand Wash in Cold Water. Hang to Dry. |,|$89.00$|,||,|BISCOTTI-HOLIDAY-PLEATHER-SKIRT-SET-GIRLS|,|$URL$biscotti-holiday-pleather-skirt-set-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-holiday-pleather-skirt-set-for-girls-23.jpg||-||Biscotti Infant and Toddler Dress|,|Twin to several new arrivals from designer Biscotti, this little girls dress is available in infant and toddler sizes. The light pink straps are ruffled with elastic for a darling effect. The empire bodice is completely covered with pastel flowers upon the front. The matching skirt falls in layers of light colored tulle that is soft with a graceful movement. She is sure to adore this dress and it will look gorgeous in your family photos! 100% polyester. Delicate hand wash cold, line dry. |,|$55.50$|,||,|BISCOTTI-EASTER-INFANT-TODDLER-DRESS|,|$URL$biscotti-easter-infant-toddler-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-infant-and-toddler-dress-1.jpg||-||Biscotti Ivory Lace Girls Shrug|,|^|This shrug is the perfect addition to her perfect dresses from Biscotti. The long sleeve lace style will compliment her sleeveless dresses beautifully. A row of ruffles around the entire piece culminates in a beautifully tied bow at the center of the front. Ruffles adorn the bodice also. Polyester and rayon. Machine wash cold, delicate cycle. Line dry. ONE SIZE 4 REMAINING  ^||,|$17.00$|,||,|BISCOTTI-IVORY-LACE-GIRLS-SHRUG|,|$URL$biscotti-ivory-lace-girls-shrug.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-ivory-lace-girls-shrug-16.jpg||-||Biscotti Ivory Vintage Lace Embrace Bloomer Set|,|^|Vintage style for your little cherub is what you'll get in this gorgeous lace bloomer set from Biscotti. The squared bodice is adorned with dotted lace on the straps and a bow of dotted lace on each side where strap meets bodice. Ruffles in varying patterns of vintage lace flow down to the hemline of this glorious top. The back features a row of buttons all the way down. The matching bloomer repeats the lace ruffle pattern and features a gathered ruffle at the hem. Cotton, polyester, rayon. Machine wash cold, delicate cycle. Line dry. 24 MOS ONLY AVAILABLE.  ^||,|$29.00$|,||,|BISCOTTI-IVORY-VINTAGE-LACE-EMBRACE-BLOOMER-SET|,|$URL$biscotti-ivory-vintage-lace-embrace-bloomer-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-ivory-vintage-lace-embrace-bloomer-set-16.jpg||-||Biscotti Little Girls Ballerina Dress in Green|,|A romantic style for the coming holiday season, this new special occasion dress for little girls was designed by Biscotti. The empire bodice features cute cap sleeves and a unique vintage inspired texture to the fabric. A zipper runs up the back while two ties form a bow on the back of her empire waist. The front of the waist is dress in sparkling sequins. The full circle skirt is created with layers of dreamy tulle. 100% Polyester. Hand Wash in Cold Water. Line Dry. |,|$92.00$|,||,|BISCOTTI-LITTLE-GIRLS-BALLERINA-DRESS-GREEN|,|$URL$biscotti-little-girls-ballerina-dress-green.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-little-girls-ballerina-dress-in-green-23.jpg||-||Biscotti Little Girls Ballerina Dress with Flowers|,| |,|$86.00$|,||,|BISCOTTI-LITTLE-GIRLS-BALLERINA-DRESS-FLOWERS|,|$URL$biscotti-little-girls-ballerina-dress-flowers.html|,|||-||Biscotti Little Girls Dress Silver Snow Princess|,|^|A darling and unique girls dress, this new creation comes from Biscotti as a piece of their ""Snow Princess"" collection. The empire waist bodice boasts of cute cap sleeves and a zipper running up the back. Beads and gems create a pattern on her waist while bodice is speckled with a subtle and soft snow leopard print. The skirt is draped with layers of a shimmering sheer fabric in light silver. Upper: Made with a polyester blend. Lower: 100% nylon. Hand wash cold, line dry. SIZE 9 MONTH, 12 MONTH AND 18 MONTH LEFT. ^||,|$41.00$|,||,|BISCOTTI-LITTLE-GIRLS-DRESS-SILVER-SNOW-PRINCESS|,|$URL$biscotti-little-girls-dress-silver-snow-princess.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-little-girls-dress-silver-snow-princess-2.jpg||-||Biscotti Little Girls Red Dress Pocketful of Posies|,|^|By designer Biscotti, this little girls red dress will be the talk of all your friends and family. The bodice possesses an empire waist adorned with a velour stripe and a trio of flowers in the center. A zipper closes the back and puffy cap sleeves enhance the style. The skirt is wrapped with a red tulle overlay that falls in a bubble hem. Large red flowers dance upon the skirt with her movement. 100% nylon. Dry clean for best results. 6 MOS AND 2T ONLY LEFT.  ^||,|$47.00$|,||,|BISCOTTI-LITTLE-GIRLS-HOLIDAY-DRESS-POCKETFUL-POSIES|,|$URL$biscotti-little-girls-holiday-dress-pocketful-posies.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-little-girls-red-dress-pocketful-of-posies-1.jpg||-||Biscotti Long Sleeve Black Dress for Girls|,|Boasting of their talent with trendy styles, this new designer dress for girls is by Biscotti. The dress is an A-line cut, offering her a classic and timeless fit. The black color block look is disrupted with circles that are filled with the alternate colors. Her long sleeves are a light ivory on the top and jet black on the top, accenting the coloring of the dress. A hidden zipper can be found in the back to fasten the dress. Polyester/Rayon/Spandex Blend. Dry Clean Recommended. |,|$72.00$|,||,|BISCOTTI-LONG-SLEEVE-BLACK-DRESS-GIRLS|,|$URL$biscotti-long-sleeve-black-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-long-sleeve-black-dress-for-girls-preorder-10.jpg||-||Biscotti Mod About You Girls Dress|,|A fun mod style, this new designer girls dress comes from Biscotti. The fun print blends yellow, orange, lime, and light pink. The retro inspiration is evident from first sight while cute colored gems are found on the front. The shapeless cut has a relaxed fit that is darling with leggings or a short bolero. A zipper closes up the back. The sleeveless neckline is wide and elegant in shape. Made with polyester blend. Hand wash cold, line dry. |,|$49.50$|,||,|BISCOTTI-MOD-ABOUT-YOU-GIRLS-DRESS|,|$URL$biscotti-mod-about-you-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-mod-about-you-girls-dress-1.jpg||-||Biscotti Off White Girls Dress Petal Parfait|,|Another stunning girls dress from designer Biscotti. This is the perfect dress for wedding or any elegant occasion. The sleeveless bodice is adorned with sequins, faux pearls and beadwork over a shimmery off white fabric. Just below the bodice, a parfait of off white petals in sheer and satin finish dance around the entire dress to the hemline. The dress is lined and has a full zipper at the back. Made from polyester, dry cleaning recommended. |,|$57.00$|,||,|BISCOTTI-OFF-WHITE-GIRLS-DRESS-PETAL-PARFAIT|,|$URL$biscotti-off-white-girls-dress-petal-parfait.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-off-white-girls-dress-petal-parfait-15.jpg||-||Biscotti Once Upon a Princess Dress with Beading|,|A dress meant for a princess, this new Biscotti dress is perfect for a spring wedding or Easter celebration. The off white dress features a beaded bodice with a hidden zipper in the back. A thin tie makes a bow on her back while the sleeveless neckline is accented with tulle. Layers of dreamy tulle fall from her waist in different angles to create a gorgeous uneven hemline. The dress is fully lined. Made with polyester blend. Delicate hand wash cold, line dry. |,|$89.00$|,||,|BISCOTTI-ONCE-UPON-PRINCESS-DRESS-BEADING|,|$URL$biscotti-once-upon-princess-dress-beading.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-once-upon-a-princess-dress-with-beading-17.jpg||-||Biscotti Orange Polka Dot Dress for Girls|,|Raining polka dots, this new girls dress from Biscotti is a fun new creation just in time for spring! A sleeveless boat neck is positively adorable while the front is accented with large sequins. The sheer white fabric is covered with orange dots. The soft dots become increasingly bold as we reach the hem. The light weight nature of the fabric gives it a waving look as it cascades down the dress and captures every slight breeze or movement she makes. 100% polyester. Machine wash cold, line dry. |,|$58.50$|,||,|BISCOTTI-ORANGE-POLKA-DOT-DRESS-GIRLS|,|$URL$biscotti-orange-polka-dot-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-orange-polka-dot-dress-for-girls-1.jpg||-||Biscotti Patriotic Navy Dress|,|^|She'll set sail for summer in style in this fabulous girls dress from designer Biscotti. Navy stripes adorn the bodice along with mesh flowers. A bow in navy dot pattern also accents the bodice. Short sleeves and a keyhole opening with one button are other features. The navy skirt is created from a mesh overlay with oversized mesh flowers at the hem. Cotton, spandex and polyester. Machine wash cold, tumble dry low. SIZE 12 MONTH AVAILABLE. ^||,|$29.00$|,||,|BISCOTTI-PATRIOTIC-NAVY-DRESS|,|$URL$biscotti-patriotic-navy-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-patriotic-navy-dress-14.jpg||-||Biscotti Platinum Petals Girls Sleeveless Party Dress|,|Sophistication blended with sass, this new girls party dress comes from designer Biscotti. The empire waist bodice features a shimmering georgette overlay, large silver sequins accenting the waist, and a hidden zipper in the back. The skirt is covered with dancing satin and georgette petals all the way down to the hem. Adding to the textured interest, grey boa feathers adorn the bottom of the skirt. 100% polyester, dry clean recommended. |,|$59.00$|,||,|BISCOTTI-PLATINUM-PETALS-GIRLS-SLEEVELSS-PARTY-DRESS|,|$URL$biscotti-platinum-petals-girls-sleevelss-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-platinum-petals-girls-sleeveless-party-dress-16.jpg||-||Biscotti Pocketful of Posies Girls Red Dress|,|^|In Biscotti's ""Pocketful of Posies"" collection, this girls holiday dress is stunning. The red bodice boasts of long sleeves to help keep her warm and a trio of little red flowers off centered beneath the neckline. The skirt bubbles out with its hem while several layers of red tulle overlay. Large red flowers with shimmering centers have made their home upon the skirt. Upper: Made with polyester blend. Lower: 100% nylon. Hand wash cold, line dry. ^||,|$39.00$|,||,|BISCOTTI-POCKETFUL-POSIES-GIRLS-RED-HOLIDAY-DRESS|,|$URL$biscotti-pocketful-posies-girls-red-holiday-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-pocketful-of-posies-girls-red-dress-1.jpg||-||Biscotti Red Holiday Dress for Girls Falling for Dots|,|^|Biscotti is now offering this holiday red dress as a part of their ""Falling for Dots"" collection. The zipper runs up the back while the bodice boasts of its sleeveless neckline. The satin is comfortable on her skin and is dressed by a red shimmering overlay. Circles dance from the bodice down the skirt and an added shining center is found on most. 100% polyester. Dry clean for best results. SIZE 4 AND 6 AVAILABLE. ^||,|$49.50$|,||,|BISCOTTI-RED-HOLIDAY-DRESS-GIRLS-FALLING-DOTS|,|$URL$biscotti-red-holiday-dress-girls-falling-dots.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-red-holiday-dress-for-girls-falling-for-dots-3.jpg||-||Biscotti Shes Got Stripes Girls Dress|,|^|Biscotti is now offering this adorable girls summer dress as a part of their ""She's Got Stripes"" collection. The long sleeve bodice is fastened closed in the back while a single bow accents the neckline. The thin stripes of navy are closer together on the top and continue down to the drop waist. The same small bow is off centered on her waistline. The skirt has navy and white stripes in a bold, wide style. Made with cotton blend. Machine wash cold, tumble dry low. ^||,|$55.50$|,||,|BISCOTTI-SHES-GOT-STRIPES-GIRLS-DRESS|,|$URL$biscotti-shes-got-stripes-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-shes-got-stripes-girls-dress-1.jpg||-||Biscotti Shrug for Girls in White|,|To go with all of the fabulous new creations from designer Biscotti, this girls shrug will add to her style. The front of the shrug features sprinkles of pearl beads and sequins that catch the light. A button found in the center of the neckline fastens the front closed. The soft cotton fabric is comfortable enough for all day wear and also creates the long sleeves. Made with polyester blend. Delicate hand wash cold, flat to dry. |,|$28.50$|,||,|BISCOTTI-SHRUG-GIRLS-WHITE|,|$URL$biscotti-shrug-girls-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-shrug-for-girls-in-white-1.jpg||-||Biscotti Sleeveless Toddler Party Dress Pretty Princess|,|^|A stunning new creation for this coming holiday season, this new toddler dress comes from fabulous designer Biscotti. Covered with a light pink glitter tulle, this dress boasts of its small silver sequins found on the entire piece, reflecting the light as she moves. The sleeveless bodice boasts of its silver satin waist adorned with large gems and tying in a bow in the back. A zipper is hidden with a tuck of fabric in the back. The skirt's full shape is provided by the top layer of tulle as well as an under layer. Line dry, hand wash delicately. (1) 2T ONLY LEFT. ^||,|$49.00$|,||,|BISCOTTI-SLEEVELESS-TODDLER-PARTY-DRESS-PRETTY-PRINCESS|,|$URL$biscotti-sleeveless-toddler-party-dress-pretty-princess.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-sleeveless-toddler-party-dress-pretty-princess-16.jpg||-||Biscotti Sleeveless Tween Dress Snow Princess|,|^|A trendy new piece for this winter's holiday season, this silver tween dress comes from Biscotti's ""Snow Princess"" collection. The straight sheath style is a hit for all tweens while the sleeveless neckline is complimented by beads and gems. The dress is covered with a shimmering and subtle leopard print, making it a must have! Be sure to check out the younger Snow Princess dress for a matching sister pair or trio! Made with polyester blend. Hand wash cold, line dry. 8 ONLY AVAILABLE.  ^||,|$37.00$|,||,|BISCOTTI-SLEEVELESS-TWEEN-DRESS-SNOW-PRINCESS|,|$URL$biscotti-sleeveless-tween-dress-snow-princess.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-sleeveless-tween-dress-snow-princess-3.jpg||-||Biscotti Toddler Holiday Dress Tiered Lace PREORDER|,|^|Elegant and timeless, this new Biscotti dress is avalable in infant and toddler sizes and is from the ""Good as Gold"" collection. The dress features an empire bodice with a neckline framed by cap sleeves. The champagne color is rich and classic while touches of matching lace bring in a vintage feel. A bow ties at the back of her waist and a hidden zipper fastens in the back. The skirt is made with angled layers of alternating fabrics. The touches of shimmering sheer and lacey fabrics is truly unique to this piece. Please note that this is a PreOrder item and it is NOT currently in stock. This Biscotti item is expected to be in stock between August 4, 2014 and August 31, 2014. For further information on PreOrders, please visit the PreOrder tab on the top navigation menu. ^||,|$86.00$|,||,|BISCOTTI-TODDLER-HOLIDAY-DRESS-TIERED-LACE|,|$URL$biscotti-toddler-holiday-dress-tiered-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-toddler-holiday-dress-tiered-lace-preorder-1.jpg||-||Biscotti Trench Coat Polka Dot Navy and White|,|The perfect spring time jacket, this new girls coat comes from Biscotti. The jacket has a traditional length and collar found on a trench coat. The buttons blend in to the navy polka dot fabric. A wide sash ties around her waist to give shape. The hemline is finished with three tiers of ruffles. Whether its from the chilly spring air or the droplets of rain, this cute girls jacket is sure to keep her comfortable. 100% polyester. Machine wash cold, tumble dry low. |,|$66.00$|,||,|BISCOTTI-TRENCH-COAT-POLKA-DOT-NAVY-WHITE|,|$URL$biscotti-trench-coat-polka-dot-navy-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-trench-coat-polka-dot-navy-and-white-1.jpg||-||Biscotti Tulle Ruffle Infant Dress with Legging Tippy Toes|,|^|This new designer infant dress from Biscotti is fit for the season. The long sleeve dress features a soft velour bodice boasting of a satin ribbon design accenting the front of the neck. Two tiers of ruffles are finished with matching curled satin ribbon. The accompanying leggings are as soft as the bodice. Cotton blend, machine washable. SIZE NEWBORN ONLY REMAINING. ^||,|$29.00$|,||,|BISCOTTI-TULLE-RUFFLE-INFANT-DRESS-LEGGING-TIPPY-TOES|,|$URL$biscotti-tulle-ruffle-infant-dress-legging-tippy-toes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-tulle-ruffle-infant-dress-with-legging-tippy-toes-14.jpg||-||Biscotti Tween Dress in Navy and White Stripe|,|^|From Biscotti's new ""She's Got Stripes"" collection, this fabulous tween dress is perfect for almost any occasion. The wide neckline dresses the sleeveless bodice with an elegant style. A zipper runs up the back. The dress is cut for a fitted look. The skirt continues in the same fun nautical print that will take the summer by storm! This dress is easy to dress up for elegant occasions, but can also be worn to birthdays or recitals! The wide stripes match perfectly several of the new dresses. Made with cotton blend. Machine wash cold, tumble dry low. ^||,|$39.00$|,||,|BISCOTTI-TWEEN-DRESS-NAVY-WHITE-STRIPE|,|$URL$biscotti-tween-dress-navy-white-stripe.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-tween-dress-in-navy-and-white-stripe-1.jpg||-||Biscotti Tween Girls Shrug Shimmering Rose|,|^|The perfect choice to wear over her new Biscotti Shimmering Rose Holiday Dress, this designer shrug will become her go to shrug for any outfit that needs a bit of class and style. The bolero shape is classic and flattering while the long sleeves are finished with a small gather by the cuffs. A single flower rests upon the left side while the soft rose gold shade shimmers and catches the light. Created with both a polyester-rayon blend and 100% polyester. Hand wash with care and hang to dry. (1) SIZE 14 ONLY AVAILABLE.  ^||,|$14.50$|,||,|BISCOTTI-TWEEN-GIRLS-SHRUG-SHIMMERING-ROSE|,|$URL$biscotti-tween-girls-shrug-shimmering-rose.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-tween-girls-shrug-shimmering-rose-2.jpg||-||Biscotti Tween Special Occasion Dress|,|A fabulous design for your tween, this new Biscotti dress is sure to fit almost any special occasion. The empire bodice is covered with flowers on the front while the wide neckline is created by the multiple, thin straps on each shoulder. A zipper closes the fit on her back. Waterfall cascades fall from the center of her waist and wrap around the dress down to the high-low hemline. The soft flower pattern is layered with sheer dotted mesh. This dress is the perfect match to a younger style, also a new arrival from Biscotti for spring and summer! 100% polyester. Machine wash cold, hang to dry. |,|$81.75$|,||,|BISCOTTI-TWEEN-SPECIAL-OCCASION-DRESS|,|$URL$biscotti-tween-special-occasion-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-tween-special-occasion-dress-1.jpg||-||Biscotti Tween White Special Occasion Dress|,|^|A fancy new off white tween dress, this wonderful creation from designer Biscotti is sure to be a hit! The sleeveless bodice features an empire waistline that is accented with gorgeous, coordinating beads. The hidden zipper runs up the back to secure the fit. The skirt has layers of matching tulle that resemble a cascading waterfall. The tulle makes a unique hemline and is lined underneath. Made with polyester blend. Delicate hand wash cold, line dry. SIZE 7 ONLY LEFT.  ^||,|$73.50$|,||,|BISCOTTI-TWEEN-WHITE-SPECIAL-OCCASION-DRESS|,|$URL$biscotti-tween-white-special-occasion-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-tween-white-special-occasion-dress-17.jpg||-||Biscotti Velvet Winter Hat for Toddlers|,| |,|$29.00$|,||,|BISCOTTI-VELVET-WINTER-HAT-TODDLERS|,|$URL$biscotti-velvet-winter-hat-toddlers.html|,|||-||Biscotti White Standing Ovation Girls Party Dress|,|^|Whether itS a holiday gathering or family photos, this new Biscotti gown for girls is a true show stopper. The straight shaped dress is covered in cute flowers adding awesome visual texture as a satin bow is found on each shoulder. Zipper is hidden in the back, dress is lined. Polyester, hand wash. SIZE 18 MONTH ONLY LEFT. ^||,|$33.00$|,||,|BISCOTTI-WHITE-STANDING-OVATION-GIRLS-PARTY-DRESS|,|$URL$biscotti-white-standing-ovation-girls-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/biscotti-white-standing-ovation-girls-party-dress-18.jpg||-||Blossoms Girls White Baptism Hair Clip|,|Placed upon an alligator clip, this white crinkled satin rosette features a touch of green in the center joining the flower rosette. Perfect to accent her baptism outfit,this new clip comes from designer Blossoms. |,|$8.00$|,||,|BLOSSOMS-GIRLS-WHITE-BAPTISM-HAIR-CLIP|,|$URL$blossoms-girls-white-baptism-hair-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/blossoms-girls-white-baptism-hair-clip-11.jpg||-||Blossoms Grape Flower Hair Clip for Girls|,|A two tone delight, this girls hair clip comes from Blossoms by Kristin Boutin. The crinkled satin is finished with applied heat to the edges while a ribbon flowers sits in the center. Two green leaves stick out the side to finish this circle rosette. Attached to an alligator clip. |,|$8.00$|,||,|BLOSSOMS-GRAPE-FLOWER-HAIR-CLIP-GIRLS|,|$URL$blossoms-grape-flower-hair-clip-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/blossoms-grape-flower-hair-clip-for-girls-11.jpg||-||Brown Crochet Girls Hat - Jumbo Peony Hat|,|Perfect for cooler temperatures, she'll love this sweet brown crochet hat with its flower attachment. Decorated by a large pink jewel in the center, this five and a half inch peony takes the stylish hat to the next level of fashion. Designed by PJ Boutique. |,|$9.00$|,||,|BROWN-CROCHET-GIRLS-HAT-JUMBO-PEONY-HAT|,|$URL$brown-crochet-girls-hat-jumbo-peony-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/brown-crochet-girls-hat-jumbo-peony-hat-11.jpg||-||Cach Cach Baby Blanket with Leopard Trim|,|^|The perfect welcoming gift for the newborn princess in your life, this Cach Cach baby blanket is one mom will always have with her on the go and at home. The pink cotton is a light shade and delicate on her skin. A punch of pattern is added by the leopard print ruffle that races around the edges of this blanket. If you want to give a truly unforgettable gift, match this blanket with any of the outfits from the ""Pleather Dots"" collection along with a hair clip or headband! Measures 28 inches wide and 34 inches long. Cotton/Spandex Blend. Machine Wash in Cold Water. Tumble Dry Low. ^||,|$54.00$|,||,|CACH-CACH-BABY-BLANKET-LEOPARD-TRIM|,|$URL$cach-cach-baby-blanket-leopard-trim.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-baby-blanket-with-leopard-trim-1.jpg||-||Cach Cach Baby Clothes Pink Romper|,|Created by Cach Cach, this infant romper is absolutely adorable! The light pink shade is classic and well loved by all! The empire bodice of the romper features a large flower off centered at the waistline while waves of ribbons texture the dress by falling in lines with small rosettes mixed in. The bottom of the romper is finished with a bubble hemline and classic changing snaps are found on the inseam. Do not miss out on this great summer gem! |,|$39.75$|,||,|CACH-CACH-BABY-CLOTHES-PINK-ROMPER|,|$URL$cach-cach-baby-clothes-pink-romper.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-baby-clothes-pink-romper-1.jpg||-||Cach Cach Baby Coming Home Outfit - Ivory Gown|,|Designed by Cach Cach, this delicate infant gown is sure to look stunning at any occasion. The cotton bodice is soft on her skin and a single button is fastened on her back. The sleeveless shoulders are accented with a waving hemline. The waist is draped with the tails of a large tulle bow. A small ivory flower sits in the center of the bow. The skirt is covered with chiffon flower textures. The hemline is created in the bubble style. |,|$38.25$|,||,|CACH-CACH-BABY-COMING-HOME-OUTFIT-IVORY-GOWN|,|$URL$cach-cach-baby-coming-home-outfit-ivory-gown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-baby-coming-home-outfit-ivory-gown-17.jpg||-||Cach Cach Baby Gown in Pink|,|A sweet gift for an expecting mother, this fabulous gown comes from designer Cach Cach. The gown matches other items from the designer's fall and winter collection so she can match her older sisters. The bodice has long sleeves for the chilly air. The neckline is fastened in the back with a single button keyhole. The leopard print waistline is accented with a long tail bow and a tulle flower. A light pink tulle overlays the skirt while covered with pink pleather polka dots. The hemline is gathered with elastic to help keep her tiny feet bundled. Cotton/Spandex Blend. Machine Wash in Cold Water. Tumble Dry Low. |,|$49.00$|,||,|CACH-CACH-BABY-GOWN-PINK|,|$URL$cach-cach-baby-gown-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-baby-gown-in-pink-1.jpg||-||Cach Cach Blue Icy Blooms Baby Blanket|,|^|Sure to create a sweet baby show gift, this new infant girls blanket comes from Cach Cach. The soft light blue cotton is delicate on her skin and will help keep her from the chill of the wind. The edge of the entire blanket is decorated with flower cut outs in a matching blue. This blanket is the perfect match of the new arrival ""Cach Cach Newborn Baby Gown in Icy Blue."" Cotton/spandex. Machine wash cold gentle cycle. ^||,|$36.75$|,||,|CACH-CACH-BLUE-ICY-BLOOMS-BABY-BLANKET|,|$URL$cach-cach-blue-icy-blooms-baby-blanket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-blue-icy-blooms-baby-blanket-1.jpg||-||Cach Cach Cream Pie Capri Set for Girls in Ivory|,|Almost identical to a younger style, this girls top and pant set comes from Cach Cach. The neckline helps to create the graceful feel while the soft cotton has a fitted cut. The long skirt is dressed with a garden of flowers that introduce a brilliant texture. The sheer overlay of the skirt flairs as she twirls. Ivory cotton capris are worn beneath. The elastic waist has an easy fit and a matching ruffle hem finishes the pants. |,|$57.00$|,||,|CACH-CACH-CREAM-PIE-CAPRI-SET-GIRLS-IVORY|,|$URL$cach-cach-cream-pie-capri-set-girls-ivory.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-cream-pie-capri-set-for-girls-in-ivory-1.jpg||-||Cach Cach Cream Pie Ivory Baby Bubble|,|Perfect for a wedding, this new designer baby outfit was designed by CachCach. The sleeveless neckline is the perfect design that looks fabulous on its own and is easy to layer if needed. The ivory petal flower found on the waist is off centered. The bottom of the romper is covered with a sheer overlay that is textured with rosettes. The bubble hem almost disguises the romper shape. Changing snaps are found on the inseam. |,|$42.75$|,||,|CACH-CACH-CREAM-PIE-IVORY-BABY-BUBBLE|,|$URL$cach-cach-cream-pie-ivory-baby-bubble.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-cream-pie-ivory-baby-bubble-1.jpg||-||Cach Cach Cream Pie Ivory Purse for Little Girls|,|A light ivory that has a gorgeous elegance, this Cach Cach purse can hold her treasures or the petals she is to spread down the aisle. The thin shoulder strap is long. The rounded shape of the purse is accented by the slight gather at the mouth. The flower texture on the outside is adorned by a large sheer petal flower with a shimmering center. The inside of the purse is fully lined. |,|$17.25$|,||,|CACH-CACH-CREAM-PIE-IVORY-PURSE-LITTLE-GIRLS|,|$URL$cach-cach-cream-pie-ivory-purse-little-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-cream-pie-ivory-purse-for-little-girls-1.jpg||-||Cach Cach Girls Party Dress in Blue Icy|,|New from CachCach, this girls party dress matches her younger sisters new outfit in icy blue. The bodice has a sleeveless neckline and a plain cotton fabric that is both soft and allows slight stretch in its pull over fit. The waist is adorned with three flowers placed in a row. The skirt drapes beautifully and the flower cut outs flutter with the wind. The soft light blue is perfect for the new life of spring or the fun of a summer wedding! Cotton/spandex. Machine wash cold gentle cycle. |,|$59.00$|,||,|CACH-CACH-GIRLS-PARTY-DRESS-BLUE|,|$URL$cach-cach-girls-party-dress-blue.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-girls-party-dress-in-blue-1.jpg||-||Cach Cach Icy Blooms Headband in Blue|,|A darling hair accessory, this new Cach Cach headband is in a soft, icy blue. The aqua blue headband stretches to fit her head comfortably. The single flower has a tulle bow found underneath and a beaded center! |,|$11.25$|,||,|CACH-CACH-ICY-BLOOMS-HEADBAND-BLUE|,|$URL$cach-cach-icy-blooms-headband-blue.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-icy-blooms-headband-in-blue-1.jpg||-||Cach Cach Infant Girls Dress in Blue|,|^|Matching several new CachCach arrivals, this icy blue infant dress is adorable! The skirt of the dress is covered with a ribbons of blue flower cut outs falling down from waist to hemline. A large flower sits off centered on her waistline and matches perfectly the one found on her bodice. The top of the dress is made with soft cotton and features a sleeveless neckline. Matching bloomers are worn beneath the dress. If you are looking to pair sisters together, be sure to look at the icy blue capri outfit! Cotton/spandex. Machine wash cold gentle cycle. SIZE 24 MOS ONLY LEFT.  ^||,|$49.00$|,||,|CACH-CACH-INFANT-GIRLS-DRESS-BLUE|,|$URL$cach-cach-infant-girls-dress-blue.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-infant-girls-dress-in-blue-17.jpg||-||Cach Cach Ivory Baby Blanket Cream Pie|,|In the same sweet ivory to match several of the new Cach Cach spring pieces, this baby blanket is both elegant and endearing. The soft cotton is inviting and comfortable on her delicate skin. The edges of the blanket are adorned with a flower textured ruffle that is made in sheer ivory. |,|$39.00$|,||,|CACH-CACH-IVORY-BABY-BLANKET-CREAM-PIE|,|$URL$cach-cach-ivory-baby-blanket-cream-pie.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-ivory-baby-blanket-cream-pie-1.jpg||-||Cach Cach Ivory Bowtique Girls Long Sleeve Dress|,|^|Ready for holiday photos or wedding celebrations, this new ivory girls dress comes from designer Cach Cach. The bodice features a warm cotton blend knit and an elastic black waist adorned with an off centered ivory flower. The long sleeves help keep her warm while the skirt is draped with rows of small rosettes. Pair with black tights and elegant patent leather shoes for a classic look! Machine washable. Deeply discounted due to small black mark on back of right arm. (1) SIZE 6X REMAINS. ^||,|$29.00$|,||,|CACH-CACH-IVORY-BOWTIQUE-GIRLS-LONG-SLEEVE-DRESS|,|$URL$cach-cach-ivory-bowtique-girls-long-sleeve-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-ivory-bowtique-girls-long-sleeve-dress-16.jpg||-||Cach Cach Ivory Flower Girl Dress with Bloomer|,|Created as a part of their spring and summer line, this new flower girls dress is sure to look darling as she spreads her petals. The sleeveless bodice has a wide neckline and a cute flower on the empire waist. The skirt has a perfect shape for twirling about. The sheer overlay falls with grace as the flower texture covers it. Matching solid bloomers are placed beneath the dress and have an elastic gathered hemline. |,|$49.00$|,||,|CACH-CACH-IVORY-FLOWER-GIRL-DRESS-BLOOMER|,|$URL$cach-cach-ivory-flower-girl-dress-bloomer.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-ivory-flower-girl-dress-with-bloomer-1.jpg||-||Cach Cach Leopard Print Hair Clip for Girls|,|^|Complimenting her new CachCach outfit, this fabulous hair accessory is a part of their ""Pleather Dots"" collection. This collection is filled with sweet pinks and leopard prints. This hair bow is accented with a tulle flower finished by a shimmering jewel center. Perfect for placing in her hair whether it is down or up! ^||,|$14.00$|,||,|CACH-CACH-LEOPARD-PRINT-HAIR-CLIP-GIRLS|,|$URL$cach-cach-leopard-print-hair-clip-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-leopard-print-hair-clip-for-girls-1.jpg||-||Cach Cach Little Girls Faux Fur Blanket in White|,| |,|$56.00$|,||,|CACH-CACH-LITTLE-GIRLS-FAUX-FUR-BLANKET-WHITE|,|$URL$cach-cach-little-girls-faux-fur-blanket-white.html|,|||-||Cach Cach Little Girls Vest in Ivory Faux Fur|,|^|Soft and stylish, this darling vest comes from Cach Cach and matches several other new pieces. The vest boasts of its fluffy faux fur that is covered with a textured pattern in elegant swirls. The satin lining slides easily over her clothes without bulking up. A large gem button closure is found at the neckline. Made in the USA. 100% polyester faux fur, machine washable. Tumble dry on low. SIZE 4T ONLY AVAILABLE. ^||,|$27.00$|,||,|CACH-CACH-LITTLE-GIRLS-VEST-IVORY-FAUX-FUR|,|$URL$cach-cach-little-girls-vest-ivory-faux-fur.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-little-girls-vest-in-ivory-faux-fur-3.jpg||-||Cach Cach Newborn Baby Gown in Blue|,|An icy sweet new arrival from designer CachCach, this fabulous baby girls gown is sure to be loved this spring and summer. The light blue gown boasts of an empire bodice in a soft, fitted cotton. A large tulle bow drapes down the skirt from the center of her waist, accented with a single matching flower. A button closes the back of the neckline. The long skirt is covered with flower punch outs creating a fun texture that stands out in photos. The hemline is gathered with an elastic band. A matching blue headband is also offered from Cach Cach which completes the look of this gown, don't forget to find it on the Cach Cach page! Cotton/spandex. Machine wash cold gentle cycle. |,|$39.00$|,||,|CACH-CACH-NEWBORN-BABY-GOWN-BLUE|,|$URL$cach-cach-newborn-baby-gown-blue.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-newborn-baby-gown-in-blue-1.jpg||-||Cach Cach Newborn Girls Couture Gown and Hat|,|Designed by Cach Cach, this pink baby girls gown is perfect for her first trip home from the hospital! The gown is wrapped with quaint ruffles of sheer fabric from shoulder to hem. The small cap sleeves almost resemble a sleeveless style while a large pink flower grows on the front. The tiny ruffles are covered with a pink leopard print pattern that is both wild and sweet. The elastic hemline is accented with ruffles of pink mesh. A matching hat comes with the gown as the same large flower sits off to one side! |,|$49.00$|,||,|CACH-CACH-NEWBORN-GIRLS-COUTURE-GOWN-HAT|,|$URL$cach-cach-newborn-girls-couture-gown-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-newborn-girls-couture-gown-and-hat-1.jpg||-||Cach Cach Newborn Take Me Home Oufit for Girls|,|A fun spring and summer time arrival, this new designer newborn gown comes from CachCach. The popular pink shade flirts with life as its covered with blooms, leaves, and chipper birdies. The front of this take home gown is striped with diagonal ruffles with a single candy pink tulle flower accent. The center of the flower is decorated with a large faux gem. The hemline stretches with elastic to help keep her feet bundled while a ruffle of pink tulle completes the look. The longer sleeves and light weight of the fabric are perfect for the season! This item comes with a matching hat! This outfit makes a perfect baby shower gift! Made with 100% polyester in the USA. Machine wash on delicate and tumble dry on low. |,|$46.50$|,||,|CACH-CACH-NEWBORN-TAKE-ME-HOME-OUTFIT-GIRLS|,|$URL$cach-cach-newborn-take-me-home-outfit-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-newborn-take-me-home-oufit-for-girls-18.jpg||-||Cach Cach Pink Baby Blanket Tea Rose|,|A sweet new design from CachCach, this cute baby girls blanket will make a splendid baby gift. The pink is always a loved color to welcome in a new princess into the world! The unique accents and trimmings are what set the CachCach blankets apart from others. CachCach makes their designs with quality fabric and care! You will not be disappointed! |,|$36.75$|,||,|CACH-CACH-PINK-BABY-BLANKET-TEA-ROSE|,|$URL$cach-cach-pink-baby-blanket-tea-rose.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-pink-baby-blanket-tea-rose-1.jpg||-||Cach Cach Pink Baby Romper for Girls|,|A light pink romper that suits spring, this baby girl outfit comes from Cach Cach. The straight neckline is complimented with an animal print ruffle and a single flower. Light pink straps are found on her shoulders and waving ribbons of ruffles run across the piece. Both legs are finished with the leopard print while only the right leg can boast of the rose pink flower. |,|$36.75$|,||,|CACH-CACH-PINK-BABY-ROMPER-GIRLS|,|$URL$cach-cach-pink-baby-romper-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-pink-baby-romper-for-girls-1.jpg||-||Cach Cach Pink Dress for Girls in Houndstooth|,| |,|$66.00$|,||,|CACH-CACH-PINK-DRESS-GIRLS-HOUNDSTOOTH|,|$URL$cach-cach-pink-dress-girls-houndstooth.html|,|||-||Cach Cach Pink Infant Take Me Home Outfit|,|A wave of wild style, this new designer baby gown comes from Cach Cach. The sleeveless gown is created with a light pink. Small ruffles wave across the gown. A brown leopard print accents the gown with three ruffles and the trimming on the neckline. Matching flowers are found on the front of the gown. The hemline gathers with elastic creating the perfect shape. A matching hat accompanies the gown and completes the outfit. |,|$49.00$|,||,|CACH-CACH-PINK-INFANT-TAKE-ME-HOME-OUTFIT|,|$URL$cach-cach-pink-infant-take-me-home-outfit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-pink-infant-take-me-home-outfit-1.jpg||-||Cach Cach Pink Leopard Print Baby Gown|,|Cach Cach is now offering this adorable baby girls take home gown as a part of their fall and winter line. The empire bodice has a single button keyhole that fastens at the back of her neckline while the long sleeves keep her safe from chilly air. The long skirt of the sac is covered in the small leopard print. A fabric flower sits on the center of her waistline upon a bow with long tails. The elastic hemline is dressed with a tulle ruffle with large polka dots. Cotton/Spandex Blend. Machine Wash in Cold Water. Tumble Dry Low. |,|$48.00$|,||,|CACH-CACH-PINK-LEOPARD-PRINT-BABY-GOWN|,|$URL$cach-cach-pink-leopard-print-baby-gown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-pink-leopard-print-baby-gown-1.jpg||-||Cach Cach Rockabye Baby Girls Tutu Dress|,|^|Created by designer Cach Cach, this new toddler and girls dress comes from the sassy and sweet collection, ""Rockabye Baby."" The bodice boasts of the infectious leopard spots and the long sleeves that promises to help block chilly air. The waist is adorned by two fuchsia bows while the skirt is overlayed with draping folds of ivory tulle. An ivory flower with a shimmering center rests upon a matching bow just beneath the neckline. Made with a cotton blend. Machine wash cold, tumble dry low. ^||,|$28.50$|,||,|CACH-CACH-ROCKABYE-BABY-GIRLS-TUTU-DRESS|,|$URL$cach-cach-rockabye-baby-girls-tutu-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-rockabye-baby-girls-tutu-dress-3.jpg||-||Cach Cach Sugar Baby Girls Dress|,|^|Almost an exact match to the younger style, this new girls dress was designed by CachCach. The ""Sugar Baby"" collection is personified by a white and pink ombre created from this fabulous, dainty fabric. The scallop tiers are finished with small fringe. The neckline is gathered slightly and framed by fun short sleeves. The duo of flower accents really pulls out the pink that is found closer to the hem of the dress while a shining center is found in the larger one. ^||,|$39.00$|,||,|CACH-CACH-SUGAR-BABY-GIRLS-DRESS|,|$URL$cach-cach-sugar-baby-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-sugar-baby-girls-dress-1.jpg||-||Cach Cach Sugar Baby Gown with Hat in Pink|,|^|About as darling as can be, this new designer baby girls gown is from Cach Cach's ""Sugar Baby"" collection for the spring. The cute gown features vintage inspiration with the scallop tiers in a fun ombre fading from white into pink. Two cute flowers sit in the center of the bodice and quaint cap sleeves frame the neckline. The gathered hem is draped with the same fun sheer fabric. A matching hat comes with the gown and features the same crochet pink flowers sitting just above the edge off to one side. ^||,|$39.00$|,||,|CACH-CACH-SUGAR-BABY-GOWN-HAT-PINK|,|$URL$cach-cach-sugar-baby-gown-hat-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-sugar-baby-gown-with-hat-in-pink-1.jpg||-||Cach Cach Summer Capri Outfit - Tropical Punch|,|Matching her younger sister's romper, Cach Cach is now offering this adorable tropical outfit. The sleeveless top has a smocked strap and a sweet bow found beneath the oversized flower. Ruffles run around the piece in the same blue and green storm. The hemline is ruffled with blue polka dot. The solid cotton leggings have an elastic waistline and a straight leg. Both legs are finished with the same sheer ruffle as the top. Polyester. Machine wash cold delicate. |,|$49.00$|,||,|CACH-CACH-SUMMER-CAPRI-OUTFIT-TROPICAL-PUNCH|,|$URL$cach-cach-summer-capri-outfit-tropical-punch.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-summer-capri-outfit-tropical-punch-1.jpg||-||Cach Cach Tropical Punch Baby Girls Romper|,|^|A punch of color, this baby girls romper is a gem from Cach Cach. The shades of greens and blues are blended for a tropical swirl. The smocked straps are wide while a large flower with a gem center hides the neckline. Waving ruffles run around the piece. The inseam has a row of changing snaps. This romper is sure to be unlike anything else you have seen! Polyester. Machine wash cold delicate. SIZE 0-3MOS ONLY LEFT.  ^||,|$38.25$|,||,|CACH-CACH-TROPICAL-PUNCH-BABY-GIRLS-ROMPER|,|$URL$cach-cach-tropical-punch-baby-girls-romper.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cach-cach-tropical-punch-baby-girls-romper-1.jpg||-||CachCach Baby Girl Gown Ruffled Rosettes|,| |,|$49.00$|,||,|CACHCACH-BABY-GIRL-GOWN-RUFFLED-ROSETTES|,|$URL$cachcach-baby-girl-gown-ruffled-rosettes.html|,|||-||CachCach Designer Infant Romper Girly Dots|,|^|Designer CachCach has created this adorable new baby girls romper as a part of their ""Pleather Dots"" collection for fall and winter. The romper is a perfect match the newborn gown so it makes a wonderful item to pair together in a baby shower gift. The light pink cotton allows slight stretch in its fit while a row of snaps line the inseam of her legs for easy changing. A touch of animal print fabric is found on the waistline along with a ribbon bow and tulle flower. The pleather polka dots dance upon the pink tulle overlay. Cotton/Spandex Blend. Machine Wash in Cold Water. Tumble Dry Low. ^||,|$54.00$|,||,|CACHCACH-DESIGNER-INFANT-ROMPER-GIRLY-DOTS|,|$URL$cachcach-designer-infant-romper-girly-dots.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cachcach-designer-infant-romper-girly-dots-1.jpg||-||CachCach Elegant Dress for Girls Lace Birthday|,| |,|$64.00$|,||,|CACHCACH-ELEGANT-DRESS-GIRLS-LACE-BIRTHDAY|,|$URL$cachcach-elegant-dress-girls-lace-birthday.html|,|||-||CachCach Elegant Little Girls Handbag|,| |,|$19.00$|,||,|CACHCACH-ELEGANT-LITTLE-GIRLS-HANDBAG|,|$URL$cachcach-elegant-little-girls-handbag.html|,|||-||CachCach Fancy Girls Top and Pants Outfit|,| |,|$69.00$|,||,|CACHCACH-FANCY-GIRLS-TOP-PANTS-OUTFIT|,|$URL$cachcach-fancy-girls-top-pants-outfit.html|,|||-||CachCach Flower Headband for Girls with Pearl Center|,| |,|$14.00$|,||,|CACHCACH-FLOWER-HEADBAND-GIRLS-PEARL-CENTER|,|$URL$cachcach-flower-headband-girls-pearl-center.html|,|||-||CachCach Frilly Girls Top and Pant|,| |,|$69.00$|,||,|CACHCACH-FRILLY-GIRLS-TOP-PANT|,|$URL$cachcach-frilly-girls-top-pant.html|,|||-||CachCach Girls Baby Blanket with Ruffle Trim|,| |,|$54.00$|,||,|CACHCACH-GIRLS-BABY-BLANKET-RUFFLE-TRIM|,|$URL$cachcach-girls-baby-blanket-ruffle-trim.html|,|||-||CachCach Girls Houndstooth Coat|,| |,|$48.00$|,||,|CACHCACH-GIRLS-HOUNDSTOOTH-COAT|,|$URL$cachcach-girls-houndstooth-coat.html|,|||-||CachCach Girls Pink Leopard Print Headband|,|Designed by Cach Cach this designer girls accessory is the final touch to a darling outfit. The headband has an easy stretch fit that is comfortable for her to wear all day long. Upon the headband we find a sweet pink leopard print bow. A sheer pink tulle flower sits in the center of the bow with a gem accent that catches the light. |,|$14.00$|,||,|CACHCACH-GIRLS-PINK-LEOPARD-PRINT-HEADBAND|,|$URL$cachcach-girls-pink-leopard-print-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cachcach-girls-pink-leopard-print-headband-1.jpg||-||CachCach Icy Blooms Girls Capri Outfit|,|A fun new piece, this infant and toddler girls dress was designed by Cach Cach. The swing top is sleeveless and can be layered easily beneath a light sweater if needed. A flower is found just beneath the neckline to match the one off centered on her waist. The skirt of the top is covered with those gorgeous flower cutouts that are irresistible. Matching cotton pants come with the top and are paired beneath. An elastic waist is a comfortable fit. The bell hem on both legs matches the top perfectly with the same cutouts! Cotton/spandex. Machine wash cold gentle cycle. |,|$59.00$|,||,|CACHCACH-ICY-BLOOMS-GIRLS-CAPRI-OUTFIT|,|$URL$cachcach-icy-blooms-girls-capri-outfit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cachcach-icy-blooms-girls-capri-outfit-1.jpg||-||CachCach Infant Girl Bubble in Pink and White|,|^|From Cach Cach, this new infant bubble dress is certain to gain many compliments and look splendid in photographs. The ombre piece fades from white into pink. Tiers of fabric are ended with a scallop fringe edge. The cute neckline is a ""U"" shape gathered with elastic. The fluttering cap sleeves are made with the same unique fabric. Two pink crochet flowers compliment the light pink found near the hemline. Hidden beneath the skirt are two bubbled legs complete with inseam snaps for changing. ^||,|$39.00$|,||,|CACHCACH-INFANT-GIRL-BUBBLE-PINK-WHITE|,|$URL$cachcach-infant-girl-bubble-pink-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cachcach-infant-girl-bubble-in-pink-and-white-1.jpg||-||CachCach Ivory Flower Girls Dress - Cream Pie|,|A gorgeous new girls dress, this fabulous arrival comes from Cach Cach. The empire bodice is a soft cotton boasting of a wide neckline. A pair of flowers is found just beneath the neck and the sleeveless shoulders are easy to pair with a light sweater. The long skirt is covered with the same sheer overlay seen on so many of the brilliant new pieces. The flower texture is completely unforgettable while a matching ivory lining is found underneath. Machine wash cold gentle cycle. Cotton/spandex. Machine wash cold gentle cycle. |,|$49.00$|,||,|CACHCACH-IVORY-FLOWER-GIRLS-DRESS-CREAM-PIE|,|$URL$cachcach-ivory-flower-girls-dress-cream-pie.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cachcach-ivory-flower-girls-dress-cream-pie-34.jpg||-||CachCach Ivory Hair Bow - Cream Pie|,|A hair accessory to go with her new CachCach dress, this fabulous accessory has undeniable charm. The flower has a trio of gems accenting in the center of the flower. A single tulle bow is found beneath the flower. All of the new ivory spring and summer pieces from designer Cach Cach are a glorious choice for any wedding. |,|$9.50$|,||,|CACHCACH-IVORY-HAIR-BOW-CREAM-PIE|,|$URL$cachcach-ivory-hair-bow-cream-pie.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cachcach-ivory-hair-bow-cream-pie-1.jpg||-||CachCach Ivory Headband - Cream Pie|,|Pairing with several new arrivals from Cach Cach, this little girls headband is elegant and sweet. The stretch headband has a comfortable fit around her head. The large ivory flower is accented with a shining center. A tulle bow creates the bed for the flower, off centered to one side of her head. This headband is made with a neutral color that can match with so many of her dresses and outfits! |,|$12.00$|,||,|CACHCACH-IVORY-HEADBAND-CREAM-PIE|,|$URL$cachcach-ivory-headband-cream-pie.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cachcach-ivory-headband-cream-pie-1.jpg||-||CachCach Little Girls Dress Leopard Dot|,|^|Joining several matching pieces for her younger sister, this new little girls dress from Cach Cach is part of the ""Pleather Dots"" collection. The dress has a relaxed fit that drapes gracefully from her sleeveless boat neckline. A single leopard bow is off centered on the neck and accented with a tulle flower and sparkling center. A small keyhole slit found on the back is closed with a single button. A trendy bubble hem finishes this dress perfectly. The tulle overlay is covered with large polka dots. Cotton/Spandex Blend. Machine Wash in Cold Water. Tumble Dry Low. ^||,|$68.00$|,||,|CACHCACH-LITTLE-GIRLS-DRESS-LEOPARD-DOT|,|$URL$cachcach-little-girls-dress-leopard-dot.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cachcach-little-girls-dress-leopard-dot-17.jpg||-||CachCach Little Girls Pink Cap|,| |,|$19.00$|,||,|CACHCACH-LITTLE-GIRLS-PINK-CAP|,|$URL$cachcach-little-girls-pink-cap.html|,|||-||CachCach Little Girls Top and Pant|,|A new designer outfit for your little girl, this arrival comes from Cach Cach, a beloved brand. The tunic top has an empire bodice with long sleeves. The waistline is defined in leopard spots while a cute bow and tulle flower sits off to one side with a glittering center. The skirt of the tunic features a sheer overlay that is covered in large polka dot accents. Matching animal print leggings are paired beneath. The cotton fabric allows slight stretch in their fit. Cotton/Spandex Blend. Machine Wash in Cold Water. Tumble Dry Low. |,|$68.00$|,||,|CACHCACH-LITTLE-GIRLS-TOP-PANT|,|$URL$cachcach-little-girls-top-pant.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cachcach-little-girls-top-and-pant-1.jpg||-||CachCach Pink Baby Gown with Hat|,|Cach Cach is now offering this pink baby girls gown for the spring season. The light pink gown has a solid cotton fabric bodice that is both delicate on her skin and has a single button keyhole on the back. The sleeveless neckline is accented with a waving trim. The empire waistline has a large rosette placed in the center upon a tulle bow. The long skirt features waves of pink ribbon falling down, speckled with textures of rosettes. The hemline finishes with a cute bubble shape! |,|$48.75$|,||,|CACHCACH-PINK-BABY-GOWN-HAT|,|$URL$cachcach-pink-baby-gown-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cachcach-pink-baby-gown-with-hat-1.jpg||-||CachCach Pink with Leopard Girls Outfit|,|A cute little swing set, this new arrival was designed by Cach Cach. The sleeveless neckline has a pull on fit. A ruffle of waves wrap around the top and the waistline is accented with leopard spots. The skirting of the top matches the top perfectly. A solid pair of cotton pants are worn beneath. The bell hems are dressed with two sweet bows. Polyester. Machine wash cold delicate. |,|$39.00$|,||,|CACHCACH-PINK-LEOPARD-GIRLS-OUTFIT|,|$URL$cachcach-pink-leopard-girls-outfit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/cachcach-pink-with-leopard-girls-outfit-1.jpg||-||CachCach White Flower Baby Gown|,| |,|$46.00$|,||,|CACHCACH-WHITE-FLOWER-BABY-GOWN|,|$URL$cachcach-white-flower-baby-gown.html|,|||-||CachCach Winter Hat for Little Girls|,| |,|$24.00$|,||,|CACHCACH-WINTER-HAT-LITTLE-GIRLS|,|$URL$cachcach-winter-hat-little-girls.html|,|||-||Chichanella Bella Beachside Beauty Girls Tankini|,|^|Your little beauty will adore this two piece swimsuit from Chichanella Bella. She'll be stylin' beachside in this pink and white tankini style suit. The pink top is adorned with ruffled straps that cross over at the back. A ruffled yoke adorns the front. The bottom is beautifully garnished with apron style panels on each side in pink dot with ruffled edges. The pink legs are banded with the same pink dot. An adorable matching bonnet is sold separately. Made in the USA. Made from polyester/spandex. Hand wash cold, hang or lay flat to dry. SIZE 3T ONLY AVAILABLE.  ^||,|$54.00$|,||,|CHICHANELLA-BELLA-BEACHSIDE-BEAUTY-GIRLS-TANKINI|,|$URL$chichanella-bella-beachside-beauty-girls-tankini.html|,|http://ep.yimg.com/ay/yhst-17102259411242/chichanella-bella-beachside-beauty-girls-tankini-16.jpg||-||Chichanella Bella Brown Swimsuit Summer of Love|,|Created for the original and unique, this fabulous girls swimsuit comes from the vintage inspired brand, Chichanella Bella. The top is covered with tiers of ruffles that alternate between solid brown and a floral print. The thin straps create a square shaped neckline. The matching bottoms have the same floral on the waist and creating a heart shaped applique on her left leg. The bell hem on both legs is also introduced with the patterned fabric and ruffles around her legs. |,|$72.00$|,||,|CHICHANELLA-BELLA-BROWN-SWIMSUIT-SUMMER-OF-LOVE|,|$URL$chichanella-bella-brown-swimsuit-summer-of-love.html|,|http://ep.yimg.com/ay/yhst-17102259411242/chichanella-bella-brown-swimsuit-summer-of-love-12.jpg||-||Chichanella Bella Cabana Cutie One Piece Girls Swim Suit|,|A vintage inspired swimsuit, this new arrival comes from Chichanella Bella. The one piece suit is cut in a romper style that offers her longer shorts for a more modest look. The light colored stripes run around the entire piece while the sweet neckline is accented with ruffles. Three flowers are found front and center while the straps criss cross on her back. A small ruffle finishes off the hem of both legs. |,|$68.00$|,||,|CHICHANELLA-BELLA-CABANA-CUTIE-ONE-PIECE-GIRLS-SWIM-SUIT|,|$URL$chichanella-bella-cabana-cutie-one-piece-girls-swim-suit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/chichanella-bella-cabana-cutie-one-piece-girls-swim-suit-12.jpg||-||Chichanella Bella Diving Daisy Two Piece Swimsuit|,|^|This delightful swimsuit is from designer Chichanella Bella and will make her the star of the beach or pool. The yellow top boasts of its squared neckline, puffy sleeves and large pink patterned rosette in the center. Pink and white gingham ruffles adorn all of the edges. The bottom features decorative panels on the sides with ruffles of pink gingham. The pink gingham is repeated at the waist with a small rosette on each hip. A matching bonnet is sold separately. Made in the USA. Made from polyester/spandex. Hand wash cold, hang or lay flat to dry. SIZE 12 MOS ONLY LEFT. ^||,|$72.00$|,||,|CHICHANELLA-BELLA-DIVING-DAISY-TWO-PIECE-SWIMSUIT|,|$URL$chichanella-bella-diving-daisy-two-piece-swimsuit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/chichanella-bella-diving-daisy-two-piece-swimsuit-20.jpg||-||Chichanella Bella Girls Pixy Stix Swimsuit|,|^|A sweet and sassy vintage look just for her from Chichanella Bella. The ruffled off the shoulder style bodice of this green suit features spaghetti straps and a double ruffle trimmed in deep pink. The leg openings are adorned with ruffles trimmed in deep pink as well. A bonnet made to match is sold as a separate. Made in the USA. SIZE 2T ONLY REMAINING.  ^||,|$68.00$|,||,|CHICHANELLA-BELLA-GIRLS-PIXY-STIX-SWIMSUIT|,|$URL$chichanella-bella-girls-pixy-stix-swimsuit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/chichanella-bella-girls-pixy-stix-swimsuit-15.jpg||-||Chichanella Bella Licorice Twist Vintage Girls Swimsuit|,|^|A glamorous new designer swimsuit for girls, this Chichanella Bella tankini is filled to the brim with charm. The top has ruffled straps set apart for a wide, square neckline. A stripe of white runs down the front and is presented with two matching bows. The matching shorts offer more privacy than tradition swimsuits. The front of both legs are decorated with the same accents while all hemlines are bedecked by quaint ruffles. SIZE 2T ONLY LEFT. ^||,|$66.00$|,||,|CHICHANELLA-BELLA-LICORICE-TWIST-VINTAGE-GIRLS-SWIMSUIT|,|$URL$chichanella-bella-licorice-twist-vintage-girls-swimsuit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/chichanella-bella-licorice-twist-vintage-girls-swimsuit-1.jpg||-||Chichanella Bella Mary Jane Two Piece in Black|,|A unique girls swimsuit, this new arrival comes from designer Chichanella Bella. The top has a straight fit and offers a wide neckline framed with ruffle accented straps. The front is gathered in the center beneath the row of buttons. A matching ruffle is found on the hem. The matching bottoms are a high-waist fit. Three buttons are placed in the front and stitching to create the look of pockets is found on the bottom. The look is finished off with one last ruffle! |,|$72.00$|,||,|CHICHANELLA-BELLA-MARY-JANE-TWO-PIECE-BLACK|,|$URL$chichanella-bella-mary-jane-two-piece-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/chichanella-bella-mary-jane-two-piece-in-black-12.jpg||-||Chichanella Bella Seaside Retreat Girls Swimsuit|,|^|From designer Chichanella Bella, this new designer girls swimsuit is unlike anything else she will see at the poolside. The suit is covered with a quaint flower print. The ""V"" neckline is adorned with a bow found both in the front and on the back. A touch of blue decoration runs down the front and back to a bow on the scallop hemline. The high waist bottoms are in the boy short style with ruffles that wrap around the back. SIZE 2T AND 4 ONLY LEFT.  ^||,|$72.00$|,||,|CHICHANELLA-BELLA-SUNKISSED-SWEETHEART-GIRLS-SWIMSUIT|,|$URL$chichanella-bella-sunkissed-sweetheart-girls-swimsuit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/chichanella-bella-seaside-retreat-girls-swimsuit-1.jpg||-||Chichanella Bella Swimwear Lovebug Lucy One Piece Suit|,|An adorable vintage style, this new designer girls swimsuit comes from the charming Chichanella Bella brand. The red suit features an empire bodice that is accented with scallop trimming on the square neckline and the straps. A small bow is found in the center while two tucks run down the front. The boy short bottoms are filled with a timeless look and are ruffled by a touch of blue. This new swimsuit is perfect for any summer celebration! |,|$72.00$|,||,|CHICHANELLA-BELLA-SWIMWEAR-LOVEBUG-LUCY-ONE-PIECE-SUIT|,|$URL$chichanella-bella-swimwear-lovebug-lucy-one-piece-suit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/chichanella-bella-swimwear-lovebug-lucy-one-piece-suit-1.jpg||-||Chichanella Bella Vintage Girls Swimsuit Polka Dot|,|Designer Chichanella Bella fills their designs with a style that comes from a vintage inspiration. The black bandeaux top is covered in a black and white polka dot print. The thin halter strap is tied in a bow behind her neck. The center of the top is gathered with a draw string that is tied at the hemline. The matching bottoms are long shorts covered with the same pattern. A single white ruffle is found at the hem of both legs. |,|$68.00$|,||,|CHICHANELLA-BELLA-VINTAGE-GIRLS-SWIMSUIT-POLKA-DOT|,|$URL$chichanella-bella-vintage-girls-swimsuit-polka-dot.html|,|http://ep.yimg.com/ay/yhst-17102259411242/chichanella-bella-vintage-girls-swimsuit-polka-dot-12.jpg||-||Classy Baby Amber Infant Flower Headband in White|,|Perfection from Classy Baby, this infant girls headband is pure white and stunning. The nylon stretch headband of white plays host to a white flower. The curling petals are accented with shimmery tulle petals. A circle of jewel accents shine from the center of the flower. ALL SOLD OUT 6/14/13.  |,|$17.00$|,||,|CLASSY-BABY-AMBER-INFANT-FLOWER-HEADBAND-WHITE|,|$URL$classy-baby-amber-infant-flower-headband-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-amber-infant-flower-headband-in-white-11.jpg||-||Classy Baby Angelica Aqua Flower Clip|,|From Classy Baby, this girls hair clip is just the right touch for her spring outfits. The blue petals get smaller towards the center. Wispy petals of aqua tulle are tucked between the satin petals. Faux pearl beads are nestled between the smaller petals at the center. Attaches to her hair with an alligator style clip. |,|$16.00$|,||,|CLASSY-BABY-ANGELICA-AQUA-FLOWER-CLIP|,|$URL$classy-baby-angelica-aqua-flower-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-angelica-aqua-flower-clip-13.jpg||-||Classy Baby Angelica Bubblegum Pink Flower Clip|,|^|With its fun color this new girls hair clip was designed by Classy Baby. The satin petals curl from the edges while the beaded center compliments the bubblegum pink. Measures 3"" and placed upon a pinch clip. ^||,|$16.00$|,||,|CLASSY-BABY-ANGELICA-BUBBLEGUM-PINK-FLOWER-CLIP|,|$URL$classy-baby-angelica-bubblegum-pink-flower-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-angelica-bubblegum-pink-flower-clip-12.jpg||-||Classy Baby Angelica Coral Flower Hair Clip|,|Beautiful with any kind of outfit, this girls flower clip comes from Classy Baby. The deep coral satin sheen and is complimented by the pearl center. Each petal curls at the edge from the heat seal while a bit of tulle hides between layers. The pinch alligator clip is easy to use. |,|$16.00$|,||,|CLASSY-BABY-ANGELICA-CORAL-FLOWER-HAIR-CLIP|,|$URL$classy-baby-angelica-coral-flower-hair-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-angelica-coral-flower-hair-clip-12.jpg||-||Classy Baby Angelica Flower Clip in Yellow|,|^|New from Classy Baby, this girls hair clip is undeniably cute! The radiant yellow petals boast of their curled edges and satin sheen while the pearl bead center creates the perfect final touch. Measuring about 3"" in diameter, this flower is placed on an alligator hair clip and is easy to use. ONLY (1) REMAINING.  ^||,|$16.00$|,||,|CLASSY-BABY-ANGELICA-FLOWER-CLIP-YELLOW|,|$URL$classy-baby-angelica-flower-clip-yellow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-angelica-flower-clip-in-yellow-12.jpg||-||Classy Baby Angelica Flower Clip Light Yellow|,|A sunny selection, this girls hair clip is fresh for the season from Classy Baby. Sunny light yellow petals with curling edges surround a pearl like center for a stunning look. Wispy petals of tulle are tucked in amongst the satin petals. The flower is attached to an alligator style clip. |,|$16.00$|,||,|CLASSY-BABY-ANGELICA-FLOWER-CLIP-LIGHT-YELLOW|,|$URL$classy-baby-angelica-flower-clip-light-yellow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-angelica-flower-clip-light-yellow-10.jpg||-||Classy Baby Angelica Flower Headband in Red|,|An adorable new arrival from designer Classy Baby, this little girls headband is truly a delight! The stretchy headband is soft on her head and boasts of its rich red shade. The satin flower is made with petals that whisically twist from their heat-applied edges. The center is adorned with a garden of pearl beads. |,|$18.00$|,||,|CLASSY-BABY-ANGELICA-FLOWER-HEADBAND-RED|,|$URL$classy-baby-angelica-flower-headband-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-angelica-flower-headband-in-red-12.jpg||-||Classy Baby Angelica Flower Little Girls Headband in Leopard|,|^|Fitting a wide range of ages, this new arrival in our accessory department comes from the loved Classy Baby. The single flower is one of their most popular styles named ""Angelica."" This design boasts of curled satin petals with heat treated edges and a small touch of matching tulle. At the center we find pearl pollen to really set it apart. The elastic band is decorated by a sheer leopard print ribbon that ruffles slightly. Sure to look great with any of your new fall outfits! ^||,|$18.00$|,||,|CLASSY-BABY-FLOWER-LITTLE-GIRLS-HEADBAND-LEOPARD|,|$URL$classy-baby-flower-little-girls-headband-leopard.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-angelica-flower-little-girls-headband-in-leopard-2.jpg||-||Classy Baby Angelica Satin Red Flower Clip|,|^|Arriving in time for all holiday festivities, Classy Baby is now offering their Angelica flower clip in red. The satin petals shorten in the middle and curl from the edges. A touch of tulle makes the center pop out with the ring of beads. 3"" in diameter, placed upon an alligator clip. ^||,|$16.00$|,||,|CLASSY-BABY-ANGELICA-SATIN-RED-FLOWER-CLIP|,|$URL$classy-baby-angelica-satin-red-flower-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-angelica-satin-red-flower-clip-13.jpg||-||Classy Baby Angelica Silver Flower Clip|,|^|Precious placed in her hair, this new girls hair clip comes from Classy Baby. Silver satin petals with individual curl and matching tulle to make the center pop out. Measures roughly 3"" with a beaded center. ^||,|$16.00$|,||,|CLASSY-BABY-ANGELICA-SILVER-FLOWER-CLIP|,|$URL$classy-baby-angelica-silver-flower-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-angelica-silver-flower-clip-13.jpg||-||Classy Baby Bubblegum Pink Infant Headband|,|For your new baby girl, this adorable hair band was designed by Classy Baby. The light pink satin shines in the light while folded layers create a fabulous texture for each petal. The edges are heat treated for a lasting effect. The thin band stretches around her head to take its place as a crown upon her head. A group of ivory beads is found at the center of the flower. |,|$12.00$|,||,|CLASSY-BABY-BUBBLEGUM-PINK-INFANT-HEADBAND|,|$URL$classy-baby-bubblegum-pink-infant-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-bubblegum-pink-infant-headband-1.jpg||-||Classy Baby Dusty Rose Handmade Hairbow|,|A unique hair accessory unlike the rest, this new piece was designed by Classy Baby. The handmade hair bow features fun petals that are layered with matching sheer fabric. The center of the flower is decorated with a few pearlized beads. The bloom is placed upon the thin band that stretches for an easy fit. This flower hair band is sure to complete the style of her look! |,|$16.00$|,||,|CLASSY-BABY-DUSTY-ROSE-HANDMADE-HAIRBOW|,|$URL$classy-baby-dusty-rose-handmade-hairbow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-dusty-rose-handmade-hairbow-1.jpg||-||Classy Baby Fuchsia Large Rosette Headband|,|Classy Baby is now offering this wonderful fuchsia pink headband. The satin petals create a really glamorous look to the piece with its rich shade and the edges that have a slight curl from the heat seal. The pearl beads are found in the center to complete the look. The headband stretches for a great, individual fit. |,|$19.00$|,||,|CLASSY-BABY-FUCHSIA-LARGE-ROSETTE-HEADBAND|,|$URL$classy-baby-fuchsia-large-rosette-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-fuchsia-large-rosette-headband-1.jpg||-||Classy Baby Fuchsia Satin Angelica Flower Clip|,|From designer Classy Baby, this girls flower hair clip is rich and color and sure to gain compliments. The deep fuchsia flower boasts of curling petals and that satin shine. The bead center features a pearl look, placed upon an alligator clip. |,|$16.00$|,||,|CLASSY-BABY-FUCHSIA-SATIN-ANGELICA-FLOWER-CLIP|,|$URL$classy-baby-fuchsia-satin-angelica-flower-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-fuchsia-satin-angelica-flower-clip-12.jpg||-||Classy Baby Girls Double Bow Headband in Black|,|^|Adorned with a large double bow, this new little girls headband from Classy Baby is a cozy fit. The soft band stretches to fit around her head. The bow measures roughly 3"" across. Fits most infants and toddlers. ^||,|$13.00$|,||,|CLASSY-BABY-GIRLS-BOW-HEADBAND-BLACK|,|$URL$classy-baby-girls-bow-headband-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-girls-double-bow-headband-in-black-10.jpg||-||Classy Baby Girls Double Bow Headband in Fuchsia|,|^|Like a bow wrapping up a very precious gift, this new little girls headband stretches to wrap around her head. The soft band is adorned by a large fuchsia ribbon bow measuring roughly 3"" in length. Fits most infants and toddlers. ^||,|$13.00$|,||,|CLASSY-BABY-GIRLS-BOW-HEADBAND-FUCHSIA|,|$URL$classy-baby-girls-bow-headband-fuchsia.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-girls-double-bow-headband-in-fuchsia-11.jpg||-||Classy Baby Girls Hairbow in Lilac|,|Classy Baby has created this gorgeous new girls hair bow. The thin headband is an easy stretch fit. The lilac satin petals have a cute curl given by their heat sealed edges. A touch of sheer fabric is layered into the piece, adding texture. The flower is placed upon the thin band and is meant to be worn off to one side. |,|$16.00$|,||,|CLASSY-BABY-GIRLS-HAIRBOW-LILAC|,|$URL$classy-baby-girls-hairbow-lilac.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-girls-hairbow-in-lilac-1.jpg||-||Classy Baby Girls Headband in Bubblegum Pink|,|A gorgeous new accessory, this flower headband comes from Classy Baby. The flower is a whimsical design with bubblegum pink satin petals and edges sealed with heat. The flower is sure to look fabulous with her favorite outfits this season! The bloom is placed upon a headband that stretches for a great fit. |,|$19.00$|,||,|CLASSY-BABY-GIRLS-HEADBAND-BUBBLEGUM-PINK|,|$URL$classy-baby-girls-headband-bubblegum-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-girls-headband-in-bubblegum-pink-1.jpg||-||Classy Baby Girls Peach Hair Clip Angelica Flower|,|A beautiful, delicate finish that is sure to look darling amongst her locks, this new hair clip comes from Classy Baby. The soft peach tone compliments the popular colors for this fall while a bit of tulle texture is found inbetween petals. The curl of the petals is a natural result of the heat trimmed edges. Attached to an alligator clip and finished with a cute pearl center, this flower really is a gem. |,|$15.00$|,||,|CLASSY-BABY-GIRLS-PEACH-HAIR-CLIP-ANGELICA-FLOWER|,|$URL$classy-baby-girls-peach-hair-clip-angelica-flower.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-girls-peach-hair-clip-angelica-flower-10.jpg||-||Classy Baby Girls Satin Bow Headband in Fuchsia|,|^|Princess pink, this new little girls headband is the perfect accessory to add color to any outfit. The sheer ruffled band stretches around her head and boasts of its candy pink satin bow sitting on top measuring roughly 2.5"" Fits most infants and toddlers. ^||,|$9.00$|,||,|CLASSY-BABY-GIRLS-SATIN-BOW-HEADBAND-FUCHSIA|,|$URL$classy-baby-girls-satin-bow-headband-fuchsia.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-girls-satin-bow-headband-in-fuchsia-13.jpg||-||Classy Baby Girls Satin Bow Headband in White|,|^|Classy Baby is now offering this white satin girls headband. Sitting atop an elastic band accented with sheer white ribbon ruffle is a shiny sating bow measuring roughly over 2"" long. Fits most infants and toddlers. ^||,|$9.00$|,||,|CLASSY-BABY-GIRLS-SATIN-BOW-HEADBAND-WHITE|,|$URL$classy-baby-girls-satin-bow-headband-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-girls-satin-bow-headband-in-white-10.jpg||-||Classy Baby Gray Rosette Headband|,|Designed with love by Classy Baby, this new designer girls headband is a wonderful addition to her outfit. The fabulous petals on this bloom is created with silver satin completed with heat finished edges. A group of pearl beads is placed in the center of the flower to finish the look beautifully. This adorable design is placed upon a headband that stretches for custom fit. |,|$19.00$|,||,|CLASSY-BABY-GRAY-ROSETTE-HEADBAND|,|$URL$classy-baby-gray-rosette-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-gray-rosette-headband-1.jpg||-||Classy Baby Handmade White Headband|,|An oversized beauty, this new designer hair accessory comes from Classy Baby. The flower is created with white satin petals finished with a heat sealed edges. The stretch headband is a comfortable fit. To finish off this look with their classic signature, a group of pearl beads are found in the center. |,|$19.00$|,||,|CLASSY-BABY-HANDMADE-WHITE-HEADBAND|,|$URL$classy-baby-handmade-white-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-handmade-white-headband-1.jpg||-||Classy Baby Hot Pink Angelica Flower Clip|,|She'll be precious in this hot pink girls hair clip from Classy Baby. Pink petals curl at the edges and reduce in size towards the center. A large pearl like bead is surrounded by smaller beads to create a beautiful center. Tulle petals are tucked in for added effect. The flower is placed on an alligator style clip. |,|$16.00$|,||,|CLASSY-BABY-HOT-PINK-ANGELICA-FLOWER-CLIP|,|$URL$classy-baby-hot-pink-angelica-flower-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-hot-pink-angelica-flower-clip-10.jpg||-||Classy Baby Hot Pink Rosette Headband|,|The large flower is a bright hot pink for this fabulous new accessory from Classy Baby. Also available in other colors, this designer accessory sets off to one side and had a truly glamorous look. The center is accented with a group of beading. The comfortable headband stretches for fit while it is in a coordinating shade of pink. |,|$19.00$|,||,|CLASSY-BABY-HOT-PINK-ROSETTE-HEADBAND|,|$URL$classy-baby-hot-pink-rosette-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-hot-pink-rosette-headband-1.jpg||-||Classy Baby Infant Girls Headband Black Satin Bow|,|^|Perfect for her photo debut or to compliment most any outfit, this new infant headband comes from Classy Baby. The black stretch headband features a velvet ribbon while the double satin bow sits off to one side of her head. The bow measures just over 3"" in length. ^||,|$9.00$|,||,|CLASSY-BABY-INFANT-GIRLS-HEADBAND-BLACK-SATIN-BOW|,|$URL$classy-baby-infant-girls-headband-black-satin-bow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-infant-girls-headband-black-satin-bow-12.jpg||-||Classy Baby Ivory Handmade Headband|,|A glamorous hair accessory, this new design is sure to be loved! This full and elegant hair accessory created with layers and layers of ivory petals curled towards the center. The bloom boasts of its shimmering center created with a blend of gems and pearl beads in a gorgeous design. The neutral ivory shade is sure to coordinate with almost any of her fabulous boutique outfits. |,|$19.00$|,||,|CLASSY-BABY-IVORY-HANDMADE-HEADBAND|,|$URL$classy-baby-ivory-handmade-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-ivory-handmade-headband-1.jpg||-||Classy Baby Ivory Newborn Headband|,|Sure to be the crown of her fabulous outfits, this infant headband comes from Classy Baby. The smooth ivory petals are created by folds while the flower is attached to the thin, stretch band. The raw edges are sealed with heat giving a playful waves. Check out all of the other fabulous Classy Baby headbands to have an accessory for every outfit! |,|$12.00$|,||,|CLASSY-BABY-IVORY-NEWBORN-HEADBAND|,|$URL$classy-baby-ivory-newborn-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-ivory-newborn-headband-1.jpg||-||Classy Baby Large Flower Light Pink Headband|,|Classy Baby designed this glorious new hair accessory. Light pink petals come together to form this oversized flower that sits off to one side of her head. The large bloom sits upon a stretch band that fits her head comfortably. This shade of pink is sure to match many of her outfits and bring an elegant, feminine touch. |,|$19.00$|,||,|CLASSY-BABY-LARGE-FLOWER-LIGHT-PINK-HEADBAND|,|$URL$classy-baby-large-flower-light-pink-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-large-flower-light-pink-headband-1.jpg||-||Classy Baby Light Pink Infant Girls Headband|,|Created by Classy Baby, this new infant headband is certainly darling. The stretch band is thin and dainty creating a feminine quality. The flower is designed through layers of classic fabric. The pearl, ivory beads that decorate the center are the perfect finish to this design. The light shade of pink is sure to look great with many of her new outfits! The headband is available in other colors as well! |,|$12.00$|,||,|CLASSY-BABY-LIGHT-PINK-INFANT-GIRLS-HEADBAND|,|$URL$classy-baby-light-pink-infant-girls-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-light-pink-infant-girls-headband-1.jpg||-||Classy Baby Lime Angelica Satin Flower Clip|,|A unique new hair accessory, this girls flower clip comes from designer Classy Baby. The lime satin petals shorten towards the center and curl at their edges. Detailed touches like a bit of tulle and a pearl bead center are what make this piece so great. Attached to a pinch clip. |,|$16.00$|,||,|CLASSY-BABY-LIME-ANGELICA-SATIN-FLOWER-CLIP|,|$URL$classy-baby-lime-angelica-satin-flower-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-lime-angelica-satin-flower-clip-12.jpg||-||Classy Baby Lime Green Angelica Flower Infant Headband|,|This beautiful creation in lime is from Classy Baby. The infant girls headband is done in trendy lime green nylon. The attached flower is of a lighter shade of green. Satiny petals curl at the edges and are smaller towards the center. Faux pearl beads are used to create a circular center. Tulle petals are tucked amongst the petals. |,|$18.00$|,||,|CLASSY-BABY-LIME-GREEN-ANGELICA-FLOWER-INFANT-HEADBAND|,|$URL$classy-baby-lime-green-angelica-flower-infant-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-lime-green-angelica-flower-infant-headband-13.jpg||-||Classy Baby Mint Handmade Headband|,|A cool mint green, Classy Baby is now offering this wonderful flower headband. The gorgeous flower is layered with curled petals finished with a heat seal. The center is adorned with gems and pearl beads. The bloom is placed upon a great band with an elastic stretch.. This color is hot for the season. |,|$19.00$|,||,|CLASSY-BABY-MINT-HANDMADE-HEADBAND|,|$URL$classy-baby-mint-handmade-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-mint-handmade-headband-1.jpg||-||Classy Baby Navy Angelica Flower Clip|,|^|In a deep navy blue, this new girls flower clip comes from Classy Baby. The satin petals curl at the edge and sheen in the light. A grouping of pearl beads adorn the center. The flower measures about 3"" and is on a pinch hair clip. SOLD OUT ALL 2/11/14 ^||,|$16.00$|,||,|CLASSY-BABY-NAVY-ANGELICA-FLOWER-CLIP|,|$URL$classy-baby-navy-angelica-flower-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-navy-angelica-flower-clip-13.jpg||-||Classy Baby Navy Angelica Flower Headband|,|^|Welcoming fall with cute accessories, this new Classy Baby headband is also available as a clip or in other colors. The soft stretch headband is designed to comfortably fit her head while the satin flower is the real star of the show. The curled satin petals and layer of tulle are complimented with an ivory pearl center. (1) ONLY LEFT.  ^||,|$18.00$|,||,|CLASSY-BABY-NAVY-ANGELICA-FLOWER-HEADBAND|,|$URL$classy-baby-navy-angelica-flower-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-navy-angelica-flower-headband-13.jpg||-||Classy Baby Newborn Headband in Gray|,|In charcoal, this new girls accessory is a real gem from Classy Baby. The headband is a comfortable stretch fit with its thin band. The gray flower is layered with the same shade all the way through while the edges are finished with a touch of heat. The center is a gorgeous cap to the piece with its cluster of pearl beads. Pair this peace with almost any outfit in her wardrobe! |,|$12.00$|,||,|CLASSY-BABY-NEWBORN-HEADBAND-GRAY|,|$URL$classy-baby-newborn-headband-gray.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-newborn-headband-in-gray-1.jpg||-||Classy Baby Newborn Headband in Mint|,|A hot color for the season, this fabulous mint headband is a highlight of the new arrivals from Classy Baby. The dainty, thin stretch band has a comfortable fit on her head. Attached to this band is a lovely and beautiful flower. The crisp color is cool as can bee while the petals are created in layers completed by the heat treated edges. The center of the flower is graced with small, pearlized beads that are grouped together carefully. Everyone is sure to fall in love with this accessory. |,|$12.00$|,||,|CLASSY-BABY-NEWBORN-HEADBAND-MINT|,|$URL$classy-baby-newborn-headband-mint.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-newborn-headband-in-mint-1.jpg||-||Classy Baby Pink Tones Girls Headband|,|In fabulous, pretty pink, this new designer hair accessory comes from Classy Baby. This flower is constructed with multiple layers which alternate between the rich fuchsia and the soft, light pink. The flower is created to sit off centered to one side while the fit is assisted with a stretch band. Pearl beads are accenting the center of the flower. |,|$19.00$|,||,|CLASSY-BABY-PINK-TONES-GIRLS-HEADBAND|,|$URL$classy-baby-pink-tones-girls-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-pink-tones-girls-headband-1.jpg||-||Classy Baby Purple Girls Hairbow with Pearl Accents|,|The color of royalty, this girls headband from Classy Baby is one she can wear again and again! The rich purple satin creates the whimsical flower petals while completed with heat treated edges. The decorated center is filled with pearl beads. Whether she is an every day glamorous or dressing to the nines, this fabulous hair accessory will suit her well! |,|$16.00$|,||,|CLASSY-BABY-PURPLE-GIRLS-HAIRBOW-PEARL-ACCENTS|,|$URL$classy-baby-purple-girls-hairbow-pearl-accents.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-purple-girls-hairbow-with-pearl-accents-1.jpg||-||Classy Baby Red Infant Headband|,|Accessorizing her fabulous new wardrobe, this designer infant headband comes from Classy Baby. The thin headband stretches to fit comfortably in a neutral white. The flower is designed with layers of folded red satin to create the petals. The edges are heat treated for a finished look while small pearl beads are gathered at the center to complete the look. |,|$12.00$|,||,|CLASSY-BABY-RED-INFANT-HEADBAND|,|$URL$classy-baby-red-infant-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-red-infant-headband-1.jpg||-||Classy Baby Royal Blue Angelica Flower Clip|,|Fit for your princess, this royal blue girls hair clip comes from designer Classy Baby. The clip boasts of large flower with curling petals in royal blue. The petals reduce in size towards the center and are accented with petals of tulle. A pearlescent beaded center really stands out against the royal blue. An alligator style clip is used to attach it to her hair. |,|$16.00$|,||,|CLASSY-BABY-ROYAL-BLUE-ANGELICA-FLOWER-CLIP|,|$URL$classy-baby-royal-blue-angelica-flower-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-royal-blue-angelica-flower-clip-14.jpg||-||Classy Baby Satin Orange Angelica Flower Clip|,|^|Adding a vibrant color to her favorite outfits, this new flower hair clip is now available from Classy Baby. The satin petals sheen and curl from the edges while a grouping of beads adorn the center. A small layer of tulle is found between layers. 3"" in diameter, attached to a pinch alligator clip. ^||,|$16.00$|,||,|CLASSY-BABY-SATIN-ORANGE-ANGELICA-FLOWER-CLIP|,|$URL$classy-baby-satin-orange-angelica-flower-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-satin-orange-angelica-flower-clip-12.jpg||-||Classy Baby Shades of Pink Infant Headband|,|Hitting upon the ombre trend, this new infant headband comes from Classy Baby. The flower is created with layers of shiny pink material formed into four petals. The lower layers begin at a rich fuchsia while the middle is the perfect transition into the light pink top. The center of the flower is adorned with ivory beads. |,|$12.00$|,||,|CLASSY-BABY-SHADES-OF-PINK-INFANT-HEADBAND|,|$URL$classy-baby-shades-of-pink-infant-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-shades-of-pink-infant-headband-1.jpg||-||Classy Baby White Angelica Flower Hair Clip|,|Sure to become a staple in her accessorizing, this new girls flower clip from from Classy Baby. The white satin petals curl from their heat sealed edges while the shorter center petals draw attention to the bead center. The pinch alligator clip is easy to use. |,|$16.00$|,||,|CLASSY-BABY-WHITE-ANGELICA-FLOWER-HAIR-CLIP|,|$URL$classy-baby-white-angelica-flower-hair-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-white-angelica-flower-hair-clip-12.jpg||-||Classy Baby White Infant Headband|,|From designer Classy Baby, this darling hair accessory is sure to be loved. The white satin flower is shiny and pristine while all of the raw edges have been treated with heat to seal and protect from fraying. The thin headband stretches around her head with a dainty look. The small, ivory beads are clustered together at the center of this sweet flower. |,|$12.00$|,||,|CLASSY-BABY-WHITE-INFANT-HEADBAND|,|$URL$classy-baby-white-infant-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-white-infant-headband-1.jpg||-||Classy Baby White Rosette Bow Headband for Girls|,|A perfect unique accessory for the holidays, this new girls headband comes from designer Classy Baby. The hard headband is wrapped with satin ribbon while the oversized bow sits off to one side. Cute little rosettes make up the bow while the crystal center is an elegant finish. |,|$19.00$|,||,|CLASSY-BABY-WHITE-ROSETTE-BOW-HEADBAND-GIRLS|,|$URL$classy-baby-white-rosette-bow-headband-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/classy-baby-white-rosette-bow-headband-for-girls-10.jpg||-||Coastal Projections Black Holiday Shoes for Girls with Bows|,|The lovely black holiday shoes by Coastal Projections are just what she needs this holiday season! The gorgeous little girls ballet flat is covered with sparkling black and silver sequins with an elastic strap that runs across the top of her foot. She will love the fun small silver beads that wrap around her foot and are shaped into a bow on the toes. One large gem adorns the center of these beaded bows. A black rubber sole lines the bottom of the shoe to ensure she has a safe grip on the ground. |,|$52.00$|,||,|COASTAL-PROJECTIONS-BLACK-HOLIDAY-SHOES-GIRLS-BOWS|,|$URL$coastal-projections-black-holiday-shoes-girls-bows.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-black-holiday-shoes-for-girls-with-bows-2.jpg||-||Coastal Projections Black Lace Flats - Sequin Shoes with Beaded Rosettes|,|Lovely in lace, these quaint flats from Coastal Projections are full of small details. The black lace is adorned with silver sequins while the top of the toe features a flower outlined in black sequins and beading. Handmade with a rubber outersole. |,|$49.00$|,||,|COASTAL-PROJECTIONS-BLACK-LACE-FLATS-SEQUIN-SHOES-BLACK-ROSETTE|,|$URL$coastal-projections-black-lace-flats-sequin-shoes-black-rosette.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-black-lace-flats-sequin-shoes-with-beaded-rosettes-12.jpg||-||Coastal Projections Black Sequin Girls Shoes|,|Coastal Projections is now offering these sparkling black flats fit for a princess. These handmade shoes feature beaded sequin detailing covering the black satin. The elastic strap is embellished with three black satin rosettes and provides a tight fit. Rubber sole for a nonslip grip. |,|$42.00$|,||,|COASTAL-PROJECTIONS-BLACK-SEQUIN-FLATS-GIRLS-SHOES-BEADING-BLACK-ROSETTES|,|$URL$coastal-projections-black-sequin-flats-girls-shoes-beading-black-rosettes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-black-sequin-girls-shoes-25.jpg||-||Coastal Projections Girls Black Sequin Shoes Vibrant Flowers|,|A pop of style for her feet, these new little girls black sequin flats are unlike any others. The satin shoes are completely covered in hand beaded and sequin designs boasting of a vibrant flower at the toe and on the back heel. A textured rubber outsole and an elastic band across her foot keeps the fit and grip secure. |,|$52.00$|,||,|COASTAL-PROJECTIONS-BLACK-SEQUIN-SHOES|,|$URL$coastal-projections-black-sequin-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-girls-black-sequin-shoes-vibrant-flowers-23.jpg||-||Coastal Projections Girls Ivory Sequin Shoes with Bow|,|Perfect for her holiday outfits, these sparkling ivory shoes are beyond adorable. The flats are covered in iridescent sequins and feature an ivory rosette band running across the top of her foot. A large satin bow adorned with jewels sits on her toe. |,|$59.00$|,||,|COASTAL-PROJECTIONS-GIRLS-IVORY-SEQUIN-SHOES-BOW|,|$URL$coastal-projections-girls-ivory-sequin-shoes-bow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-girls-ivory-sequin-shoes-with-bow-13.jpg||-||Coastal Projections Girls Pink Sequin Flats with Flower|,|Pretty in pink, these new little girls flats are covered with iridescent sequins. The elastic band is adorned by a fun pinwheel tulle rosette on the side. Pretty in pink shoes that are sure to get her noticed. |,|$49.00$|,||,|COASTAL-PROJECTIONS-GIRLS-PINK-SEQUIN-FLATS-FLOWER|,|$URL$coastal-projections-girls-pink-sequin-flats-flower.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-girls-pink-sequin-flats-with-flower-13.jpg||-||Coastal Projections Girls Silver Glitter T Strap Shoes|,|Every little girl loves to sparkle and that's just what she'll do in these silver glitter girls shoes from Coastal Projections. Silver glitter covers the entire shoe. A t-strap runs up the center to the ankle strap and plays host to a large grey sequined bow with a rhinestone accent at the center. The sole is of a firm rubber for grip. |,|$39.00$|,||,|COASTAL-PROJECTIONS-GIRLS-SILVER-GLITTER-T-STRAP-SHOES|,|$URL$coastal-projections-girls-silver-glitter-t-strap-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-girls-silver-glitter-t-strap-shoes-25.jpg||-||Coastal Projections Girls Zebra Sequin Shoes|,|Hand designed, these beautiful black and white zebra sequin shoes will be the talk of the town. The flats feature a textured outsole and elastic band across the top of her foot to secure both fit and grip while a sheer zebra ribbon forms a bow at her town, adorned with a single gem. To perfect to pass up! |,|$49.00$|,||,|COASTAL-PROJECTIONS-GIRLS-ZEBRA-SEQUIN-SHOES|,|$URL$coastal-projections-girls-zebra-sequin-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-girls-zebra-sequin-shoes-23.jpg||-||Coastal Projections Hot Pink Girls Sequin Shoes with Bow|,|A sparkling find in hot pink, she's sure to love these girls shoes from Coastal Projections. An abundance of sequins in hot pink cover the entire shoe. A hot pink strap travels across her foot and an oversized pink bow with jewel accents adorns her toes. The shoe has a rubber sole for firm grip. |,|$52.00$|,||,|COASTAL-PROJECTIONS-HOT-PINK-GIRLS-SEQUIN-SHOES-BOW|,|$URL$coastal-projections-hot-pink-girls-sequin-shoes-bow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-hot-pink-girls-sequin-shoes-with-bow-23.jpg||-||Coastal Projections Little Girls Brown Flats Glittering Bow|,|^|Matching her big sisters shoes, these little darlings come from designer Coastal Projections. The brown glitter shoes offer a rosette band running across the top of her foot to keep it secure while a large satin bow adorned with gems sits on her toe. SIZE 6 ONLY LEFT.  ^||,|$59.00$|,||,|COASTAL-PROJECTIONS-LITTLE-GIRLS-BROWN-FLATS-GLITTERING-BOW|,|$URL$coastal-projections-little-girls-brown-flats-glittering-bow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-little-girls-brown-flats-glittering-bow-13.jpg||-||Coastal Projections Little Girls Sequin Shoes Lilac Flowers|,|^|Gorgeous as always, these new Coastal Projection shoes are gorgeous spring time flats for any special occasion. The lilac satin shoes are covered in a hand sequined and beaded garden in mostly pink and greens. A sure grip is offered by the textured rubber outsole as an elastic purple strap over the top of her fit gives a secure fit. SIZES 5 AND 6 LEFT ^||,|$52.00$|,||,|COASTAL-PROJECTIONS-LILAC-FLOWERS-SEQUIN-SHOES|,|$URL$coastal-projections-lilac-flowers-sequin-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-little-girls-sequin-shoes-lilac-flowers-23.jpg||-||Coastal Projections Little Girls Sequin Shoes Pink Flowers|,|^|Just in time for any of her spring time special occasions, these little girls sequin shoes are such a delight. These beauties boast of their secure fit with a pink elastic band across her foot and a textured rubber sole to give her a great grip. The outside of the shoe is all hand beaded and features a fun floral design in aqua, purple, fuchsia, green and yellow. Match these with her favorite spring dress for fun photos, wedding attire, or show stopping Easter outfits. INFANT SIZES 0 TO 4 ONLY LEFT.  ^||,|$39.00$|,||,|COASTAL-PROJECTIONS-PINK-FLOWER-SEQUIN-SHOES|,|$URL$coastal-projections-pink-flower-sequin-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-little-girls-sequin-shoes-pink-flowers-12.jpg||-||Coastal Projections Little Girls Sequin Shoes Pink Garden|,|^|A new design from designer Coastal Projections, these hand beaded special occasion flats are great paired with that spring time dress. The shoes are covered in a bright floral design with many fun spring time colors and feature a crystal center to the large flower on the toe. Sure to stay on her feet with the pink elastic band across the top of her foot, these little girls sequin shoes offer a great grip with its textured outsole. Perfect for weddings, photos, or an Easter celebration! SIZE 6 ONLY LEFT.  ^||,|$52.00$|,||,|COASTAL-PROJECTIONS-PINK-GARDEN-SEQUIN-SHOES|,|$URL$coastal-projections-pink-garden-sequin-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-little-girls-sequin-shoes-pink-garden-23.jpg||-||Coastal Projections Pink Girls Pastel Sequin Shoes with Flower|,|^|Beautiful shoes for your beautiful darling, these lovely girls shoes are fresh from Coastal Projections. All dressed up in a generous amount of sequins in pastel colors, they are just too cute. A pink flower sits on the outside and a pink stretchy strap travels across her foot. A rubber sole gives a firm grip. SIZE 0 INFANT ONLY REMAINING. ^||,|$49.00$|,||,|COASTAL-PROJECTIONS-PINK-GIRLS-PASTEL-SEQUIN-SHOES-FLOWER|,|$URL$coastal-projections-pink-girls-pastel-sequin-shoes-flower.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-pink-girls-pastel-sequin-shoes-with-flower-13.jpg||-||Coastal Projections Pink Sequin Flats Strappy Rosette|,|A sparkling addition to her new designer dresses, this shimmering shoe for girls comes from Coastal Projections. The flats are covered with pink sequins that catch the lights. The sole is a rubber that grips with her every step. A strap runs across the top of her foot to keep it secure and is decorated with three quaint rosettes. |,|$53.00$|,||,|COASTAL-PROJECTIONS-PINK-SEQUIN-FLATS-STRAPPY-ROSETTE|,|$URL$coastal-projections-pink-sequin-flats-strappy-rosette.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-pink-sequin-flats-strappy-rosette-1.jpg||-||Coastal Projections Pink Sequin Flats- Satin Tie Bow|,|^|Sparkling in style, these adorable little girl flats are the perfect finishing touch. Handstitched beaded sequins cover the outside of the shoe in a petal pink and also create three petite flowers found on the top of the toe. Finished off with a satin tie bow at the back. Rubber outersole for sound grip. infant sizes 0, 1, 2, 3 available only. ^||,|$29.00$|,||,|COASTAL-PROJECTIONS-PINK-SEQUIN-FLATS-LITTLE-GIRL-SHOES-SATIN-TIE-BOW|,|$URL$coastal-projections-pink-sequin-flats-little-girl-shoes-satin-tie-bow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-pink-sequin-flats-satin-tie-bow-11.jpg||-||Coastal Projections Purple Girls Sequin Shoes with Flower|,|Coastal Projections has done it again in these perfectly purple girls sequin shoes. Purple hued iridescent sequins cover the entire shoe. A flower of purple mesh blooms on the outside of the shoe, while a stretchy strap of purple travels over her foot. The rubber sole provides her a firm support and grip. |,|$49.00$|,||,|COASTAL-PROJECTIONS-PURPLE-GIRLS-SEQUIN-SHOES-FLOWER|,|$URL$coastal-projections-purple-girls-sequin-shoes-flower.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-purple-girls-sequin-shoes-with-flower-39.jpg||-||Coastal Projections Red Rosette Sequin Shoes|,|^|Quality handmade by Coastal Projections, these little girls shoes are covered with beaded red sequins. Three rosettes embellish the toes. Elastic strap for fit. Her own ruby slippers! Sizes Infant 0 to Big girls size 2. ^||,|$44.00$|,||,|COASTAL-PROJECTIONS-RED-SEQUINED-SHOES|,|$URL$coastal-projections-red-sequined-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-red-rosette-sequin-shoes-23.jpg||-||Coastal Projections Red Velvet Flats - Little Girl Shoes with Beading|,|Elegant in a rich red, these new velvet flats now offered by Coastal Projections are the perfect pair of shoes for fall and winter. A touch of sparkle is added through hand beaded detailing. These shoes also feature a small red satin rosette on the outer side of each shoe and a comfortable elastic strap to keep them in place. Rubber sole, handmade. |,|$29.00$|,||,|COASTAL-PROJECTIONS-RED-VELVET-FLATS-LITTLE-GIRL-SHOES-BEADING|,|$URL$coastal-projections-red-velvet-flats-little-girl-shoes-beading.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-red-velvet-flats-little-girl-shoes-with-beading-13.jpg||-||Coastal Projections Sequin Party Shoes in Hot Pink|,|Coastal Projections can always be counted upon to create brilliant shoes that compliment her designer outfits, and this pair is no different. This flats are completed covered in hot pink sequins that are bold in color and shimmer as they catch the light. Upon the toe of both feet we find a sweet beaded flower design. A single strap runs across the top of her foot to keep it in place as she moves about. The outer sole is rubber to provide grip. |,|$54.00$|,||,|COASTAL-PROJECTIONS-SEQUIN-PARTY-SHOES-HOT-PINK|,|$URL$coastal-projections-sequin-party-shoes-hot-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-sequin-party-shoes-in-hot-pink-12.jpg||-||Coastal Projections Silver Sequin Flats Rosettes|,|Precious in glitz, these little shoes are perfect to match with that special outfit. These flats are covered in hand stitched, beaded sequins. They also feature an elastic strap to ensure a nice fit detailed by quaint silver satin rosettes. Rubber sole by Coastal Projections. |,|$48.00$|,||,|COASTAL-PROJECTIONS-SILVER-SEQUIN-FLATS-BEADED-SHOES-ROSETTES|,|$URL$coastal-projections-silver-sequin-flats-beaded-shoes-rosettes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-silver-sequin-flats-rosettes-25.jpg||-||Coastal Projections Silver Shoes with Tulle Bow|,|Fun and eye catching, these new flats from Coastal Projections make any outfit a hit. Completely covered in silver beaded sequins, these flats feature an adorable silver tulle bow on the outer toe of each foot. Hand beaded and fit for any princess. |,|$49.00$|,||,|COASTAL-PROJECTIONS-SILVER-SHOES-TULLE-BOW-SILVER-SEQUIN-FLATS|,|$URL$coastal-projections-silver-shoes-tulle-bow-silver-sequin-flats.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-silver-shoes-with-tulle-bow-13.jpg||-||Coastal Projections Tween Girls Brown Glitter Flats|,|Contagiously beautiful, these new tween flats will bring joy to her smile. The flats are covered in shimmering brown glitter and boast of the cute satin bow adorning her toe. Crystal beads add the final touch to this delightful creation. |,|$59.00$|,||,|COASTAL-PROJECTIONS-TWEEN-GIRLS-BROWN-GLITTER-FLATS|,|$URL$coastal-projections-tween-girls-brown-glitter-flats.html|,|http://ep.yimg.com/ay/yhst-17102259411242/coastal-projections-tween-girls-brown-glitter-flats-13.jpg||-||Corky Coats Floral Winter Coat for Little Girls|,|^|A match to her sister's new Corky coat, this fabulous design will keep your little girl warm and stylish. The berry colored flowers cover the coat in a pretty pattern. Solid pink is found trimming the rolled cuffs and the comfy hood. Flower appliques are also found on the hood. Made with an acrylic blend. Machine wash cold, line dry only. 9/12 MOS ONLY LEFT. ^||,|$34.50$|,||,|CORKY-COATS-FLORAL-WINTER-COAT-LITTLE-GIRLS|,|$URL$corky-coats-floral-winter-coat-little-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/corky-coats-floral-winter-coat-for-little-girls-2.jpg||-||Corky Coats Hooded Girls Coat Fair Isle|,|^|Cut for a loser wrap style, this new girls coat comes from Corky and Company as a part of their ""Fair Isle"" collection. The cozy coat is lined in soft fleece and boasts of a cute and comfortable hood. A single ruffle edges the hood while sweet flowers are found attached to the top. The colorful print wraps around in stripes while the rolled cuffs are accented with the same ruffle. Made with an acrylic blend. Machine wash cold, line dry only. (1) SIZE 4 ONLY LEFT.  ^||,|$57.50$|,||,|CORKY-COATS-HOODED-GIRLS-COAT-FAIR-ISLE|,|$URL$corky-coats-hooded-girls-coat-fair-isle.html|,|http://ep.yimg.com/ay/yhst-17102259411242/corky-coats-hooded-girls-coat-fair-isle-2.jpg||-||Corky Coats Winter Coat for Girls Red with Bubble Hem|,|^|Ever little girl deserves a cute red winter coat like this new arrival from designer Corky and Company. This red Mary Jane coat boasts of large metal buttons accenting the lapels and a single button closing the neckline and hiding the zipper. The skirted bottom relaxes in fit and finishes with a bubble hem. An attached hood adds warmth and the long sleeves are finished with a ruffled cuff. This thick warm fleece is made with 100% polyester, machine wash and line dry. SIZE 12 MOS ONLY LEFT.  ^||,|$31.50$|,||,|CORKY-COATS-WINTER-COAT-GIRLS-RED-BUBBLE-HEM|,|$URL$corky-coats-winter-coat-girls-red-bubble-hem.html|,|http://ep.yimg.com/ay/yhst-17102259411242/corky-coats-winter-coat-for-girls-red-with-bubble-hem-32.jpg||-||Daisy Jane Girls Boutique Dresses in Crochet Lace|,|An adorable creation from Daisy Jane, this new girls dress has arrived just in time to wow all her friends at school. The dress is cut for a more fitted look and offers a square neckline. The sleeves are sheer and finished with sweet bell ruffles. The lining peaks out through the soft crochet lace that creates the unique look to this piece. 100% Polyester. Machine Wash in Cold Water. Line Dry. |,|$49.00$|,||,|DAISY-JANE-GIRLS-BOUTIQUE-DRESSES-CROCHET-LACE|,|$URL$daisy-jane-girls-boutique-dresses-crochet-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/daisy-jane-girls-boutique-dresses-in-crochet-lace-1.jpg||-||Derhy Kids Candice Dress for Tweens|,|A dreamy new creation for your fabulous tween, this designer dress was created by Derhy Kids. The bodice boasts of metallic gold trimming that outlines the sleeveless neckline and the front center panel. The sheer fabric is covered with a unique, colorful print accented with clear, square sequins. The fitted bodice has a metal zipper that fastens up the back. Pleating falls from the waistline to open up the shape. The fabric sways with her movement and the slight breeze. The subtle stripes are covered with pinks, tans, and yellows with a slight touch of blue. The dress is fully lined. Viscose blend with nylon and metallic fiber. Lining: 100% polyester. Hand wash with care and hang or dry flat. |,|$87.00$|,||,|DERHY-KIDS-CANDICE-DRESS-TWEENS|,|$URL$derhy-kids-candice-dress-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/derhy-kids-candice-dress-for-tweens-1.jpg||-||Derhy Kids Girls Chiffon White Dress in Tropical Print|,|New from French designer Dehry Kids comes this romantic white chiffon dress for your tween. This sleeveless style featuring a sheer tropical print has sequin embellishments on the front and a keyhole button closure at back. The gathered elastic waistline allows for the flowy look that is trending this summer. Complete with soft ruffle detailing at the hemline. 100% polyester. Hand wash with care and hang to dry. |,|$69.00$|,||,|DERHY-KIDS-GIRLS-CHIFFON-WHITE-DRESS-TROPICAL-PRINT|,|$URL$derhy-kids-girls-chiffon-white-dress-tropical-print.html|,|http://ep.yimg.com/ay/yhst-17102259411242/derhy-kids-girls-chiffon-white-dress-in-tropical-print-1.jpg||-||Derhy Kids Summer Dress in Sandrine White|,|A fabulous dress perfect for any summer wedding or event, this new tween dress comes from high end designer Derhy Kids. The dress boasts of a fitted bodice covered with sweet petal flowers. A hidden zipper runs up the back. An illusion neckline is created with mesh and closed with a single button keyhole on her back. The skirt is created with a sheer fabric that is slightly more coarse than the typical silky chiffon. This allows for a chic look from the unique texture. The dress is fully lined while a touch of tulle ruffles beneath the hemline. This dress is perfect for a flower girl! 100% polyester. Hand wash with care and hang to dry. |,|$72.00$|,||,|DERHY-KIDS-SUMMER-DRESS-SANDRINE-WHITE|,|$URL$derhy-kids-summer-dress-sandrine-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/derhy-kids-summer-dress-in-sandrine-white-1.jpg||-||Derhy Kids Tween White Dress Cecile|,|A sweet summer dress for tweens, this new arrival comes from Derhy Kids. This dress features a sleeveless bodice with a hidden zipper found in the back. The wide neckline is dressed with neon pink sequins and small gems. The sheer georgette fabric has a sophisticated drape to the way it lays. A jungle print adds rich blues and greens while accented with small beads and sequins. The waist adds a pop of neon color. The fit opens through the skirt to allow the fabric to dance around her legs. This dress is fully lined in white polyester. Georgette fabric: polyester blend. Hand wash only, hang to dry. |,|$87.00$|,||,|DERHY-KIDS-TWEEN-WHITE-DRESS-CECILE|,|$URL$derhy-kids-tween-white-dress-cecile.html|,|http://ep.yimg.com/ay/yhst-17102259411242/derhy-kids-tween-white-dress-cecile-17.jpg||-||Desigual Black and White Stripe Girls Dress|,|^|Desigual is now offering this casual tween dress for summer. The dress boasts of a relaxed, blouson fit bodice with a sweet bow placed upon the center of the waistline. The front is covered with colorful circles that contrast the black and white jailbird stripe. 100% cotton. Wash separately. SIZE 9/10 ONLY LEFT.  ^||,|$36.75$|,||,|DESIGUAL-BLACK-WHITE-STRIPE-GIRLS-DRESS|,|$URL$desigual-black-white-stripe-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-black-and-white-stripe-girls-dress-1.jpg||-||Desigual Butterfly Denim Skirt for Girls|,|^|A cute casual skirt perfect for school, this new arrival comes from the creative designers at Desigual. The dark blue denim skirt boasts of fading on the front and slight whiskering to give a slightly distressed look. Sparkling sequins and colored fabrics wrap around her waist while the bright circle print is found not only on the hemline but also inside one of the front pockets. The left skirt is accented with two butterflies. Made with a cotton blend. Machine wash cold, tumble dry low. SIZE 4 AND 9/10 ONLY REMAINING.  ^||,|$34.50$|,||,|DESIGUAL-BUTTERFLY-DENIM-SKIRT-GIRLS|,|$URL$desigual-butterfly-denim-skirt-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-butterfly-denim-skirt-for-girls-2.jpg||-||Desigual Butterfly Girls Dress with Tutu Skirt|,|Cute and original, this new girls dress comes from the wildly fun brand, Desigual. The bodice features a fun butterfly print that covers the front. The right sleeve is striped in contrast to the solid black left sleeve. The skirt is made with layers of black tulle that fall from the waist to create the cute tutu style. Pairs adorably with leggings, but just as gorgeous by itself. Shell: 100% cotton. Trimming: 100% polyester. Machine wash cold, tumble dry low. |,|$33.00$|,||,|DESIGUAL-BUTTERFLY-GIRLS-DRESS-TUTU-SKIRT|,|$URL$desigual-butterfly-girls-dress-tutu-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-butterfly-girls-dress-with-tutu-skirt-2.jpg||-||Desigual Chiffon Red Dress for Girls|,|Easy to wear as a casual outfit or to dress up, this new girls dress comes from Desigual for girls. The empire waist is defined with a touch of elastic while the bodice boasts of a sheer overlay that creates an illusion neckline. The thin shoulder straps are adjustable. The chiffon is covered with a small polka dot print and touches of colorful flowers. Polyester. Wash separately. |,|$46.50$|,||,|DESIGUAL-CHIFFON-RED-DRESS-GIRLS|,|$URL$desigual-chiffon-red-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-chiffon-red-dress-for-girls-1.jpg||-||Desigual Designer Girls Skirt in Green|,|From European designer, Desigual, this new girls skirt is sure to be a staple in her school wardrobe. The skirt features a fold over waist that stretches for a comfortable fit. The waist is striped in greens and a touch of pink. The skirt opens to a full circle shape that is a loved look by many. The colorful design off to the right side of the skirt pops out against the black background. Cotton/Elastane. Machine wash cold, inside out. Hang to dry. |,|$54.00$|,||,|DESIGUAL-DESIGNER-GIRLS-SKIRT-GREEN|,|$URL$desigual-designer-girls-skirt-green.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-designer-girls-skirt-in-green-1.jpg||-||Desigual Flower Print Girls Leggings|,|^|Desigual is now offering these fabulous leggings, perfect to finish off her new Desigual fall outfits. The black leggings boast of the classic stretch fit and elastic waist. The solid black is covered with white and multi-colored flowers. The flower style has a hand made look. The perfect fun layer beneath her shorts, skirts, or dresses! Made with a cotton blend. Machine wash cold, tumble dry low. SIZE SMALL (3/4) ONLY REMAINING.  ^||,|$14.50$|,||,|DESIGUAL-FLOWER-PRINT-GIRLS-LEGGINGS|,|$URL$desigual-flower-print-girls-leggings.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-flower-print-girls-leggings-2.jpg||-||Desigual Girls Back to School Dress in Blue|,|^|Created by Desigual, this new girls dress is sure to be envied by her friend. The blue dress features a front covered with circles. A touch of satin fabric appliques adds a new twist to the look. The long sleeves are created in a coordinating circle print fabric in blue. The dress is cut for a straight fit that is relaxed, comfortable, and sure to look fabulous with leggings paired beneath. 100% Cotton. Hand wash cold, inside out. SIZE 4 AND 7/8 ONLY LEFT.  ^||,|$49.00$|,||,|DESIGUAL-GIRLS-BACK-TO-SCHOOL-DRESS-BLUE|,|$URL$desigual-girls-back-to-school-dress-blue.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-girls-back-to-school-dress-in-blue-1.jpg||-||Desigual Girls Boat Neck Dress in Grey Bloom|,|A casual dress that she can wear any day of the week, this new arrival comes from Desigual Kids. The soft grey fabric allows for a cozy fit and offers long sleeves. The boat neck is a trendy choice to style this top. The front of the dress is covered with a unique print that is made from rich red tones. A thin tie is finished in a bow on the waist. 100% Cotton. Hand wash cold, inside out. |,|$82.00$|,||,|DESIGUAL-GIRLS-BOAT-NECK-DRESS-GREY-BLOOM|,|$URL$desigual-girls-boat-neck-dress-grey-bloom.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-girls-boat-neck-dress-in-grey-bloom-1.jpg||-||Desigual Girls Minnie Mouse Shirt in Red|,|A popular design from the new fall and winter line by Desigual Kids, this fabulous shirt is loved by all. The red top offers her long sleeves to help keep her warm in the chillier months. The front is graced with a large print while her right sleeve boasts of Disney polka dots. A large Minnie mouse head sits upon the front lined with black sequins to catch the light. Her red hair bow is also made from sequins. 100% Cotton. Machine wash cold, inside out. |,|$49.00$|,||,|DESIGUAL-GIRLS-MINNIE-MOUSE-SHIRT-RED|,|$URL$desigual-girls-minnie-mouse-shirt-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-girls-minnie-mouse-shirt-in-red-1.jpg||-||Desigual Girls Romper in Bright Print|,|A trendy style for the warmer months, this romper is covered with an exotic print. The romper features a belt that ties around her waist and spaghetti straps. The top of the bodice is a smocked stretch fit. The belt at the waist allows for a flowing blouse fit on the top while the wide legs are hemmed with an elastic ruffle. 100% polyester. Hand wash only. |,|$36.75$|,||,|DESIGUAL-GIRLS-ROMPER-BRIGHT-PRINT|,|$URL$desigual-girls-romper-bright-print.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-girls-romper-in-bright-print-1.jpg||-||Desigual Girls Skinny Pant in Black|,|Looking fabulous with her new Desigual tops, these girls skinny pants are a wardrobe classic. The pants offer slight stretch in their fit and have a sweet ribbon that ties into a bow around her waist. Near the hem of both legs we find a faint fly trap design. This design stands out from the subtle damask print to the fabric. 99% Cotton. Machine wash cold with like colors. Hang to dry. |,|$38.00$|,||,|DESIGUAL-GIRLS-SKINNY-PANT-BLACK|,|$URL$desigual-girls-skinny-pant-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-girls-skinny-pant-in-black-1.jpg||-||Desigual Girls Striped Desigual Tee|,|^|The perfect way to show off her individual style, this new Desigual tee is unforgettable. The bright stripes are blends of beautiful colors that are unique for a fall pallet. The Desigual name that is printed on the front is filled with different patterns and fonts. One long sleeve sides with the striped front while the other wears the fun geometric pattern that covers the back. 100% cotton. Hand wash cold, hang to dry. SIZE 4 AND 5/6 ONLY LEFT.  ^||,|$24.50$|,||,|DESIGUAL-GIRLS-STRIPED-DESIGUAL-TEE|,|$URL$desigual-girls-striped-desigual-tee.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-girls-striped-desigual-tee-2.jpg||-||Desigual Girls Top with Face Graphic|,|Created for the fashion forward, this new designer girls top comes from the beloved Desigual brand. The top is as cute as can be boasting of its sharkbite hemline and quaint short sleeves. The light weight fabric is covered with a color block stripe that travels from pink to white to orange. Near the wide hemline we find a large screen print of a face with red lips and short hair. Poly/cotton. Hand wash cold water inside out. |,|$36.75$|,||,|DESIGUAL-GIRLS-TOP-FACE-GRAPHIC|,|$URL$desigual-girls-top-face-graphic.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-girls-top-with-face-graphic-16.jpg||-||Desigual Glitter Champagne Tween Skinny Jeans|,|^|Quickly becoming the talked about piece in many of her outfits, these new jeans come from Europe based designer, Desigual. The denim pants feature a skinny shape finished with slight gathers on each ankle and a shimmering champagne color. Fun designs and words accent both back pockets. Cotton blend, machine washable. 11/12 AND 13/14 ONLY AVAILABLE.  ^||,|$19.00$|,||,|DESIGUAL-GLITTER-CHAMPAGNE-TWEEN-SKINNY-JEANS|,|$URL$desigual-glitter-champagne-tween-skinny-jeans.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-glitter-champagne-tween-skinny-jeans-14.jpg||-||Desigual Green Fringe Scarf for Girls|,|Created by Desigual to finish her new fall and winter outfits off right, this new scarf is so cute! The grass green scarf is covered a subtle print, just a shade darker while bright blooming flowers pop out in color. A thin line of sequins runs around the edge that is finished with cute, trendy fringe. 100% polyester. Hand wash cold, hang to dry. |,|$17.00$|,||,|DESIGUAL-GREEN-FRINGE-SCARF-GIRLS|,|$URL$desigual-green-fringe-scarf-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-green-fringe-scarf-for-girls-2.jpg||-||Desigual Kids Dresses - Green Kaleidoscope|,|^|Vibrant and unique, this new kids dress comes from the fabulous European brand, Desigual. The bodice boasts of a wrap style that creates a V neckline and is accented by the blending of paisley and striped patterns. The two long sleeves where one of the two patterns. A wide band breaks up the mixture to emphasize her waist slightly. A kaleidoscope print covers the skirt and is sure to pop out in fall. 100% cotton. Hand wash cold, hang to dry. (1) 4 ONLY LEFT.  ^||,|$29.00$|,||,|DESIGUAL-KIDS-DRESSES-GREEN-KALEIDOSCOPE|,|$URL$desigual-kids-dresses-green-kaleidoscope.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-kids-dresses-green-kaleidoscope-2.jpg||-||Desigual Kids Shorts Fleece Lined Denim|,|Warming up a traditionally cooler style, this new design from Desigual is adorable. The denim shorts feature a soft ivory lambswool the edges both the hem and her pockets while two pink buttons close the waist. A vibrant printed fabric wraps around one side of her waist while stripes of purple and pink sequins run around the other. One of the back pockets is detailed by a pink feather print. Pair with leggings or tights in the cooler months. |,|$37.00$|,||,|DESIGUAL-KIDS-SHORTS-FLEECE-LINED-DENIM|,|$URL$desigual-kids-shorts-fleece-lined-denim.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-kids-shorts-fleece-lined-denim-2.jpg||-||Desigual Kids Tunic in Navy Print|,|^|Adding creativity and wonder to her wardrobe, Desigual aims to surprise with fun, irresistible prints and styles. The long sleeve tunic does just that! The top has a more relaxed fit and boasts of the row of snaps that run from the neckline down the shirt half way. The long sleeves contrast to the body in their solid navy fabric. The bodice comes to life with fanciful prints, colors, and lines. 100% cotton. Machine wash cold, tumble dry low. SIZE 5/6 AND 11/12 REMAINING.  ^||,|$21.00$|,||,|DESIGUAL-KIDS-TUNIC-NAVY-PRINT|,|$URL$desigual-kids-tunic-navy-print.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-kids-tunic-in-navy-print-2.jpg||-||Desigual Long Sleeve Dress in Purple|,|^|Ready for whatever the day throws at her, this new girls dress from designer Desigual is stylish and comfortable, perfect for any errand or plan. The long sleeve dress boasts of a rich pallet of purple shade and a dreamy print. The waist is defined only by the ribbon that ties in a bow around it. The skirt opens in shape from the waist to the hem and features a second layer that peaks out beneath and finishes with a dainty scallop hemline. 100% cotton. Machine wash cold, tumble dry low. AVAILABLE IN SIZE 4 ONLY.  ^||,|$31.00$|,||,|DESIGUAL-LONG-SLEEVE-DRESS-PURPLE|,|$URL$desigual-long-sleeve-dress-purple.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-long-sleeve-dress-in-purple-2.jpg||-||Desigual Long Sleeve Top for Girls in Multi Print|,|Designer Desigual is a well known and loved European brand. They have created this fun new top for girls as a part of their new line for fall and winter. This top is a beyond comfortable feel with its casual fit. The neck is wrapped in black trim to match the background while bold colors pop out. The unique kaleidoscope print is created with fabric appliques and traditional screen prints. The long sleeves finish with a sweater knit cuff in pink. 100% Cotton. Hand wash cold, inside out. |,|$58.00$|,||,|DESIGUAL-LONG-SLEEVE-TOP-GIRLS-MULTI-PRINT|,|$URL$desigual-long-sleeve-top-girls-multi-print.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-long-sleeve-top-for-girls-in-multi-print-1.jpg||-||Desigual Minnie Mouse Sequin Heart Dress|,|With an older version of the beloved Minnie Mouse, this new girls dress is a design by Desigual for kids. The rich stripes run horizontally across the dress. The bodice features short sleeves and a wide neckline. A touch of elastic defines her waistline while the skirt falls to a classic, straight hemline. The large character screen print has touches of pink and silver while a sequin heart is found in the conversation bubble. 100% Cotton. Hand wash inside out cold water. |,|$39.00$|,||,|DESIGUAL-MINI-MOUSE-SEQUIN-HEART-DRESS|,|$URL$desigual-mini-mouse-sequin-heart-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-minnie-mouse-sequin-heart-dress-1.jpg||-||Desigual Minnie Mouse Tank Top for Girls|,|Filled with the love of Disney, this new designer top comes from Desigual for kids. The white and red ombre top boasts of thin shoulder straps that frame the neckline. Minnie Mouse profile is posed on the front. The wide cut of the top allows for a comfortable, casual fit. 100% cotton. Hand wash cold, lay flat to dry. |,|$31.50$|,||,|DESIGUAL-MINI-MOUSE-DRESS-PINK-GRAY|,|$URL$desigual-mini-mouse-dress-pink-gray.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-minnie-mouse-tank-top-girls-1.jpg||-||Desigual Polka Dot Girls Skirt|,|From designer Desigual, this new fabulous skirt is sure to create many wonderful summer outfits. The white skirt boasts of a short, fitted cut. Large black polka dots cover the skirt completely. Pair this piece with any of her favorite new Desigual creations. 100% cotton. Hand wash cold. |,|$28.50$|,||,|DESIGUAL-POLKA-DOT-GIRLS-SKIRT|,|$URL$desigual-polka-dot-girls-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-polka-dot-girls-skirt-1.jpg||-||Desigual Summer Dress for Tweens|,|^|Filled with the Desigual style, this new girls dress is sure to take pride in its bold colors underneath the warm sunlight. The empire bodice has a crossover, V neckline. The sleeveless dress features touches of green, pink, and blue in its patterns. The skirt is paneled in different fabrics upon the front. 100% cotton. Wash separately. Lay flat to dry. (1) SIZE 13/14 ONLY LEFT.  ^||,|$39.00$|,||,|DESIGUAL-SUMMER-DRESS-TWEENS|,|$URL$desigual-summer-dress-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-summer-dress-for-tweens-1.jpg||-||Desigual Top for Girls in Blue|,|A trendy new top for your fabulous daughter, this design was created by European designer, Desigual. The top features the fun dolman fit. The neckline is a wide boat neck cut. The left side of the front is covered with a scrolling blue print creating flowers and leaves. The right side is a large applique covered with a green kaleidoscope print and finished with a gold stitched edge. 100% Viscose. Hand wash cold, inside out. |,|$42.00$|,||,|DESIGUAL-TOP-GIRLS-BLUE-BLACK|,|$URL$desigual-top-girls-blue-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-top-for-girls-in-blue-1.jpg||-||Desigual Tween Denim Skirt Short Bubble|,|^|Perfect to pair with her favorite summer top, this new tween denim skirt from designer Desigual gives an abundance of possibilities. The skirt features a medium wash with slight fading, a large teal snap button, and two pockets on the front and back. The left waist boasts of a lace applique whiles three scalloped lace ribbons wrap from the center around her right side, ending in the back. The uniqueness of this piece comes with its wide hem, slightly taken in, to give it a shape that bubbles out slightly. Made with cotton blend. ONE EACH OF SIZE 11/12 AND 13/14.  ^||,|$19.00$|,||,|DESIGUAL-TWEEN-DENIM-SKIRT-SHORT-BUBBLE|,|$URL$desigual-tween-denim-skirt-short-bubble.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-tween-denim-skirt-short-bubble-13.jpg||-||Desigual Tween Girls Summer Skirt|,|A classic design from Desigual girls, this new summer skirt is a fresh breeze. The skirt features a stretch waist that sits comfortably for all day wear. The white cotton is paneled with different, bold prints. The blends of greens, yellow, pinks, and blues are sure to make this skirt match almost all of her tops! A second layer peeks out from beneath the hemline. 100% cotton. Wash seperately. |,|$46.50$|,||,|DESIGUAL-TWEEN-GIRLS-SUMMER-SKIRT|,|$URL$desigual-tween-girls-summer-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-tween-girls-summer-skirt-1.jpg||-||Desigual Tween Tank Top Circle Print|,|^|A brilliant design, European brand Desigual is now offering this adorable piece. The tween tank top boasts of a grey and white stripe and a scoop neckline. The racer back is a casual cut and allows for a relaxed fit. The front is covered with a bold, colorful bull's-eye in blue, green, and pink. 100% cotton. Hand wash only. 13/14 ONLY AVAILABLE.  ^||,|$25.50$|,||,|DESIGUAL-TWEEN-TANK-TOP-CIRCLE-PRINT|,|$URL$desigual-tween-tank-top-circle-print.html|,|http://ep.yimg.com/ay/yhst-17102259411242/desigual-tween-tank-top-circle-print-1.jpg||-||Deux Par Deux Girl Sundress Orange Swiss Dot|,|Complimenting so many different outfits that have arrived from designer Deux Par Deux, this fabulous girls sundress is a trendy coral orange. The elastic straps are ruffled on the shoulders and frame the wide, straight neckline. The fabric is textured with a swiss dot while the hemline is layered in ruffles. |,|$44.25$|,||,|DEUX-PAR-DEUX-GIRL-SUNDRESS-CORAL-SWISS-DOT|,|$URL$deux-par-deux-girl-sundress-coral-swiss-dot.html|,|http://ep.yimg.com/ay/yhst-17102259411242/deux-par-deux-girl-sundress-coral-swiss-dot-1.jpg||-||Deux Par Deux Girls Bow Dress Black|,|Sophisticated and cute, this girls dress comes from designer Deux Par Deux. The drop waist bodice is a solid black fabric featuring a classic neckline secured by a single button keyhole in the back. The front of her waist is covered with a row of large bows. The skirt finishes with a layered hemline that introduces the same two prints that create the bows. Made with cotton blend. Machine wash cold, tumble dry low. |,|$39.00$|,||,|DEUX-PAR-DEUX-GIRLS-BOW-DRESS-BLACK|,|$URL$deux-par-deux-girls-bow-dress-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/deux-par-deux-girls-bow-dress-black-32.jpg||-||Deux Par Deux Girls Red Summer Top|,|This new darling summer top from designer Deux Par Deux is part of their spring and summer collection. The bold red top has a wide neckline framed with thin gingham ruffled straps. The front features stitching details and small flower accents and has a single button keyhole closure. |,|$27.00$|,||,|DEUX-PAR-DEUX-GIRLS-RED-SUMMER-TOP|,|$URL$deux-par-deux-girls-red-summer-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/deux-par-deux-girls-red-summer-top-1.jpg||-||Deux Par Deux Girls Top and Short in Orange|,|Also available in navy, this new designer girls top and short set comes from Deux Par Deux. The veil top has a polka dot overlay that dresses the solid white tank. A quaint ruffle accents the shape of the neckline while the wide shoulder straps are gathered with a piece of fabric. Cute coral shorts are worn beneath. These bottoms feature a bubble cut with a button/zipper fly. The shorts are covered with a small swiss dot texture. |,|$59.00$|,||,|DEUX-PAR-DEUX-GIRLS-TOP-SHORT-CORAL|,|$URL$deux-par-deux-girls-top-short-coral.html|,|http://ep.yimg.com/ay/yhst-17102259411242/deux-par-deux-girls-top-and-short-in-orange-1.jpg||-||Deux Par Deux Little Girls Heart Dress|,|Deux Par Deux is now offering this fabulous little girls outfit for spring and summer. The top boasts of cap sleeves and a single button keyhole at the back of the neckline. A small heart is found on the front while the rich pink polka dots cover the entire piece. Two pleats open up the shape of the top while the double layer hemline is dressed with ruffles. Paired beneath the top are matching pink leggings. The hemline is dressed with a ruffle on the outer side of both legs. Top: 100% cotton. Leggings: Made with cotton blend. Machine wash cold, tumble dry low. |,|$49.00$|,||,|DEUX-PAR-DEUX-LITTLE-GIRLS-HEART-DRESS|,|$URL$deux-par-deux-little-girls-heart-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/deux-par-deux-little-girls-heart-dress-11.jpg||-||Deux Par Deux Navy Chevron Top and Short|,|Created with love for the spring and summer seasons, this new Deux Par Deux is easy to fall in love with! The top features a veil overlay in a fun, navy chevron stripe. The neckline is dressed in polka dots and wide stripes. The bold pink shorts paired beneath are covered with a swiss dot texture. The bubble style is characterized by the wide hem and the fitted waist. |,|$59.00$|,||,|DEUX-PAR-DEUX-NAVY-CHEVRON-TOP-SHORT|,|$URL$deux-par-deux-navy-chevron-top-short.html|,|http://ep.yimg.com/ay/yhst-17102259411242/deux-par-deux-navy-chevron-top-and-short-1.jpg||-||Deux Par Deux Navy Stripe Dress for Girls|,|A retro chic, this fabulous girls dress was designed by loved Deux Par Deux. The white and navy stripes run own the entire dress while her wide neckline is created by the unique shape of the straps. The left side is printed with a water color flower design. The dress finishes with a full circle hem that ruffles around her legs as she walks and twirls. Made with cotton blend. Machine wash cold, tumble dry low. |,|$42.00$|,||,|DEUX-PAR-DEUX-BLACK-STRIPE-DRESS-GIRLS|,|$URL$deux-par-deux-black-stripe-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/deux-par-deux-black-stripe-dress-for-girls-11.jpg||-||Deux Par Deux Pink Plaid Dress for Girls|,|The perfect summer dress, this new arrival comes from Deux Par Deux. The fitted bodice boasts of coral and pink shoulder straps that cross and wrap around her empire waistline. The scoop neckline welcomes the warm sunshine. The rich shades of pink and coral are a top pick for summer and are blended into a large plaid print. The hemline dances in its ruffles. 100% cotton. Machine wash cold, do not tumble dry. |,|$48.00$|,||,|DEUX-PAR-DEUX-PINK-PLAID-DRESS-GIRLS|,|$URL$deux-par-deux-pink-plaid-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/deux-par-deux-pink-plaid-dress-for-girls-32.jpg||-||Deux Par Deux Plaid Tunic with Leggings|,|Refreshing like a cool breeze, this new Deux Par Deux outfit is adorable. The bodice features keyhole back and two bows found on the shoulders. The pleating found at the neckline opens up the tunic's shape while a row of buttons sit in the center. Coordinating leggings are paired beneath with accents found just above the hemline on both legs. |,|$39.00$|,||,|DEUX-PAR-DEUX-PLAID-TUNIC-LEGGINGS|,|$URL$deux-par-deux-plaid-tunic-leggings.html|,|http://ep.yimg.com/ay/yhst-17102259411242/deux-par-deux-plaid-tunic-with-leggings-1.jpg||-||Deux Par Deux Rainbow Summer Dress for Girls|,|Rival the bright warmth of the sun, this new girls sun dress comes from designer Deux Par Deux. The bold pink bodice is framed with tiny black dots found at the neckline and empire waist. Striped ruffles decorate the shoulders and a single button fastens on the back. Small bows are also found on the top. The skirt is tiered in a color block fashion with a wide ruffle hem. |,|$39.00$|,||,|DEUX-PAR-DEUX-RAINBOW-SUMMER-DRESS-GIRLS|,|$URL$deux-par-deux-rainbow-summer-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/deux-par-deux-rainbow-summer-dress-for-girls-1.jpg||-||Deux Par Deux Red Eyelet Shorts for Girls|,|New from Deux Par Deux, these sweet eyelet lace shorts are sure to be a favorite this summer. These shorts are finished with a button tab hemline and offer her comfortable pockets and a zipper/button fly. |,|$19.00$|,||,|DEUX-PAR-DEUX-RED-LACE-SHORTS-GIRLS|,|$URL$deux-par-deux-red-lace-shorts-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/deux-par-deux-red-lace-shorts-for-girls-1.jpg||-||Deux Par Deux Striped Girls Dress with Legging|,|From designer Deux Par Deux, this new girls outfit is sure to be one both mom and daughter adore. The flounced dress features a bow bodice accented with four buttons and thin stripes. The hemline is covered with a chevron stripe print while the back has a coordinating polka dot design. Matching thin stripe leggings are paired beneath. Top: 100% cotton. Leggings: Made with cotton blend. Machine wash cold, tumble dry low. |,|$49.00$|,||,|DEUX-PAR-DEUX-STRIPED-GIRLS-DRESS-LEGGING|,|$URL$deux-par-deux-striped-girls-dress-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/deux-par-deux-striped-girls-dress-with-legging-33.jpg||-||Dolls and Divas Girls Party Dress in Black Pleather|,|^|Stylish and trendy, this new girls dress is beyond any other piece in her closet. The fitted dress boasts of its black pleather fabric that allows a slight stretch and a wide sleeveless neckline. The peplum skirt ruffles around at the waist and brings shape and interest to the short skirt. Metallic silver trimmings finish off this adorable fashion forward look. Made in the USA. Hand wash with care in cold water and lay flat to dry. Dolls and Divas tends to run small. Please consider ordering up a size.  ^||,|$29.00$|,||,|DOLLS-DIVAS-GIRLS-PARTY-DRESS-BLACK-PLEATHER|,|$URL$dolls-divas-girls-party-dress-black-pleather.html|,|http://ep.yimg.com/ay/yhst-17102259411242/dolls-and-divas-girls-party-dress-in-black-pleather-32.jpg||-||Dolls and Divas Light Pink Girls Peplum Dress|,|^|A classy dress that both mom and daughter can easily fall in love with, this new arrival comes from Dolls and Divas Couture. The sleeveless bodice is made in a light pink cotton blend, lined with the same fabric and made in a fitted style. The waist is wrapped with black pleather, matching the accents found on both shoulders. The short skirt is graced by a peplum ruffle skirt to finish this sophisticated look. Made with cotton blend, hand wash in cold water. Made in the USA. Dolls and Divas tends to run small. Please consider ordering up a size. SIZE 7 ONLY LEFT.  ^||,|$29.00$|,||,|DOLLS-DIVAS-LIGHT-PINK-GIRLS-PEPLUM-DRESS|,|$URL$dolls-divas-light-pink-girls-peplum-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/dolls-and-divas-light-pink-girls-peplum-dress-32.jpg||-||Dolls and Divas Ruffle Zebra Girls Dress|,|^|Cute as can be, this new little girls dress from designer Dolls and Divas will make quite the statement this fall and winter season. The black bodice is soft on her skin and offers a fitted look and long sleeves while a ruffle red rosette sits just beneath the wide neckline. A wide ribbon ties around her waist in a bow while the skirt is tiered by three wide ruffles in a wilde zebra print. Made with a cotton blend in the USA. Hand wash with cold water and lay flat to dry. Dolls and Divas tends to run small. Please consider ordering up a size.  ^||,|$18.99$|,||,|DOLLS-DIVAS-RUFFLE-ZEBRA-SKIRT-GIRLS-DRESS|,|$URL$dolls-divas-ruffle-zebra-skirt-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/dolls-and-divas-ruffle-zebra-girls-dress-1.jpg||-||Dolls and Divas Valentine Heart Girls Striped Dress|,|^|Hard to not fall in love with, this girls dress comes from loved designer, Dolls and Divas Couture. The black and white striped bodice features long sleeves and a light weight fabric. A beating sequin heart applique is found front and center. A matching red sequin belt fastens around her waist. The full circle skirt is created with the same pattern and the dress does allow a slight stretch in its fit. Hand wash with care and lay flat to dry. Made in the USA. Dolls and Divas tends to run small. Please consider ordering up a size. (1) SIZE 2T ONLY REMAINS. ^||,|$19.00$|,||,|DOLLS-DIVAS-VALENTINE-HEART-GIRLS-STRIPED-DRESS|,|$URL$dolls-divas-valentine-heart-girls-striped-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/dolls-and-divas-valentine-heart-girls-striped-dress-32.jpg||-||DreamSpun Aqua Little Girls Necklace|,|A light blue dream accessory, this little girls necklace comes from designer DreamSpun. The necklace is made with beads of all kinds. The clear prisms and small gems catch the light while the shimmering satin finish contrasts with other beads nearby. The center of the necklace is adorned by a large diamond. |,|$19.50$|,||,|DREAMSPUN-AQUA-LITTLE-GIRLS-NECKLACE|,|$URL$dreamspun-aqua-little-girls-necklace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/dreamspun-aqua-little-girls-necklace-1.jpg||-||DreamSpun Aqua Top with Mustard Shorties for Girls|,|An easy outfit with great charm, this new top and short set comes from designer DreamSpun. The unique top is covered with a paisley print upon the light blue background. An oversized rosette is found near the ruffled, elastic neckline. Mustard yellow shoulder straps are covered with sweet polka dots and tie in the back. The matching shorties are great paired with almost every top! The two tone stripe races around her legs. The hem of both legs is a double ruffle that adds a finishing touch of grace. 100% cotton. Made in the USA. Machine wash cold, tumble dry. |,|$59.00$|,||,|DREAMSPUN-AQUA-TOP-MUSTARD-SHORTIES-GIRLS|,|$URL$dreamspun-aqua-top-mustard-shorties-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/dreamspun-aqua-top-with-mustard-shorties-for-girls-17.jpg||-||DreamSpun Girls Hair Clip with Feather Detail|,|Finishing the cute new summer outfit with a gorgeous accessory, this new arrival comes from DreamSpun. The darling hair clip is created from a trio of flowers. The blooms blend blue, yellow and pink in a delicious new way! A blue feather accents the accessory and it clips in her hair easily! |,|$19.50$|,||,|DREAMSPUN-GIRLS-HAIR-CLIP-FEATHER-DETAIL|,|$URL$dreamspun-girls-hair-clip-feather-detail.html|,|http://ep.yimg.com/ay/yhst-17102259411242/dreamspun-girls-hair-clip-with-feather-detail-1.jpg||-||DreamSpun Green Floral Dress with Lace Hem|,|^|A great summer dress for any young girl, this new design comes from DreamSpun. The yellow empire bodice features a comfortable tank fit. The small ruffle cap sleeves are made in a rich green pattern. The skirt is created with the same large floral print on the rich grass green. The hemline is dressed with a fancy lace ruffle hem. Every bright warm day deserves a fabulous dress! 100% cotton. Made in the USA. Machine wash cold, tumble dry. SIZE 4T AND 8 ONLY LEFT.  ^||,|$36.75$|,||,|DREAMSPUN-GREEN-FLORAL-DRESS-LACE-HEM|,|$URL$dreamspun-green-floral-dress-lace-hem.html|,|http://ep.yimg.com/ay/yhst-17102259411242/dreamspun-green-floral-dress-with-lace-hem-1.jpg||-||DreamSpun Little Girls Necklace in Pastel Rose|,|Designed by DreamSpun, this new little girls necklace is filled with fun. The necklace is made with large, chunky beads. The beads boast of different textures while placed in rainbow order. The clear prism beads reflect the light around her while a few add a touch of sparkle. Pair this fabulous necklace with her favorite new spring and summer outfits! |,|$19.50$|,||,|DREAMSPUN-LITTLE-GIRLS-NECKLACE-PASTEL-ROSE|,|$URL$dreamspun-little-girls-necklace-pastel-rose.html|,|http://ep.yimg.com/ay/yhst-17102259411242/dreamspun-little-girls-necklace-in-pastel-rose-1.jpg||-||DreamSpun Love Letter Halter with Aqua Capri|,|^|DreamSpun is now offering this fabulous summer outfit. The unique halter top boasts of thin shoulder straps and a straight neckline. The empire bodice is a red floral print with a chevron yoke framed with blue rickrack ribbon. The skirt of the top is a warm red boasting of the ""love"" that is scripted near the blue floral hemline. Paired beneath we find light blue leggings. Their classic stretch fit as comfortable as can be while the outer side of both legs is hemmed with a tied knot. 100% Cotton. Machine wash cold. Tumble Dry. Made in the USA. ^||,|$79.00$|,||,|DREAMSPUN-LOVE-LETTER-HALTER-AQUA-CAPRI|,|$URL$dreamspun-love-letter-halter-aqua-capri.html|,|http://ep.yimg.com/ay/yhst-17102259411242/dreamspun-love-letter-halter-with-aqua-capri-17.jpg||-||DreamSpun Rosie Top with Bloomer in Mustard|,|^|New from designer DreamSpun, this fabulous little girls outfit is a true delight. The top boasts of an elastic top hemline that ruffles the neckline and allows a comfortable stretch fit. The sky blue fabric is covered with a pink rose pattern. The dark burgundy spiral rosette is attached off to the right side. The matching rich shoulder straps are thin and tie for a custom fit on her back. The top is paired with bloomer shorts. The golden rod yellow is rich and coordinates with the blue in a unique way. The vintage inspired print covers both legs as they finish with a double ruffle hem with a touch of scallop lace. 100% cotton. Made in the USA. Machine wash cold, tumble dry. SIZE 6 ONLY LEFT.  ^||,|$64.50$|,||,|DREAMSPUN-ROSIE-TOP-BLOOMER-MUSTARD|,|$URL$dreamspun-rosie-top-bloomer-mustard.html|,|http://ep.yimg.com/ay/yhst-17102259411242/dreamspun-rosie-top-with-bloomer-in-mustard-1.jpg||-||DreamSpun Yellow Blossom Hair Clip|,|Fitting with the warm sunshine, this new girls hair accessory from DreamSpun is sure to compliment several of their new arrivals. The rich yellow fabric is layered with elegant tulle. The flower clips into her hair with ease. |,|$10.50$|,||,|DREAMSPUN-YELLOW-BLOSSOM-HAIR-CLIP|,|$URL$dreamspun-yellow-blossom-hair-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/dreamspun-yellow-blossom-hair-clip-1.jpg||-||Elisa B Black Dress with Neon Stripes|,|^|From designer Elisa B, this tween special occasion dress is perfect for most any event. The girls black dress features a sleeveless bodice covered with a sweet blouson overlay that parts slightly on her back. The short skirt is a fitted look which is accented by the trio of neon stripes that wrap the front. Made with a polyblend fabric that allows stretch in its fit. A hidden zipper is found on her left side. Hand wash and line dry. ONLY SIZE 7 LEFT. ^||,|$46.50$|,||,|ELISA-B-BLACK-DRESS-NEON-STRIPES|,|$URL$elisa-b-black-dress-neon-stripes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-black-dress-with-neon-stripes-20.jpg||-||Elisa B Black Tween Dress Lovely Lace|,|Newly arrived from designer Elisa B, this lace tween dress is certain to make her feel beautiful. The dress features a white tank dress lining that is attached at the shoulders.The bodice features a wide neckline and short sleeves made with the dreamy black lace overlay. The waist line is decorated with peachy pink and ivory flowers made from layers of tulle and chiffon. The center of each flower is adorned with sweet pearl beads and sparkling gems. The fabric allows slight stretch in its fit. A hidden zipper runs down the back of the dress a few inches past her waistline.The hemline is wrapped with a wide ribbed ribbon in white. All fabric is 100% polyester, hand wash separately and hang to dry. |,|$58.50$|,||,|ELISA-B-BLACK-TWEEN-DRESS-LOVELY-LACE|,|$URL$elisa-b-black-tween-dress-lovely-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-black-tween-dress-lovely-lace-22.jpg||-||Elisa B Blue Tween Dress|,|Elisa B has created this fabulous girls dress to accompany her to any special occasion. The wide neckline is framed with gems decorating the straps in alternating white and black sparkle. The straight shape of the dress is accented by the single drape of fabric on the front. A hidden zipper runs up the back. Polyester blend fabric. Hand wash. Hang to dry. |,|$46.50$|,||,|ELISA-B-BLUE-TWEEN-DRESS|,|$URL$elisa-b-blue-tween-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-blue-tween-dress-20.jpg||-||Elisa B Color Block Tween Dress with Animal Print|,|^|A truly wild design, this new tween girls dress comes from the trendy Elisa B line. The black color block shoulders boast of a wide neckline that is flattering while a bright pink runs down the center of the dress. Her sides are dressed with black and white animal print while the knit fabric is comfortable for all day wear. Pairs great with leggings and shrugs! Poly Blend fabric, hand wash only and hang to dry. (1) 7 AND (1) 8 ONLY LEFT.  ^||,|$29.00$|,||,|ELISA-B-COLOR-BLOCK-TWEEN-DRESS-ANIMAL-PRINT|,|$URL$elisa-b-color-block-tween-dress-animal-print.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-color-block-tween-dress-with-animal-print-38.jpg||-||Elisa B Designer Tween Dress in Magenta|,|Elisa B is now offering this fun tween dress as a part of their fall and winter line. The dress features a warm magenta shade with a lighter contrast found on the shoulders. A draping overlay has a hi-low cut and flows with her every movement. The fitted dress beneath is finished in a classic straight hemline. Wear this dress to any party or celebration, it is sure to be envied. Polyester, spandex blend. Machine wash in cold water, inside out. Line Dry. |,|$56.00$|,||,|ELISA-B-DESIGNER-TWEEN-DRESS-MAGENTA|,|$URL$elisa-b-designer-tween-dress-magenta.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-designer-tween-dress-in-magenta-17.jpg||-||Elisa B Fitted Tween Dress Color Block Red|,|A fun design by trendy Elisa B, this new fitted tween dress is a beautiful design that will look wonderful on your daughter. The stylish colorblock look covers this dress in red and black while it is cut for a shorter look. A zipper runs up the back of the dress to secure the fit while the sleeveless neckline is framed with round and square studs. Two slits are found where the black shoulder straps meet with the red bodice. 95% Polyester, 5% Spandex. Cold Water. Hand wash, inside out. Line Dry |,|$64.00$|,||,|ELISA-B-FITTED-TWEEN-DRESS-COLOR-BLOCK-RED|,|$URL$elisa-b-fitted-tween-dress-color-block-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-fitted-tween-dress-color-block-red-1.jpg||-||Elisa B Fitted Tween Dress with Sequins|,|Whether she is celebrating a holiday or performing in a recital, this new tween dress from Elisa B is both classy and elegant. The dress is covered with a fun geometric print that entices the eye with its never ending lines. Each shape is filled with sequins from white to silver to black. The bodice is sleeveless and the whole dress is cut for that trendy fitted look. Slight shape is cut into the dress at the waist. Pair leggings or tights beneath for a warmer look! 100% polyester. Hand wash cold, line dry. |,|$59.00$|,||,|ELISA-B-FITTED-TWEEN-DRESS-SEQUINS|,|$URL$elisa-b-fitted-tween-dress-sequins.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-fitted-tween-dress-with-sequins-18.jpg||-||Elisa B Floral Dream Girls Dress|,|^|Designed by Elisa B, this tween girls dress will be the talk of the season! The sweet dress features a soft floral print that is placed upon the sheer chiffon overlay. A ""u"" shaped neckline is accented with darling beads and gems. The flowing fit is filled with a free spirit that is evident as she moves and the dress follows gracefully. Pleating on the neckline helps open up the fit as you flow down to the straight hemline. The dress is lined and is closed with a hidden zipper found on the back ^||,|$49.00$|,||,|ELISA-B-FLORAL-DREAM-GIRLS-DRESS|,|$URL$elisa-b-floral-dream-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-floral-dream-girls-dress-15.jpg||-||Elisa B Fluttering Chiffon Tween Party Dress|,|^|New from the Elisa B collection, this tween dress is sure make a great impression at any party. The dress boasts of a single button keyhole back, double ruffled neckline, and a matching chiffon bow that ties around her waist. From her shoulders down the hem, fluttering ruffles add to the already beautiful movement of this creation. Delicate 100% polyester, hand wash and line dry. SIZE 7 AND 8 LEFT. ^||,|$39.00$|,||,|ELISA-B-FLUTTERING-CHIFFON-TWEEN-PARTY-DRESS|,|$URL$elisa-b-fluttering-chiffon-tween-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-fluttering-chiffon-tween-party-dress-32.jpg||-||Elisa B Girls Dotted Knit Halter Dress|,|^|Every girl needs a little black dress and this one comes with dots! This girls halter dress comes from Elisa B and it is sure to become a fast favorite. The halter style bodice sits above a full skirt. A zipper is hidden on the left side. A red leather belt with an adorable bow adorns the waist. The dress is lined in black and has a layer of tulle under the skirt to give it a fuller shape. Made from polyester/spandex. Machine wash cold, line dry. SIZE 7 AND 14 LEFT. ^||,|$29.00$|,||,|ELISA-B-GIRLS-DOTTED-KNIT-HALTER-DRESS|,|$URL$elisa-b-girls-dotted-knit-halter-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-girls-dotted-knit-halter-dress-48.jpg||-||Elisa B Glo In The Dark Tween Dress|,|A vibrant dress from the tween designer, Elisa B, this party dress is sure to be loved by any young girl. This dress begins with a sleeveless neckline that has a wide, boat neck shape. A neon lace overlay covers the dress with flowers. The hemline drapes with two tiers of ruffles in a sheer tiny dot print. The fit is secured with a hidden zipper that runs up the back. |,|$48.00$|,||,|ELISA-B-GLO-THE--DARK-TWEEN-DRESS|,|$URL$elisa-b-glo-the--dark-tween-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-glo-in-the-dark-tween-dress-16.jpg||-||Elisa B Holiday Dress for Tweens in Gold|,| |,|$74.00$|,||,|ELISA-B-HOLIDAY-DRESS-FOR-TWEENS-IN-GOLD|,|$URL$elisa-b-holiday-dress-for-tweens-in-gold.html|,|||-||Elisa B Knit Tween Dress with Sequin Sleeves in Purple|,|^|From designer Elisa B, this fabulous tween dress arrives just in time for all of her fall parties. The bright purple dress is unique and rich in color and boasts of its easy pull over fit. The straight shape creates a trendy look and also goes great with layers. Her long black sleeves are covered in sparkling black sequins. Also available in Turquoise. Poly blend fabric, hand wash with care. SIZE 8 AND 10 LEFT. ^||,|$29.00$|,||,|ELISA-B-KNIT-TWEEN-DRESS-SEQUIN-SLEEVES-PURPLE|,|$URL$elisa-b-knit-tween-dress-sequin-sleeves-purple.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-knit-tween-dress-with-sequin-sleeves-in-purple-32.jpg||-||Elisa B Lace Brights Pink Neon Dress|,|Competing with the sun's rays, this bright Elisa B dress is available only in tween sizes. The dress boasts of its bold neon orange fabric complimented with a neon pink overlay. The pink fabric is sheer and lacey, with the orange peaking through. The bodice is cut for a more fitted look while the skirt boasts of its flowing fit, dancing around her legs. Close the hidden zipper in the back and she's ready for a fun-filled summer day! 100% polyester. Hand wash only. Line dry. |,|$57.00$|,||,|ELISA-B-LACE-BRIGHTS-PINK-NEON-DRESS|,|$URL$elisa-b-lace-brights-pink-neon-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-lace-brights-pink-neon-dress-20.jpg||-||Elisa B Magenta Checkered Tween Dress|,|^|Unlike any other dress she owns, this new Elisa B dress is in its own class. The fitted shape of the dress is trendy and chic while long sleeves add warmth. The shorter fit of the dress is perfect to pair with leggings for even more warmth. A hidden zipper runs up the back while the soft suede feel of the polyester fabric adds texture. The front is decorated by magenta pleather squares alternating down the front. 100% polyester. Machine washable, hang to dry. SIZE 7 LEFT. ^||,|$39.00$|,||,|ELISA-B-MAGENTA-CHECKERED-TWEEN-DRESS|,|$URL$elisa-b-magenta-checkered-tween-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-magenta-checkered-tween-dress-20.jpg||-||Elisa B Miss Sixty Black and White Dress|,|Bursting with retro inspiration, this new girls dress from Elisa B is one she will love at first sight! The entire piece is covered with a black and white geometric print reminiscent of the sixties. The style is cut for a more fitted look which is created with pin tucks that run down both sides to give shape. The layered hemline ruffles in a sheer black fabric. The classic color combination makes this dress an easy fit for almost any occasion! |,|$44.25$|,||,|ELISA-B-MISS-SIXTY-BLACK-WHITE-DRESS|,|$URL$elisa-b-miss-sixty-black-white-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-miss-sixty-black-and-white-dress-16.jpg||-||Elisa B Neon Pink Dress|,|^|A vibrant arrival, this fabulous tween party dress comes from the Elisa B brand. The sleeveless top offers her a timeless neckline. A matching overlay creates the blouson look finished with a slit running down the back. The fitted skirt is lined and features silver studs decorating the front. A hidden zipper runs up the left side. Polyester blend. Hand wash with care and line dry. (1) SIZE 10 REMAINING. ^||,|$49.50$|,||,|ELISA-B-NEON-PINK-DRESS|,|$URL$elisa-b-neon-pink-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-neon-pink-dress-1.jpg||-||Elisa B Neon Pink Girls Lace Dress|,|^|Elisa B has created this new spring dress for tweens just in time for the blooming flowers. The dress is covered with a fun flower texture that is created with the lace overlay. The light pink is one that is easy to accessorize while the sleeveless bodice has a wide neckline and a hidden sipper that closes the back. The hemline is layered with sheer mesh that is covered with tiny dots. SIZE 10 ONLY REMAINING.  ^||,|$48.00$|,||,|ELISA-B-NEON-PINK-GIRLS-LACE-DRESS|,|$URL$elisa-b-neon-pink-girls-lace-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-neon-pink-girls-lace-dress-33.jpg||-||Elisa B Neon Stripe Girls Tween Dress|,|Matching another new creation from Elisa B, this wonderful tween dress is sure to please every fashionista. The sleeveless bodice has a higher neckline made with a bright neon green fabric. The fun stripes blend beautifully down to the sharkbite hemline. The striped fabric is sheer and elegant in drape. Tights or leggings can easily be paired beneath for a warmer outfit. The dress is lined in black. |,|$42.00$|,||,|ELISA-B-NEON-STRIPE-GIRLS-TWEEN-DRESS|,|$URL$elisa-b-neon-stripe-girls-tween-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-neon-stripe-girls-tween-dress-23.jpg||-||Elisa B One Shoulder Tween Party Dress|,|^|Matching a few of the new tween dresses that have arrived for this fall and winter from Elisa B, this special occasion dress is perfect for her unique style. The fitted black dress has a short length and a solid colored fabric. The bodice's sophisticated look comes from the overlay that is completely covered with sequins placed into a geometric print. This overlay falls from the neckline to her waist. One shoulder features a single strap would the other is draped for a flutter look. 100% polyester. Hand wash cold, line dry. SIZE 10 AND 14 ONLY LEFT.  ^||,|$59.00$|,||,|ELISA-B-ONE-SHOULDER-TWEEN-PARTY-DRESS|,|$URL$elisa-b-one-shoulder-tween-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-one-shoulder-tween-party-dress-20.jpg||-||Elisa B Polka Dot Girls Dress|,|Staying true to her trendy style is what this dotted knit girls dress from Elisa B will do. The bodice is done in a black knit with white dots and boasts of cap sleeves and rouching throughout. The skirt is made from white tulle with an accordion effect. Underneath is a layer of shimmering tulle that gives the skirt a bit of sparkle over the white lining. The dress is belted at the waist with a wide black belt. Made from polyester/spandex. Hand wash cold, line dry. |,|$29.00$|,||,|ELISA-B-POLKA-DOT-GIRLS-DRESS|,|$URL$elisa-b-polka-dot-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-polka-dot-girls-dress-5.jpg||-||Elisa B Royal Cold Shoulder Party Dress|,|Stylish and ready to party, this new tween dress from designer Elisa B is everything she has dreamed of. The fitted blue knit dress features a matching thin belt to wrap around her waist and long sleeves. The bodice boasts of the cold shoulder cutout and a sparkling blue overlay that is more relaxed in fit. 100% polyester, hand wash and hang to dry. |,|$49.00$|,||,|ELISA-B-ROYAL-COLD-SHOULDER-PARTY-DRESS|,|$URL$elisa-b-royal-cold-shoulder-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-royal-cold-shoulder-party-dress-18.jpg||-||Elisa B Sequin Party Dress in Black|,|^|Hot in trend, this special occasion tween dress comes from designer Elisa B. The dress features a sleeveless bodice and a waist defined only by the fitted shape. A zipper runs up the back to ensure a close fit. The center of the front is striped with silver and chrome sequins. The shorter style of the dress looks great alone but also with tights or leggings. 100% polyester. Hand wash cold, line dry. SIZE 7 AND 8 ONLY LEFT.  ^||,|$39.00$|,||,|ELISA-B-SEQUIN-PARTY-DRESS-BLACK|,|$URL$elisa-b-sequin-party-dress-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-sequin-party-dress-in-black-20.jpg||-||Elisa B Sequin Sunshine Pink Girls Dress|,|^|Sophisticated and in pretty pink, this dress was created from Elisa B straight from her dreams. The bodice has a relaxed blouson fit that gathers at her waist. The sleeveless neckline is dressed in large gems. A hidden zipper is found on the back of the bodice. The skirt has a short cut and is dressed in sparkling pink sequins. (2) SIZE 8 ONLY LEFT.  ^||,|$44.25$|,||,|ELISA-B-SEQUIN-SUNSHINE-PINK-GIRLS-DRESS|,|$URL$elisa-b-sequin-sunshine-pink-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-sequin-sunshine-pink-girls-dress-17.jpg||-||Elisa B Sequin Tween Party Dress in Animal Print|,|^|Sparkling and trendy, this new arrival from Elisa B will make your tween sing. The sleeveless bodice boasts of a fitted cut while the animal print sequin pattern runs from the straps down the center to the waist. The skirt is covered with that same wild print and sequins that catch the light as she moves. A zipper runs up the back for a sure fit. Pair with leggings and a cute bolero cardi when the air gets chilly. Made with a poly blend, hand wash with care. (1) EACH SIZE 7 AND 12 REMAINING. ^||,|$29.00$|,||,|ELISA-B-SEQUIN-TWEEN-PARTY-DRESS-ANIMAL-PRINT|,|$URL$elisa-b-sequin-tween-party-dress-animal-print.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-sequin-tween-party-dress-in-animal-print-38.jpg||-||Elisa B Sparkle Stripes Girls Dress|,|^|By designer Elisa B, this cute tween dress is a real firework! The fitted dress accents her waist and features a hidden zipper that closes the back. The wide, sleeveless neckline is a unique style with its thin, wide keyhole. The sides of the dress are a solid blue while the center of the front and the back are striped in white and royal blue sequins. Created with a polyester blend. Hand wash and hang to dry. TWO SIZE 8 REMAINING. ^||,|$49.00$|,||,|ELISA-B-SPARKLE-STRIPES-GIRLS-DRESS|,|$URL$elisa-b-sparkle-stripes-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-sparkle-stripes-girls-dress-36.jpg||-||Elisa B Spring Green Sequin Tween Dress|,|^|Unique in every way, this new designer girls dress is part of Elisa B's ""Peral Sequins"" collection for the spring. The unique coloration of the dress is earthy and rich. The sparkling sequins rain down slowly fading to a new shade creating a unique stripe. The back of the dress is closed with a zipper. Two chiffon ruffles run around the hemline with a fun frenzy. The shaping tucks that run down the front assist with a more fitted cut. ^||,|$48.00$|,||,|ELISA-B-SPRING-GREEN-SEQUIN-TWEEN-DRESS|,|$URL$elisa-b-spring-green-sequin-tween-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-spring-green-sequin-tween-dress-15.jpg||-||Elisa B Super Stripes Tween Maxi Dress|,|^|This long summer dress was designed by trendy tween designer Elisa B. The bold stripes are filled with rays of color that create a bright blend. The bodice offers a sleeveless neckline and blouson fit. The matching skirt falls with a vertical accordion texture. The hemline is high and low to compliment her legs and is right on trend. SIZE 7 AND 8 AVAILABLE ONLY. ^||,|$48.00$|,||,|ELISA-B-SUPER-STRIPES-TWEEN-MAXI-DRESS|,|$URL$elisa-b-super-stripes-tween-maxi-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-super-stripes-tween-maxi-dress-15.jpg||-||Elisa B Turquoise Tween Party Dress|,|Becoming the instant envy of all her friends, this new Elisa B dress is available selectively in tween sizes. The cool turquoise green shines out amongst all of the other dresses this fall and speaks to her individual style. The shape of the dress is created for a fitted and trendy look but also works well for her fall layers. The long black sleeves shimmer in the light as she moves because of their fun sequins. The pull over fit is easy and quick. Hand wash dress with care, polyester blend. |,|$29.00$|,||,|ELISA-B-TURQUOISE-TWEEN-PARTY-DRESS|,|$URL$elisa-b-turquoise-tween-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-turquoise-tween-party-dress-30.jpg||-||Elisa B Tween Black Dress for Parties|,|As comfortable as it is stylish, this tween dress comes from designer Elisa B. The shoulders on this piece are sheer like several other fall arrivals, providing for a sophisticated look. The black knit is comfortable for all day wear. Touches of sequins add the shimmer to this piece, causing it to shine like the stars as it reflects the light. The skirt falls into a handkerchief hemline, allowing extra fabric to move with her every step in a delightful dance around her legs. 100% polyester. Hand wash cold, line dry. |,|$59.25$|,||,|ELISA-B-TWEEN-BLACK-DRESS-PARTIES|,|$URL$elisa-b-tween-black-dress-parties.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-tween-black-dress-for-parties-16.jpg||-||Elisa B Tween Casual Dress Black and White|,|A modern dress for your fashionable tween, this new arrival comes from designer Elisa B. The bodice is made with a light weight fabric that is cut for a fitted look and allows slight stretch. The front is covered with a pinwheel design in black and white. The skirt opens in shape and twirls around her legs as she flutters about the party. The V shaped neckline is framed by the wide straps. |,|$49.00$|,||,|ELISA-B-TWEEN-CASUAL-DRESS-BLACK-WHITE|,|$URL$elisa-b-tween-casual-dress-black-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-tween-casual-dress-black-and-white-16.jpg||-||Elisa B Tween Color Block Dress|,|^|Orange accents this tween dress from Elisa B. The sleeveless neckline in orange tops this fuchsia pink fitted dress. An orange band accents the hemline. The back is zippered. Polyester blend. Hand wash, line dry. SIZE 7 AND 8 ONLY LEFT. ^||,|$29.00$|,||,|ELISA-B-TWEEN-COLOR-BLOCK-DRESS|,|$URL$elisa-b-tween-color-block-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-tween-color-block-dress-32.jpg||-||Elisa B Tween Dress|,|^|A unique design that is absolutely lovely, this new designer dress for tweens was created by the trendy Elisa B line. The fitted look of the bodice is secured by the hidden zipper that runs up the back while the neckline is cut for a wide shape. The short sleeves are textured with rows of pin tucks. The waistline is subtly accented while the skirt is a classic pencil shape. The sides of the skirt are striped with matching tucks in the fabric while a cute, single ruffle decorates the hemline. Created from a polyester blend fabric. Hand wash and line dry. ONLY (1) SIZE 7 REMAINING. ^||,|$48.00$|,||,|ELISA-B-TWEEN-DRESS|,|$URL$elisa-b-tween-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-tween-dress-20.jpg||-||Elisa B Tween Dress in Coral|,|^|A dreamy design in a hot color, this new dress from trendy tween designer Elisa B is a beautiful creation. The coral pink is a warm tone that compliments her sunkissed skin. The neckline is framed by thin shoulder straps. A small ""V"" of gems falls down the front to accent the layers of matching, wide ruffles that drape gracefully. Made with a polyester blend. Hand wash this dress and line dry. SIZE 7 ONLY REMAINING. ^||,|$39.00$|,||,|ELISA-B-TWEEN-DRESS-CORAL|,|$URL$elisa-b-tween-dress-coral.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-tween-dress-in-coral-20.jpg||-||Elisa B Tween Dress Textured Purple|,|Fashioned by a team of designers at Elisa B, this boutique dress for tween girls is a new arrival from their fall and winter line. The dress is a fun purple and is cut for a more fitted look that is fabulous with leggings paired beneath. The bodice is defined with black pleather trim that also runs around the sleeveless neckline. A zipper runs up the back of the dress. The fabric features a unique texture that completes the look and style. Polyester, Spandex blend. Machine wash in cold water, inside out. Line Dry. |,|$66.00$|,||,|ELISA-B-SHORT-TWEEN-DRESS-TEXTURED-PURPLE|,|$URL$elisa-b-short-tween-dress-textured-purple.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-tween-dress-textured-purple-43.jpg||-||Elisa B Tween Holiday Dress in White and Gold Lace|,|Beautiful and sweet, this new tween holiday dress comes from Elisa B. The dress creates a beautiful blend of white and gold. A small V slit accents the wide neckline trimmed with gold. The relaxed fit is a perfect match for this flowing fabric that boasts of its graceful movement. The lace look is the perfect texture to add to this piece. Whether she is celebrating a holiday or a wedding, this dress is the perfect choice! 100% Polyester. Machine Wash Inside Out in Cold Water. Line Dry. |,|$79.00$|,||,|ELISA-B-TWEEN-HOLIDAY-DRESS-WHITE-GOLD-LACE|,|$URL$elisa-b-tween-holiday-dress-white-gold-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-tween-holiday-dress-in-white-and-gold-lace-1.jpg||-||Elisa B Tween Party Dress in Magenta|,|Designed by Elisa B, the sister brand of Lipstik Girls, this new tween party dress is sure to excite your darling daughter's fashion palette. The sleeveless bodice has a fitted feel while the blouson overlay flows with her every movement and features a slit down the back of the bodice. The short skirt is fitted as well and embellished by the wrapped design and sublte pink gems. Polyblend fabric. Hand wash and hang to dry. |,|$55.50$|,||,|ELISA-B-TWEEN-PARTY-DRESS-MAGENTA|,|$URL$elisa-b-tween-party-dress-magenta.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-tween-party-dress-in-magenta-16.jpg||-||Elisa B Tween Party Dress Sequin Bubbles|,|^|For the dazzling tween with great style, this new party dress comes from designer Lipstik Girls line, Elisa B. The straight shape of the dress compliments its shorter length and sleeveless fit while sequin design brings all the fun. The mesh overlay is covered in black and white sequins creating a bubbling look that shimmers with her movement. 100% polyester, hand wash with care. SIZE 7 LEFT. ^||,|$39.00$|,||,|ELISA-B-TWEEN-PARTY-DRESS-SEQUIN-BUBBLES|,|$URL$elisa-b-tween-party-dress-sequin-bubbles.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-tween-party-dress-sequin-bubbles-32.jpg||-||Elisa B Tween Sequin Dress for Parties Black|,|Sparkling fun, this fabulous creation is from designer Elisa B. The tween dress features a fitted empire waist bodice fastened by a hidden zipper. A native design is made completely by fun, shimmering sequins. The skirt is created with layers of black tulle that fall down to an even hemline. This dress is perfect for any special occasion this fall or winter. 100% Polyester. Cold water, hand wash inside out. Line Dry. |,|$79.00$|,||,|ELISA-B-TWEEN-SEQUIN-DRESS-PARTIES-BLACK|,|$URL$elisa-b-tween-sequin-dress-parties-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-tween-sequin-dress-for-parties-black-1.jpg||-||Elisa B Tween Sheath Dress Sequin Snake|,|^|Equipping her with style for her next party, Elisa B created this new tween dress to satisfy her taste for fashion. The sleeveless dress is covered n colored sequins creating the illusion and pattern of dazzling snake skin. An invisible side zipper is found under her left arm. Lined in black, 100% polyester, hand wash with care. ALL SOLD OUT 5/29/14.  ^||,|$39.00$|,||,|ELISA-B-TWEEN-SHEATH-DRESS-SEQUIN-SNAKE|,|$URL$elisa-b-tween-sheath-dress-sequin-snake.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-tween-sheath-dress-sequin-snake-17.jpg||-||Elisa B White Tween Party Dress|,|Inspired from a flapper style, this tween dress was designed by fabulous Elisa B. The scoop neckline has wide shoulder straps for a sleeveless look that is perfectly easy to layer if needed. The body of the dress is covered with swooping waves made from white sequins. The style features a more fitted look while the hemline is dancing with layers of sheer ruffles. This dress is a great choice for family photos, celebrations, or pageants! |,|$49.50$|,||,|ELISA-B-IVORY-LIGHTS-TWEEN-PARTY-DRESS|,|$URL$elisa-b-ivory-lights-tween-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elisa-b-white-tween-party-dress-9.jpg||-||Elysees Bebe White Baby Doll Dress with Bloomers|,|From Elysees Bebe, comes this adorable baby doll dress with bloomers. Your little one will be the cutest of the cute in this! The soft white bodice boasts of a lace applique with a tiny rosette at the center. The neckline and sleeves are trimmed in white lace, as is the full skirt. Two tiny hearts in shades of pink are embroidered on the left side of the skirt and bloomers. The bloomers are of the same white fabric with elastic and lace at the legs. The tiny rosettes repeat on the legs as well. Made of 100% cotton. Machine wash cold, tumble dry low. |,|$39.00$|,||,|ELYSEES-BEBE-WHITE-BABY-DOLL-DRESS-BLOOMERS|,|$URL$elysees-bebe-white-baby-doll-dress-bloomers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/elysees-bebe-white-baby-doll-dress-with-bloomers-28.jpg||-||Enchanted Shimmer Aurora Newborn Crown|,|^|A step beyond extraordinary, this fabulous newborn crown comes from designer Enchanted Shimmer. The tall crown peaks at the front with a circle of gems that sparkle along with all the others that create this gorgeous design. Clear prism beads are found in the center shaped as flowers. Designed to make her photo debut unforgettable! SOLD OUT ALL 3/4/14  ^||,|$54.00$|,||,|ENCHANTED-SHIMMER-AURORA-NEWBORN-CROWN|,|$URL$enchanted-shimmer-aurora-newborn-crown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-aurora-newborn-crown-1.jpg||-||Enchanted Shimmer Girls Flower Headband in Marie|,|An exact match to a soft head piece, this hard headband comes from Enchanted Shimmer. The ivory flower is layered with lace and features a sparkling center that is almost hid like a pearl. Tall feather boast of their cool purple and blue shades that make them stand out. All of this is attached off to one side of a thin hard headband wrapped with ivory satin. |,|$29.00$|,||,|ENCHANTED-SHIMMER-GIRLS-FLOWER-HEADBAND-MARIE|,|$URL$enchanted-shimmer-girls-flower-headband-marie.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-girls-flower-headband-in-marie-1.jpg||-||Enchanted Shimmer Girls Headband Bella Feather|,|Living up to the name, this fabulous girls head piece from Enchanted Shimmer truly is beautiful. The white ruffles stretch around her head with an elastic band that is truly comfortable. The sweet pink flower is layered with natural colored lace while two loops of gems dangle and catch the light. A sweet white boa feather pokes out from beneath along with two polka dot flowers. Make a statement with this piece in her first photographs or at any event. |,|$29.00$|,||,|ENCHANTED-SHIMMER-GIRLS-HEAD-PIECE-BELLA-FEATHER|,|$URL$enchanted-shimmer-girls-head-piece-bella-feather.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-girls-headband-bella-feather-1.jpg||-||Enchanted Shimmer Girls Ruffle Band in Pearl Shimmer|,|New from Enchanted Shimmer, this fabulous headband adds the perfect elegance to her outfit! The elastic band boasts of a sheer white ruffle finished with small scallop edges. The front of this accessory is adorned by pearl accents placed among sparkling gems! Perfect for newborn photo shoots and special events! |,|$29.00$|,||,|ENCHANTED-SHIMMER-GIRLS-RUFFLE-BAND-PEARL-SHIMMER|,|$URL$enchanted-shimmer-girls-ruffle-band-pearl-shimmer.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-girls-ruffle-band-in-pearl-shimmer-1.jpg||-||Enchanted Shimmer Girls Vintage Rose Headband|,|Darling in design, this Enchanted Shimmer headband will make your daughter feel like the vintage princess she is! The thin hard headband is covered in ivory satin for a timeless look. The beige flower sits off to one side accented with a ruffle of coral lace and gorgeous tall plumes. The gem center is filled with the vintage inspiration that we all know and love! |,|$49.00$|,||,|ENCHANTED-SHIMMER-GIRLS-VINTAGE-ROSE-HEADBAND|,|$URL$enchanted-shimmer-girls-vintage-rose-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-girls-vintage-rose-headband-12.jpg||-||Enchanted Shimmer Grace Fabulous Girls Headband|,|Shining her way to the top, this new head piece comes from the glorious Enchanted Shimmer designers. The sweet pink flower is accented with lace in a natural tone while a sparkling gem center speaks to its vintage inspiration. The green and grey feathers add a truly luxurious feel. The elastic band stretches around her head for a comfortable fit while dress with white ruffles |,|$29.00$|,||,|ENCHANTED-SHIMMER-GRACE-FABULOUS-GIRLS-HEAD-PIECE|,|$URL$enchanted-shimmer-grace-fabulous-girls-head-piece.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-grace-fabulous-girls-headband-1.jpg||-||Enchanted Shimmer Infant Romper in Nude|,|An inspired design, this baby girls romper from designer Enchanted Shimmer is perfect for photographs! The romper is created in a nude tone that is a high trend for the season. Tulle ruffles wrap around in lines to add a splendid texture. Fully lined, this fabric stretches to fit. The strapless top is secured with an elastic band. A removable flower clip is found off centered near the top. This flower is layered in ivory tulle and chiffon while featuring dazzling gem accents and a touch of coral lace underneath. Fun, whimsical plumes fan out at the top. Proudly made in the USA. 100% polyester. Machine wash delicate and line dry. |,|$78.00$|,||,|ENCHANTED-SHIMMER-INFANT-ROMPER-NUDE|,|$URL$enchanted-shimmer-infant-romper-nude.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-infant-romper-in-nude-12.jpg||-||Enchanted Shimmer Marie Floral Headband for Girls|,|Designed by Enchanted Shimmer, this girls head piece makes an elegant appearance. The ruffle white band stretches with its elastic to fit comfortable on her head. The sweet natural tone flower blooms from the center almost hiding its sparkling gems. Royal plumes are proud in their shades of purple and blue to finish off this look. |,|$29.00$|,||,|ENCHANTED-SHIMMER-MARIE-FLORAL-HEAD-PIECE-GIRLS|,|$URL$enchanted-shimmer-marie-floral-head-piece-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-marie-floral-headband-for-girls-1.jpg||-||Enchanted Shimmer Petals Gem Girls Tie Back|,|^|Elegant and unique, this Enchanted Shimmer accessory is sure to not last long! The jewel design found in the front is shaped like a chain of flowers, perfect for the girly girl. A velvet tie secures the fit at the back of her head and changes its color for each size. NEWBORN ONLY LEFT.  ^||,|$38.00$|,||,|ENCHANTED-SHIMMER-PETALS-GEM-GIRLS-TIE-BACK|,|$URL$enchanted-shimmer-petals-gem-girls-tie-back.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-petals-gem-girls-tie-back-1.jpg||-||Enchanted Shimmer Princess Tie Back for Girls|,|Making a statement about your style, this shimmering hair accessory comes from Enchanted Shimmer. The jewel front falls into dangles with a large round gem at the bottom. A velvet tie changes colors based upon the size ordered and creates an individual fit when tied at the back of her head. Available for all ages to make the perfect mother and daughter photo props! |,|$42.00$|,||,|ENCHANTED-SHIMMER-PRINCESS-TIE-BACK-GIRLS|,|$URL$enchanted-shimmer-princess-tie-back-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-princess-tie-back-for-girls-1.jpg||-||Enchanted Shimmer Rosebud Girls Hair Accessory|,|This new design was created by the fabulous Enchanted Shimmer. The band features a sparkling gem front that boasts of sparkling jewels shaped into a row of flowers. A soft ribbon ties at the back and changes color depending upon the size ordered! Perfect for photos, pageants, recitals, and holidays! |,|$38.00$|,||,|ENCHANTED-SHIMMER-ROSEBUD-GIRLS-HAIR-ACCESSORY|,|$URL$enchanted-shimmer-rosebud-girls-hair-accessory.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-rosebud-girls-hair-accessory-17.jpg||-||Enchanted Shimmer Ruby Ruffle Headband for Girls|,|Sure to be a big hit for the winter season, this new girls headband comes from Enchanted Shimmer. The band boasts of a front dazzling with red and silver gems that catch the light to gleam with her every step. This accessory stretches to fit around her head and is meant to be worn across the forehead. The sheer white fabric is ruffled all the way around and a small scallop pattern creates the edge. |,|$29.00$|,||,|ENCHANTED-SHIMMER-RUBY-RUFFLE-HEADBAND-GIRLS|,|$URL$enchanted-shimmer-ruby-ruffle-headband-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-ruby-ruffle-headband-for-girls-1.jpg||-||Enchanted Shimmer Ruffled Romper for Infant Girls|,|^|Draped in elegance, this fabulous new baby girls romper comes from designer Enchanted Shimmer. The softy ivory shade is a sophisticated compliment to her skin while the fabric is created with stretch for the perfect, easy fit. Tiers of sheer ivory ruffles fall from the top to the bottom hem. The strapless neckline is held with a thin band of elastic. The sweet ivory lace and dusty rose chiffon flower pin is placed off centered on the top. Shining gems and rich plumage decorate the accessory. Created in the USA with 100% polyester. Machine wash on delicate, line dry. SIZE 0-6 MOS ONLY LEFT.  ^||,|$78.00$|,||,|ENCHANTED-SHIMMER-RUFFLED-ROMPER-INFANT-GIRLS|,|$URL$enchanted-shimmer-ruffled-romper-infant-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-ruffled-romper-for-infant-girls-1.jpg||-||Enchanted Shimmer Waverly Tie Back Band for Girls|,|^|Unlike any other accessory she has, this fabulous tie back band comes from Enchanted Shimmer. The sparkling accessory boasts of four rows of small jewels that are shaped in an elegant and dainty wave. A soft velvet ribbon tie creates an individual fit for all who wear them. This tie changes color depending on which size you order. ADULT ONLY LEFT.  ^||,|$38.00$|,||,|ENCHANTED-SHIMMER-WAVERLY-TIE-BACK-BAND-GIRLS|,|$URL$enchanted-shimmer-waverly-tie-back-band-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/enchanted-shimmer-waverly-tie-back-band-for-girls-1.jpg||-||Faith Knight Pencil Bag for Girls in Pink Zebra|,|Decorated with sparkling pink jewels, this new girls pencil bag will stir up the classroom. The soft outer shell features a pink zebra print while the single compartment inside is perfect for holding all her pencils, pens, and markers for the school year! Made to match other Faith Knight items. |,|$9.00$|,||,|FAITH-KNIGHT-PENCIL-BAG-PINK-ZEBRA|,|$URL$faith-knight-pencil-bag-pink-zebra.html|,|http://ep.yimg.com/ay/yhst-17102259411242/faith-knight-pencil-bag-for-girls-in-pink-zebra-13.jpg||-||Faith Knight Sweet Flower Pencil Bag for Girls|,|With a soft, light cream outer shell, this new girls pencil bag from Faith Knight is the perfect school accessory. The lime and pink flower print is slightly raised, while the top features an easy use full length zipper. The inside boasts of plenty of room for all of her pencils and markers. Matches a backpack and lunch box. |,|$9.00$|,||,|FAITH-KNIGHT-FLOWER-PENCIL-BAG-GIRLS|,|$URL$faith-knight-flower-pencil-bag-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/faith-knight-sweet-flower-pencil-bag-for-girls-13.jpg||-||Faith Knight Wild Zebra Girls Pencil Bag|,|The final piece to her wild zebra set, this new girls pencil bag is too adorable! The soft zebra print is adorned with a single pink sequin heart and boa feathers. A full length top zipper opens up to a single compartment perfect for all her school utensils! |,|$9.00$|,||,|FAITH-KNIGHT-WILD-ZEBRA-PENCIL-BAG|,|$URL$faith-knight-wild-zebra-pencil-bag.html|,|http://ep.yimg.com/ay/yhst-17102259411242/faith-knight-wild-zebra-girls-pencil-bag-13.jpg||-||Fall Blossom Fancy Headband for Girls|,|^|Welcoming the fall season in with bright color, this new designer headband was handmade to match the Giggle Moon fall collection ""Fall Blossom."" The soft black lace features subtle scalloped edges and the perfect amount of stretch to fit around her head. The flower builds upon a bed of satin lime petals, contrasting with a beautiful coral pink. The center of the flower is a shimmering jewel while a sheer brown flower sits off to the side. All flowers are finished with heat treated edges. ^||,|$14.00$|,||,|FALL-BLOSSOM-FANCY-HEADBAND-GIRLS|,|$URL$fall-blossom-fancy-headband-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/fall-blossom-fancy-headband-for-girls-3.jpg||-||Fancy Girls Headband Matching Giggle Moon Happy and Joyful|,|^|Handmade to go with her fabulous new Giggle Moon outfits, this new boutique headband is ready for any occasion. The bright fuchsia band stretches with its elastic and is adorned by a cute ruffle. Three large flowers create a sweet garden with mixed textures. The black lace flower is adorned by a gem center while the two pink flowers are placed on a bed of black boa feathers. LARGE (4-ADULT) ONLY LEFT.  ^||,|$27.00$|,||,|FANCY-GIRLS-HEADBAND-MATCHING-GIGGLE-MOON-HAPPY-JOYFUL|,|$URL$fancy-girls-headband-matching-giggle-moon-happy-joyful.html|,|http://ep.yimg.com/ay/yhst-17102259411242/fancy-girls-headband-matching-giggle-moon-happy-and-joyful-3.jpg||-||Five Loaves Two Fish Soloist Tween Dress Black and White|,|^|An adorable new arrival from designer Five Loaves Two Fish, this tween dress can easily accompany her to any event! The bodice offers her long sleeves and a solid black that looks great paired with almost any color of accessories. The waist is accented by a sash that ties in bow on her back. The striped skirt falls in a classic A line and features a bold mix between white and black. Made in the USA. Bodice: cotton-jersey knit, allow for some stretch. Skirt: 100% cotton. Wash on cold, inside out. Line dry or tumble dry on low heat. SIZE 10 AND (1) 12 ONLY.  ^||,|$39.00$|,||,|FIVE-LOAVES-TWO-FISH-SOLOIST-TWEEN-DRESS-BLACK-WHITE|,|$URL$five-loaves-two-fish-soloist-tween-dress-black-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/five-loaves-two-fish-soloist-tween-dress-black-and-white-2.jpg||-||Flower Girls Headband in Ivory and White|,|An elegant beauty, this new fabulous girls headband is the ideal wedding accessory for your flower girl! The headband features a garden of fabric flowers with a few small touches of pearl bead decorations. The blooms are placed upon an ivory crochet lace bed accented with white wispy threads. The stretch lace is soft and comfortable upon her head. The crowning achievement of this accessory is this fabulous ivory and white color scheme that makes this headband easy to match with her dress while filled with timeless elegance! |,|$29.00$|,||,|FLOWER-GIRLS-HEADBAND-IVORY-WHITE|,|$URL$flower-girls-headband-ivory-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flower-girls-headband-in-ivory-and-white-1.jpg||-||Flowers By Zoe 86 Tween Comic Book Dress|,|^|A truly unique blend, this new tween dress from Flowers By Zoe is unlike any other. The bodice offers a scoop neckline framed in spaghetti straps and lined with silver studs. The white and gray-blue clouded stonewash print is contrasted with touches of vibrant yellow and neon pink. The skirt opens in shape and is paneled in different fabrics. The loved comic book print is found next two a football jersey fabric that features a large ""86"". Created with rayon or rayon blend fabrics. Hand wash with care and line dry. Flowers By Zoe runs small. Please order one size up. SMALL (7/8) AND XLARGE (12/14) REMAINING.  ^||,|$54.00$|,||,|FLOWERS-BY-ZOE-86-TWEEN-COMIC-BOOK-DRESS|,|$URL$flowers-by-zoe-86-tween-comic-book-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-86-tween-comic-book-dress-1.jpg||-||Flowers By Zoe 86 Tween Top|,|^|A new top from Flowers By Zoe, this shirt comes from their spring and summer collection filled with a super hero comic print. The front of the top resembles a sports jersey. The large 86 found on the front is accented with the double stripes found on the short sleeves. The back of the top is filled with bold lines, words, and colors has it takes on a true comic book feel. The shirt has a slight high low hemline. Created with rayon or rayon blend fabrics. Hand wash with care and line dry. Flowers By Zoe runs small. Please order one size up. ^||,|$28.50$|,||,|FLOWERS-BY-ZOE-86-TWEEN-TOP|,|$URL$flowers-by-zoe-86-tween-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-86-tween-top-1.jpg||-||Flowers By Zoe American Flag Girls Tank Top|,|^|Filled with patriotic spirit, this new designer girls tank comes from Flowers By Zoe. The top boasts of a black front and a solid white back. The distressed screen print that covers the front is a classic American flag. Small touches of gems accent the piece as they sparkle in the light. The jewel cut neckline is framed with wide shoulders while the shirt is finished with a trendy hi-low hemline. Created with rayon or rayon blend fabrics. Hand wash with care and line dry. Flowers By Zoe runs small. Please order one size up. (1) SMALL (7/8) REMAINING.  ^||,|$29.00$|,||,|FLOWERS-BY-ZOE-AMERICAN-FLAG-GIRLS-TANK-TOP|,|$URL$flowers-by-zoe-american-flag-girls-tank-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-american-flag-girls-tank-top-1.jpg||-||Flowers By Zoe Animal Print Chiffon Tween Top with Pant|,|^|A truly unique look, this new tween outfit is from Flowers By Zoe. The sheer chiffon top boasts of its fun animal print, and open lace back. The long sleeves feature elastic at the cuffs to create a slight bubble. Paired with velour pants in a hazy grey, offering back pockets, belt loops, and an elastic waist. Hand wash both pieces and hang to dry. Flowers by Zoe runs small, please consider ordering one size up.  ^||,|$49.00$|,||,|FLOWERS-BY-ZOE-ANIMAL-PRINT-CHIFFON-TWEEN-TOP-PANT|,|$URL$flowers-by-zoe-animal-print-chiffon-tween-top-pant.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-animal-print-chiffon-tween-top-with-pant-11.jpg||-||Flowers by Zoe Aztec Top with Peace Sign Cutout Back|,|^|This fun new top for tweens has just arrived from Flowers By Zoe and is simply perfect for summer! The sleeveless tank is covered with a black aztec print. The white background is clouded with purples and yellows. The back features a cool peace sign cut out that is unlike anything else she has. The high low hemline makes this top easy to pair with fitted skinnies or sweet denim shorts. 100% rayon. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. SIZE SMALL (7/8) AND XLARGE (12/14) ONLY LEFT.  ^||,|$29.25$|,||,|FLOWERS-BY-ZOE-AZTEC-TOP-PEACE-SIGN-CUTOUT-BACK|,|$URL$flowers-by-zoe-aztec-top-peace-sign-cutout-back.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-aztec-top-with-peace-sign-cutout-back-1.jpg||-||Flowers By Zoe Beaded Heart Army Top for Tweens|,|^|In command of great style, this new tween sweatshirt from Flowers By Zoe will be her go to top for warmth and style. The sweatshirt boasts of raw edged detailing and an original green army camo print. The top of the long sleeves are embellished by a subtle bronze stripe. A small beaded heart in bronze is found on the left side of the front. Made with 100% rayon, hand wash only. Line dry. Please note that Flowers By Zoe runs small, please consider ordering a size up.  ^||,|$33.00$|,||,|FLOWERS-BY-ZOE-BATWING-ARMY-TOP-TWEENS|,|$URL$flowers-by-zoe-batwing-army-top-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-beaded-heart-army-top-for-tweens-3.jpg||-||Flowers by Zoe Black Dress with Jewelled Accents|,|^|Ready for almost any occasion, this new Flowers By Zoe tween dress is unique and stylish. The black dress features a high low hemline hitting above her knee. A draw string waist adds shape to the dress and allows for a custom fit. The v neckline is sleeveless while the shoulders are lined with colorful, large gems. Pair easliy with leggings! Made with rayon blend. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. ^||,|$43.50$|,||,|FLOWERS-BY-ZOE-BLACK-DRESS-JEWELLED-ACCENTS|,|$URL$flowers-by-zoe-black-dress-jewelled-accents.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-black-dress-with-jewelled-accents-1.jpg||-||Flowers By Zoe Black Knit Tween Sweater|,|^|Keeping her warm in style, this new tween sweater is designer by Flowers By Zoe. The black and grey knit receives a small touch of sparkle with quaint bits of metallic gold threading. The long sleeves boast of sequin elbow pads. Hand wash. Flowers by Zoe runs small, please consider ordering one size up. SIZE MEDIUM 10 LEFT.  ^||,|$19.00$|,||,|FLOWERS-BY-ZOE-BLACK-KNIT-TWEEN-SWEATER|,|$URL$flowers-by-zoe-black-knit-tween-sweater.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-black-knit-tween-sweater-14.jpg||-||Flowers By Zoe Black Legging for Girls Wink|,|^|These Flowers By Zoe leggings are sure to be loved from the moment she spots them. The black fabric has a comfortable stretch in its fit while the waistband is fashioned with elastic. Both legs are finished at a capri length, perfect for the warmer days under the sun. The unique character of these leggings is introduced at her knees. A white screen print accented with small gems create the winking eye. Pair these leggings with almost any fun tops and skirts in her wardrobe! Created with rayon or rayon blend fabrics. Hand wash with care and line dry. Flowers By Zoe runs small. Please order one size up. SIZE XLARGE 12/14 ONLY LEFT. ^||,|$28.50$|,||,|FLOWERS-BY-ZOE-BLACK-LEGGING-GIRLS-WINK|,|$URL$flowers-by-zoe-black-legging-girls-wink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-black-legging-for-girls-wink-1.jpg||-||Flowers By Zoe Black Mini-Skirt with Gold Sequins|,|^|New from Flowers By Zoe, pair this fabulous tween skirt with many of her favorite tops for a vast amount of unique trendy outfits. The black rayon skirt allows some stretch and offers a shorter style. The beaded design running across the front is a shimmering gold while pairing some cute leggings underneath will add a bit of warmth. Hand wash and line dry. Flowers by Zoe runs small, please consider ordering one size up. SM (7-8) ONLY REMAINING. ^||,|$19.00$|,||,|FLOWERS-BY-ZOE-SHORT-BLACK-SKIRT-GOLD-SEQUINS|,|$URL$flowers-by-zoe-short-black-skirt-gold-sequins.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-short-black-skirt-with-gold-sequins-14.jpg||-||Flowers By Zoe Black Party Dress with Sequin Waist|,|^|A tasteful dose of subtle elegance, Flowers By Zoe now offers this timeless tween dress. The sleeveless bodice allows slight stretch in its fit while the solid black fabric can be paired with almost any accessory! The empire waist is accented with a shimmering criss-cross design created by silver sequins. The solid skirt loosens in fit. Pair with classy shoes and a great shrug for a style that won't be easily forgotten. Made with rayon blend. Hand wash cold, line dry. Please note that the Flowers By Zoe brand runs small. Please consider ordering a size up. SIZE MD (10) ONLY REMAINING. ^||,|$34.00$|,||,|FLOWERS-BY-ZOE-BLACK-PARTY-DRESS-SEQUIN-WAIST|,|$URL$flowers-by-zoe-black-party-dress-sequin-waist.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-black-party-dress-with-sequin-waist-2.jpg||-||Flowers by Zoe Camp Top in Purple|,|^|Will she be heading off to camp this summer? This fun new designer top from Flowers By Zoe is sure to send her off in style! The lavender shade has a sweet, calming look while the back flutters from cute drape of fabric. The front is completed devoted to the large screen print that spells ""camp."" A rainbow heart replaces the ""a."" Made with soft, comfortable rayon. Hand wash cold water, line dry. Flowers By Zoe runs small. Please order one size up.  ^||,|$25.50$|,||,|FLOWERS-BY-ZOE-CAMP-TOP-PURPLE|,|$URL$flowers-by-zoe-camp-top-purple.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-camp-top-in-purple-1.jpg||-||Flowers by Zoe Capri Set with Smiley Faces|,|^|A cute new creation from designer Flowers By Zoe, this tween outfit is a blend of old and new. The tank top offers a hi-low, sharkbite hemline. Retro inspiration creeps in with the rainbow daisy crown that is found on the large smiley face. The back of the top is covered with a smiley white print. The matching leggings are worn beneath and are cut for a capri fit. Top: 100% rayon. Leggings: Made with rayon blend. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. MEDIUM (10) AND LARGE (10/12) ONLY AVAILABLE.  ^||,|$59.00$|,||,|FLOWERS-BY-ZOE-CAPRI-SET-SMILEY-FACES|,|$URL$flowers-by-zoe-capri-set-smiley-faces.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-capri-set-with-smiley-faces-1.jpg||-||Flowers by Zoe Cat Tank Top in Grey|,|^|Hitting on a hot trend, this new Flowers By Zoe tank boasts of cat fever! The grey fabric is easily paired with most anything in her closet while allowing slight stretch in its comfortable fit. The large cat screen print is given a bold touch of color with the bright sunglasses. Pair this cool cat with a pair of rainbow shorts available in their summer line. The back of the tank features a cut out too. Cotton. Hand wash cold water, line dry. Flowers By Zoe runs small. Please order one size up.  ^||,|$25.50$|,||,|FLOWERS-BY-ZOE-CAT-TANK-TOP-GREY|,|$URL$flowers-by-zoe-cat-tank-top-grey.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-cat-tank-top-in-grey-1.jpg||-||Flowers by Zoe Chevron Girls Shorts and Sunglass Tank|,|^|The hottest color this summer, mint green star of this new tween top and short set from Flowers By Zoe. The sleeveless tank boasts of a large cut out upon the back and a colorful sunglass screen print found on the front. Found beneath the top, the white shorts have a stretch waist fit. Colorful chevron stripes race across the shorts with a few matching studs. Summer ready and comfortable in no time. Cotton top with rayon shorts. Hand wash cold water, line dry. Flowers By Zoe runs small. Please order one size up. LARGE (10/12) ONLY REMAINING.  ^||,|$51.00$|,||,|FLOWERS-BY-ZOE-CHEVRON-GIRLS-SHORTS-SUNGLASS-TANK|,|$URL$flowers-by-zoe-chevron-girls-shorts-sunglass-tank.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-chevron-girls-shorts-and-sunglass-tank-1.jpg||-||Flowers By Zoe Chiffon Dress for Tweens Blue Ombre|,|^|A beautiful new design, this fabulous tween party dress comes from Flowers By Zoe. The sleeveless bodice boasts of a blouson fit provided by the draw string waist. A cute bow ties at the front of the waist while the collared neckline is sleeveless. The light weight fabric flows in the breeze while the ombre fade turns to blue. The skirt of this dress is ended with a shirt-tail hemline. Created with rayon or rayon blend fabrics. Hand wash with care and line dry. Poly/Rayon. Hand wash cold. Flowers By Zoe runs small. Please order one size up. SIZE MEDIUM (10) AND LARGE (10/12) ONLY LEFT.  ^||,|$55.50$|,||,|FLOWERS-BY-ZOE-CHIFFON-DRESS-TWEENS-BLUE-OMBRE|,|$URL$flowers-by-zoe-chiffon-dress-tweens-blue-ombre.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-chiffon-dress-for-tweens-blue-ombre-1.jpg||-||Flowers by Zoe Chiffon Dress Jeweled in White|,|^|A stand out design from Flowers By Zoe, this off white summer dress is easy to fall in love with quickly. The bodice has an empire waist decorated with rows of sequins and gems creating a beautiful design. Elegant chiffon falls from her waist to create a graceful skirt that flows with her every move. The skirt is lined in a comfortable fabric. She will be ready for summer weddings, family photos or dinner in a flash. Rayon/spandex/polyester. Hand wash cold water, line dry. Flowers By Zoe runs small. Please order one size up. SIZE 4 AND LARGE (10/12) ONLY LEFT. ^||,|$64.50$|,||,|FLOWERS-BY-ZOE-CHIFFON-DRESS-JEWELED-WHITE|,|$URL$flowers-by-zoe-chiffon-dress-jeweled-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-chiffon-dress-jeweled-in-white-1.jpg||-||Flowers By Zoe Cold Shoulder Top with Black Tank|,|^|Hitting the top trend for fall with a twist, designer Flowers By Zoe always delivers great style. The sheer chiffon top boasts of a white star print and a flutter short sleeves boasting of their lace insets and cold shoulder details. Paired with a solid black tank underneath. Tank: 100% cotton, Chiffon Top: 100% polyester. Hand wash both items. SM (7-8) ONLY AVAILABLE. ^||,|$39.00$|,||,|FLOWERS-BY-ZOE-COLD-SHOULDER-CHIFFON-TOP-BLACK-TANK|,|$URL$flowers-by-zoe-cold-shoulder-chiffon-top-black-tank.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-cold-shoulder-top-with-black-tank-14.jpg||-||Flowers By Zoe Comic Book Tank Top|,|^|Created by Flowers By Zoe, this new summer top is available in tween sizes. The white tank is cut for a fitted look while the fabric allows slight stretch in its fit. The longer cut makes it great for layering even past the summer season. The action print is inspired by the comic book style. Bold greens, pinks, blues, and yellows are blended in this pattern to fill the clouds and words. Created with rayon or rayon blend fabrics. Hand wash with care and line dry. Flowers By Zoe runs small. Please order one size up. ^||,|$29.00$|,||,|FLOWERS-BY-ZOE-COMIC-BOOK-TANK-TOP|,|$URL$flowers-by-zoe-comic-book-tank-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-comic-book-tank-top-1.jpg||-||Flowers By Zoe Comic Print Girls Skirt|,|^|Positively adorable, this new tween mini skirt from Flowers By Zoe is sure to be envied by her friends. The skirt boasts of a fitted cut provided by fabric that allows stretch in its fit. The rich and bold screen print covers the piece with its ""zooms,"" ""pows,"" and ""wows."" Thought bubbles, explosive stars, and bright colors create the perfect look to this design. Pair this skirt with any of the new leggings and tops. Created with rayon or rayon blend fabrics. Hand wash with care and line dry. Flowers By Zoe runs small. Please order one size up. XLARGE (12/14) ONLY LEFT. ^||,|$29.25$|,||,|FLOWERS-BY-ZOE-COMIC-PRINT-GIRLS-SKIRT|,|$URL$flowers-by-zoe-comic-print-girls-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-comic-print-girls-skirt-1.jpg||-||Flowers by Zoe Coral Top with Tie Dye Pom Pom Skirt|,|^|A new design for spring and summer, this fabulous tween outfit comes from trendy designer Flowers By Zoe. The crop top is in a bright coral shade and boasts of a sleeveless neckline decorated with large white gems. A tie dye skirt is paired just beneath. Three tiers wrap around her legs finished with colorful pom poms. The skirt and top both have pull on fits and their fabrics allow slight stretch in fit. Top: Made with rayon blend. Skirt: 100% rayon. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. SIZES LARGE (10/12) AND XLARGE (12/14) ONLY REMAINING. ^||,|$64.50$|,||,|FLOWERS-BY-ZOE-CORAL-TOP-TIE-DYE-POM-POM-SKIRT|,|$URL$flowers-by-zoe-coral-top-tie-dye-pom-pom-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-coral-top-with-tie-dye-pom-pom-skirt-11.jpg||-||Flowers by Zoe Crop Top with Long Skirt|,|^|A unique tween outfit from Flowers By Zoe, this new arrival is lots of fun! The neon tie dye print covers the sleeveless top while large gems accent the wide neckline. The top is shorter with its cropped hemline. The long maxi skirt is paired beneath. The waistline stretches with elastic. The cool pink shade is a fun color that stands apart this spring and summer. Top: Made with rayon blend. Skirt: 100% rayon. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. SIZE SMALL (7/8) AND LARGE (10/12) ONLY LEFT.  ^||,|$59.25$|,||,|FLOWERS-BY-ZOE-CROP-TOP-LONG-SKIRT|,|$URL$flowers-by-zoe-crop-top-long-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-crop-top-with-long-skirt-11.jpg||-||Flowers by Zoe Daisy Fringe Skirt with Top|,|^|Easy going and fun, this new tween outfit from designer Flowers By Zoe will certainly catch her eye. The white top is shaped by the hemline gathered with a stretch elastic. The neckline has short, batwing sleeves. Large studs sit upon both shoulders. The grey skirt that is paired beneath is covered with a white daisy print. The skirt is finished with long, flowing fringe. 100% rayon. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. ^||,|$55.50$|,||,|FLOWERS-BY-ZOE-DAISY-FRINGE-SKIRT-TOP|,|$URL$flowers-by-zoe-daisy-fringe-skirt-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-daisy-fringe-skirt-with-top-1.jpg||-||Flowers by Zoe Daisy Shorts and Chiffon Top|,|^|A sophisticated style for your stylish tween, this new spring outfit for girls comes from Flowers By Zoe. The sheer chiffon top has a sleeveless, scoop neckline and fabric that ties in a knot on the hemline. A row of buttons fasten in the front while small pleats in the back open of the fit just slightly. A matching skirt is worn beneath offering a stretch waistline. The fun daisy print finishes with a double ruffle hemline. Top: 100% polyester. Shorts: 100% polyester. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. MEDIUM (10) AND XLARGE (12/14) ONLY LEFT.  ^||,|$44.25$|,||,|FLOWERS-BY-ZOE-DAISY-SHORTS-CHIFFON-TOP|,|$URL$flowers-by-zoe-daisy-shorts-chiffon-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-daisy-shorts-and-chiffon-top-1.jpg||-||Flowers by Zoe Daisy Tank with High Low Hem and Capri|,|^|Another wonderful daisy creation, this new tween top and legging set comes from Flowers By Zoe. The sleeveless lack top offers her a hi-low hemline and a light grey back. Large white flowers with shimmering centers dress the front. Solid white leggings come with the top and are worn beneath. The capris feature a stretch fit with a comfortable elastic waistline. Top: 100% rayon. Leggings: Made with rayon blend. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. MEDIUM (10) ONLY LEFT. ^||,|$54.00$|,||,|FLOWERS-BY-ZOE-DAISY-TANK-HIGH-LOW-HEM-CAPRI|,|$URL$flowers-by-zoe-daisy-tank-high-low-hem-capri.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-daisy-tank-with-high-low-hem-and-capri-1.jpg||-||Flowers by Zoe Denim Vest with Daisies|,|^|Going with so many new arrivals from Flowers By Zoe, this fabulous tween denim jacket is a must have for spring and summer. The medium wash vest features raw edges on her shoulders and sweet white daisy appliques that are blooming on the top. A row of classic metal buttons fasten in the front while two flap pockets are the perfect style. Small tucks and a fitted hemline give this vest the perfect, trendy shape. Made with cotton blend. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. ^||,|$43.50$|,||,|FLOWERS-BY-ZOE-DENIM-VEST-DAISIES|,|$URL$flowers-by-zoe-denim-vest-daisies.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-denim-vest-with-daisies-1.jpg||-||Flowers by Zoe Designer Leopard Print Leggings|,|^|Easy to pair with many of the new tops found in her fall wardrobe, these patterned tween leggings come from Flowers By Zoe. The leggings have a comfortable stretch fit and feature an elastic waist. The leggings are covered with a fun leopard print in snow white. The leggings are styled with a longer length, perfect for the colder months! Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. ^||,|$38.00$|,||,|FLOWERS-BY-ZOE-DESIGNER-LEOPARD-PRINT-LEGGINGS|,|$URL$flowers-by-zoe-designer-leopard-print-leggings.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-designer-leopard-print-leggings-1.jpg||-||Flowers by Zoe Fancy Girls Fur Vest|,|^|A fun design she is sure to love, this tween vest comes from Flowers By Zoe, a trendy brand that is adored by many. The vest is lined in solid black fabric. The shaggy faux fur covers the vest in textured black and white. Wear this piece with any of the new tops or dresses from the fall and winter pieces! Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. ^||,|$46.00$|,||,|FLOWERS-BY-ZOE-FANCY-GIRLS-FUR-VEST|,|$URL$flowers-by-zoe-fancy-girls-fur-vest.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-fancy-girls-fur-vest-1.jpg||-||Flowers By Zoe Flag Cropped Legging with Distressed Accents|,|^|Matching the fabulous new American tops, Flowers By Zoe introduces these leggings as a part of their summer collection. The grey leggings have a great, comfortable fit. The front of both legs is dressed with a distressed stars and stripe screen print. The classic red, white, and blue is perfect for the Fourth of July! For the perfect pair, check out the ""Flowers By Zoe Gray Tank Top American Flag""! Created with rayon or rayon blend fabrics. Hand wash with care and line dry. Flowers By Zoe runs small. Please order one size up. SIZE XLARGE (12/14) ONLY LEFT. ^||,|$29.00$|,||,|FLOWERS-BY-ZOE-FLAG-CROPPED-LEGGING-DISTRESSED-ACCENTS|,|$URL$flowers-by-zoe-flag-cropped-legging-distressed-accents.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-flag-cropped-legging-with-distressed-accents-1.jpg||-||Flowers By Zoe Flag Tween Maxi Dress|,|^|A true Flowers By Zoe design, this trendy tween maxi dress is perfect for any summer celebration, especially the Fourth of July. The casual gray dress boasts of its long flowing fit and high low hemline. The scoop neckline is sleeveless while offering a racer back cut. Large gems are found falling from both shoulders, catching the light as it shimmers. The front of the dress is covered with a faded screen print boasts of stars and stripes. The distressed design creates a unique feel to her patriotic dress! Created with rayon or rayon blend fabrics. Hand wash with care and line dry. Flowers By Zoe runs small. Please order one size up. ^||,|$44.25$|,||,|FLOWERS-BY-ZOE-FLAG-TWEEN-MAXI-DRESS|,|$URL$flowers-by-zoe-flag-tween-maxi-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-flag-tween-maxi-dress-17.jpg||-||Flowers by Zoe Fringe Skirt and Neon Top for Tweens|,|^|Filling the summer line with bright neon pink, Flowers By Zoe creates trendy tween clothing that cannot be ignored. This bright top is a cropped cut with a sleeveless neckline. A unique design is created from the sequins that shimmer upon the front. The coordinating skirt is a soft gray on the front, featuring the same sparkling design. Long fringe is used to make the hemline dance with the breeze. The back of the skirt is also neon pink. Rayon/spandex. Hand wash cold water, line dry. Flowers By Zoe runs small. Please order one size up. XLARGE (12/14) ONLY LEFT.  ^||,|$63.00$|,||,|FLOWERS-BY-ZOE-FRINGE-SKIRT-AND-NEON-TOP-TWEENS|,|$URL$flowers-by-zoe-fringe-skirt-and-neon-top-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-fringe-skirt-and-neon-top-for-tweens-1.jpg||-||Flowers By Zoe Girls Burn Out Top with Legging|,|^|Turn an ordinary day in to something exquisite, this tween outfit is perfect for school and comes from trendy Flowers By Zoe. The long sleeve burn out top is in a rich turquoise shad and boasts of its classic button up style, collar neckline, and button cuff long sleeves that can roll up. The paired leggings blend unexpected colors together in a chevron pattern. Top:100% rayon. Legging: Rayon spandex blend. Hand wash both pieces and hang to dry. Please note that Flowers By Zoe runs small, please consider ordering a size up.  ^||,|$38.00$|,||,|FLOWERS-BY-ZOE-GIRLS-BURN-OUT-TOP-LEGGING|,|$URL$flowers-by-zoe-girls-burn-out-top-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-girls-burn-out-top-with-legging-3.jpg||-||Flowers by Zoe Girls Classy Black Pants with White Pleather|,|^|Looking fabulous with the new tops from the fall and winter collection, this new skinny pant was designed by Flowers By Zoe. The pants boast of a fitted look that pairs wonderfully with many different types of tops. The pleather is a popular fabric for the season. A bold white stripe runs down the outer side of both legs while the stretch fit waist is comfortable as can be. Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. ^||,|$58.00$|,||,|FLOWERS-BY-ZOE-GIRLS-CLASSY-BLACK-PANTS-WHITE-PLEATHER|,|$URL$flowers-by-zoe-girls-classy-black-pants-white-pleather.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-girls-classy-black-pants-with-white-pleather-1.jpg||-||Flowers By Zoe Girls Heart Top with Zippers|,|^|Flowers By Zoe has created this new long sleeve top for your trendy tween this fall. The black top is made with a soft, comfortable fabric. Two faux zippers accent the front at the base of both shoulders. A large quilted pleather heart applique is found front and center in cool silver. This top is both stylish and perfect for school. Matches to a new pair of silver pleather shorts also from Flowers By Zoe. 100% Rayon. Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. (1) LARGE (10/12) ONLY LEFT. ^||,|$39.00$|,||,|FLOWERS-BY-ZOE-GIRLS-HEART-TOP-ZIPPERS|,|$URL$flowers-by-zoe-girls-heart-top-zippers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-girls-heart-top-with-zippers-1.jpg||-||Flowers by Zoe Girls Jean Shorts with Daisy Trim|,|^|These new tween denim shorts are from designer Flowers By Zoe and are sure to be loved by any tween girl! The shorts feature a medium wash, aged by fading and whiskering on the front. The raw edge hemline seals the deal while a classic button-zipper fly and belt loops give her a comfortable, sure fit. The front of the shorts are dressed with white daisy appliques complete with sunshine yellow centers. Pair these tween shorts to the new ""Daisy Tank Top in Black"" for the perfect pair! Made with cotton blend. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. MEDIUM (10) AND LARGE (10/12) ONLY LEFT. ^||,|$34.50$|,||,|FLOWERS-BY-ZOE-GIRLS-JEAN-SHORT-DAISY-TRIM|,|$URL$flowers-by-zoe-girls-jean-short-daisy-trim.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-girls-jean-shorts-with-daisy-trim-1.jpg||-||Flowers by Zoe Girls Short Set|,|^|Oversized for a comfortable fit, this new Flowers By Zoe short set is part of their spring and summer collections. The top features a gray cloud print with touches of pink at the neckline and blue near the hem. The large arm holes drape on the side to create a shark bite hemline while a neon print is layered beneath. The black shorts offer a zipper and button fly and neon tie dye leggings peaking out from the hem. Large gems are found decorating her left leg. Top: 100% rayon. Shorts: Made with cotton blend. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. MEDIUM (10) ONLY LEFT. ^||,|$66.00$|,||,|FLOWERS-BY-ZOE-GIRLS-SHORT-SET|,|$URL$flowers-by-zoe-girls-short-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-girls-short-set-11.jpg||-||Flowers By Zoe Girls Summer Outfit in Black with Coral Flowers|,|^|An adorable outfit, this new creation comes from the beloved designer Flowers By Zoe. The long top boasts of a high low hemline and contrast cap sleeves. The shoulders are decked out in sequins that sparkle in the light. The black and white stripe print is covered with coral roses upon the front and the back. Paired beneath this tunic we find solid black leggings that offer her comfort throughout the whole day. Created with rayon or rayon blend fabrics. Hand wash cold with care and line dry. Flowers By Zoe runs small. Please order one size up. SIZE LARGE (10/12) AND XLARGE (12/14) ONLY LEFT. ^||,|$59.00$|,||,|FLOWERS-BY-ZOE-GIRLS-SUMMER-OUTFIT-BLACK-CORAL-FLOWERS|,|$URL$flowers-by-zoe-girls-summer-outfit-black-coral-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-girls-summer-outfit-in-black-with-coral-flowers-11.jpg||-||Flowers By Zoe Girls Tank Dress with Sequin Chevron Front|,|^|For the sweet little girl who wants to shine this holiday. The sequin front chevron girls party dress by Flowers by Zoe is a must have this winter season. Whether youre celebrating a holiday or bringing in the New Year, this dress will have everyone talking! The fitted short cut style dress has a sleeveless neckline a subtle V-shape at the neck. Pair with a great pair of leggings and ballet flats for an adorable and elegant look. Made with rayon blend. Hand wash cold, line dry. Please note that the Flowers By Zoe brand runs small. Please consider ordering a size up. SIZE SMALL (7/8) AND XLARGE (12/14) ONLY LEFT. ^||,|$56.00$|,||,|FLOWERS-BY-ZOE-GIRLS-TANK-DRESS-SEQUIN-CHEVRON-FRONT|,|$URL$flowers-by-zoe-girls-tank-dress-sequin-chevron-front.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-girls-tank-dress-with-sequin-chevron-front-2.jpg||-||Flowers By Zoe Glittering Metallic Strappy Tween Dress|,|^|This strappy and fun tween dress from Flowers By Zoe is sure to be one of her favorites. The strappy bodice is done in black metallic with a decorative zipper in the center. The hi low skirt of pink chiffon flows from the empire waist. Decorative silver studs adorn the front of the skirt. A pink lining is found under the chiffon. Made from polyester/rayon. Hand wash cold, line dry. SIZE MEDIUM (10) AND LARGE (10/12) ONLY AVAILABLE.  ^||,|$29.00$|,||,|FLOWERS-BY-ZOE-GLITTERING-METALLIC-STRAPPY-TWEEN-DRESS|,|$URL$flowers-by-zoe-glittering-metallic-strappy-tween-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-glittering-metallic-strappy-tween-dress-14.jpg||-||Flowers By Zoe Gold Chevron Tween Dress|,|Looking for the perfect fun party dress for your tween? This Flowers by Zoe gold chevron dress is perfect for all holiday parties and to ring in the New Year! The sparkling bodice features a flattering scoop neck and simple cap sleeves. This darling dress features purple, black, gold and silver chevron stripes that dance around her upper half, while an open solid black skirt flows at the bottom. The sequins will catch the light at any angle! Made with rayon blend. Hand wash cold, line dry. Please note that the Flowers By Zoe brand runs small. Please consider ordering a size up. |,|$43.00$|,||,|FLOWERS-BY-ZOE-GOLD-CHEVRON-TWEEN-DRESS|,|$URL$flowers-by-zoe-gold-chevron-tween-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-gold-chevron-tween-dress-2.jpg||-||Flowers by Zoe Gold Sequin Shorts with Leopard Top|,|^|Flowers by Zoe hit a home run with this cool summer outfit for tweens! The top is a casual fit tank in white. Leopard spots cover the tank with small accents of sequins. The flutter back is made with draping sheer fabric. The second half of this gorgeous duo is the comfortable denim shorts with stunning gold sequins. Two pockets are found upon the back while a classic zipper and button combination fasten the waist. Add a cami or simple tank and she is ready for summer fun. Rayon top and Cotton/Spandex short. Hand wash cold water, line dry. Flowers By Zoe runs small. Please order one size up. XLARGE (12/14) ONLY REMAINING.  ^||,|$74.25$|,||,|FLOWERS-BY-ZOE-GOLD-SEQUIN-SHORTS-LEOPARD-TOP|,|$URL$flowers-by-zoe-gold-sequin-shorts-leopard-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-gold-sequin-shorts-with-leopard-top-1.jpg||-||Flowers by Zoe Gray Jewelled Girls Top|,|^|New from designer Flowers By Zoe, this tween girls top will easily match with many of her favorite skinny jeans or shorts this summer! The short sleeve top boasts of a soft, light weight fabric in stone gray. Textured with the stripes of natural fibers, the top is cut for a more relaxed fit. The short sleeves are decorated with large gems and small studs. 100% rayon. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. SIZE XLARGE (12/14) ONLY LEFT. ^||,|$36.00$|,||,|FLOWERS-BY-ZOE-GRAY-JEWELLED-GIRLS-TOP|,|$URL$flowers-by-zoe-gray-jewelled-girls-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-gray-jewelled-girls-top-11.jpg||-||Flowers by Zoe Gray Zip Jacket|,|^|Knit of gray rayon and spandex, this tween girls light weight jacket has pretty pink trim. Zip pockets, zip front closure, hand wash.ONLY ONE SIZE LARGE12/14 AVAILABLE ^||,|$19.00$|,||,|FLOWERS-BY-ZOE-GRAY-ZIP-JACKET|,|$URL$flowers-by-zoe-gray-zip-jacket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-gray-zip-jacket-7.jpg||-||Flowers By Zoe Jean Shorts with Stone Accents|,|^|Created for her sunny summer plans, this new denim short from Flowers By Zoe is a staple in any tween closet this season. The grey blue wash of the denim has a retro feel that is welcomed while the frayed hemline creates a casual look. The front of the shorts is speckled with ovals, circles, and diamonds shaped out of sequins. The shorts offer her the classic pockets and belt loops. A zipper and button fly secure the fit. These shorts are created with a cotton blend fabric. Hand wash and line dry. Flowers By Zoe runs small, please order one size up.  ^||,|$29.00$|,||,|FLOWERS-BY-ZOE-JEAN-SHORTS-STONE-ACCENTS|,|$URL$flowers-by-zoe-jean-shorts-stone-accents.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-jean-shorts-with-stone-accents-1.jpg||-||Flowers By Zoe Jeweled Neon Pink Hi Low Girls Dress|,|^|Jeweled to perfection, this girls dress from Flowers By Zoe is perfect for your princess. The sweetheart bodice of black is garnished with an array of colorful jewel accents that she will fall in love with. The back of the bodice features an open panel at the center adorned with four bows. The neon pink skirt has a hi low hemline. Made from rayon/spandex. Hand wash cold, line dry. SIZE MEDIUM (10) ONLY LEFT.  ^||,|$29.00$|,||,|FLOWERS-BY-ZOE-JEWELED-NEON-PINK-HI-LOW-GIRLS-DRESS|,|$URL$flowers-by-zoe-jeweled-neon-pink-hi-low-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-jeweled-neon-pink-hi-low-girls-dress-14.jpg||-||Flowers by Zoe Jewelled Top with Skirt|,|^|Flowers By Zoe is now offering this cute tween outfit as a part of their new line for the warmer months. The short sleeve top is cut for a more fitted look while offering short sleeves. Large, colorful gems cover the front and reflect the sun's rays. Paired with a bright coral skirt that is worn beneath. The skirt has a sheer overlay that moves with grace at her every step. The waistband stretches for a comfortable and easy fit. Top: Made with rayon blend. Skirt: 100% polyester. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. SIZE MEDIUM (10) AND XLARGE (12/14) ONLY LEFT.  ^||,|$69.00$|,||,|FLOWERS-BY-ZOE-JEWELLED-TOP-SKIRT|,|$URL$flowers-by-zoe-jewelled-top-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-jewelled-top-with-skirt-11.jpg||-||Flowers by Zoe Lace Dress for Girls|,|^|Flowers By Zoe has created this summer dress for girls as a part of their bright summer line! The dress is lined with a soft cotton knit that will keep her comfortable. The bright rainbow hand dyed color peeks out through the sweet white lace which adds a dressy look. The back of the dress features a large heart cut out. Created with a polyester-rayon blend. Hand wash cold water, line dry. Flowers By Zoe runs small. Please order one size up. SIZE 4 AND XL (12/14) ONLY LEFT.  ^||,|$46.50$|,||,|FLOWERS-BY-ZOE-LACE-DRESS-GIRLS|,|$URL$flowers-by-zoe-lace-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-lace-dress-for-girls-1.jpg||-||Flowers By Zoe Leopard Tween Sweat Pant and Peace Top|,|^|Filled with style and love, this unique tween outfit can be found only from designer Flowers By Zoe. The long sleeve top is covered with a rich rainbow top boasts of a cute screen print on her left sleeve. The back of the top shows support of peace while the elastic waist sweatpants are tightened by drawstrings. The wild animal print fades slowly into color as you reach the hem. 100% Rayon. Hand wash cold, line dry. SIZE MEDIUM (10) AND LARGE (10/12) ONLY LEFT.  ^||,|$48.00$|,||,|FLOWERS-BY-ZOE-LEOPARD-TWEEN-SWEAT-PANT-PEACE-TOP|,|$URL$flowers-by-zoe-leopard-tween-sweat-pant-peace-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-leopard-tween-sweat-pant-and-peace-top-22.jpg||-||Flowers by Zoe Little Girls Summer Dress in Pink|,|^|Matching to other great arrivals found within the summer line, this Flowers By Zoe party dress is available in sizes 4 to 6X. The dress is easy to wear with a pull over fit and slight stretch offered in the fabric. The empire bodice is a neutral grey graced with a sequin design. The skirt stands out in its bright shade of pink! Pair it with her favorite sandals for a dressy look or a pair of converse for everyday deliciousness! Flowers By Zoe runs small. Please order one size up. SIZE 4 AND 5 ONLY LEFT. ^||,|$55.50$|,||,|FLOWERS-BY-ZOE-TWEEN-SUMMER-DRESS-PINK|,|$URL$flowers-by-zoe-tween-summer-dress-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-little-girls-summer-dress-in-pink-1.jpg||-||Flowers By Zoe Little Girls Tunic with Zig Zag Legging|,|^|A fun new outfit for work or play, Flowers By Zoe is now offering this tunic set. The long sleeve tunic boasts only of its hi-low hem, long sleeves and soft rayon fabric. The screen print heart is full of character and matches the colorful zig zag print found on the paired leggings. A similar fabric creates these leggings but with a stretch for the perfect fit and look. Hand wash both pieces. Note that Flowers By Zoe Runs Small, Please Size Up. SIZE 4 ONLY LEFT.  ^||,|$39.00$|,||,|FLOWERS-BY-ZOE-HI-LOW-TWEEN-TUNIC-ZIG-ZAG-LEGGING|,|$URL$flowers-by-zoe-hi-low-tween-tunic-zig-zag-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-little-girls-tunic-with-zig-zag-legging-1.jpg||-||Flowers By Zoe Love Girls Summer Top|,|^|An eye catching new design, this fabulous Flowers By Zoe tween tank top is sure to become one of her most worn tops of the summer. The dark top boasts of a bold punch of comic book flavor that creates the heart print on the front. Large letters spell ""love"" while accented with matching studs. The overlay of the top boasts of an uneven hemline while a fun, fitted pattern lengthens the fit from underneath. Pairs beautifully with so many new leggings and shorts! Created with rayon or rayon blend fabrics. Hand wash with care and line dry. Flowers By Zoe runs small. Please order one size up. (1) MEDIUM (10) ONLY LEFT.  ^||,|$36.00$|,||,|FLOWERS-BY-ZOE-LOVE-GIRLS-SUMMER-TOP|,|$URL$flowers-by-zoe-love-girls-summer-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-love-girls-summer-top-1.jpg||-||Flowers By Zoe Love Girls Summer Top Short Sleeve|,|^|Designer Flowers By Zoe has developed a fabulous new collection inspired by super heroes. The white top features a large heart screen print found upon the front. This heart is filled with bold colors that are rivaled only by the bright yellow that fills the letters to spell ""love."" Matching studs are added as accents to the front. Touches of pink and yellow are found at the neckline and on both side seams. Created with rayon or rayon blend fabrics. Hand wash with care and line dry. Flowers By Zoe runs small. Please order one size up. (1) SMALL (7/8) ONLY LEFT. ^||,|$33.00$|,||,|FLOWERS-BY-ZOE-LOVE-GIRLS-SUMMER-TOP-SHORT-SLEEVE|,|$URL$flowers-by-zoe-love-girls-summer-top-short-sleeve.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-love-girls-summer-top-short-sleeve-1.jpg||-||Flowers by Zoe Love White Sweatpant|,|^|Designed by Flowers By Zoe, these tween sweatpants are ready for any fun activity she has planned. The white pants offer a draw string waist that is tied in the front. The elastic hem gathers the fabric of both legs and makes it easy for her to wear them cropped. A ""LOVE"" print is found running down the left leg with a yellow daisy replacing the ""O."" These match easily to other new arrivals from Flowers By Zoe! 100% rayon. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. MEDIUM (10) AND LARGE (10-12) ONLY. ^||,|$43.50$|,||,|FLOWERS-BY-ZOE-LOVE-WHITE-SWEATPANT|,|$URL$flowers-by-zoe-love-white-sweatpant.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-love-white-sweatpant-1.jpg||-||Flowers by Zoe Maxi Dress Aztec Print with Pom Poms|,|^|Created by Flowers By Zoe, this new tween dress is sure to have a memorable spring and summer in the sun. The strappy bodice has a soft ""u"" neckline. Fabric drapes down from the neckline to create the illusion of an empire waistline; small white pom poms are found dangling from the edge. The white, maxi dress for tweens is covered with a black aztec print and a small touch of cloudy color. 100% rayon. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. ^||,|$55.50$|,||,|FLOWERS-BY-ZOE-MAXI-DRESS-AZTEC-PRINT-POM-POMS|,|$URL$flowers-by-zoe-maxi-dress-aztec-print-pom-poms.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-maxi-dress-aztec-print-with-pom-poms-1.jpg||-||Flowers By Zoe Maxi Dress for Tweens Floral|,|^|New from Flowers By Zoe, this spring maxi dress is an adorable design. The long dress is covered with a black and white stripe print that changes from thin to thick. Fragrant coral roses fall upon the dress from the strappy neckline to the hem. The bodice of this dress is covered with a matching overlay that drapes gracefully. The hem of this overlay is finished with sweet dancing pom poms. Created with rayon or rayon blend fabrics. Hand wash with care and line dry. Flowers By Zoe runs small. Please order one size up. ^||,|$55.50$|,||,|FLOWERS-BY-ZOE-MAXI-DRESS-TWEENS-FLORAL|,|$URL$flowers-by-zoe-maxi-dress-tweens-floral.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-maxi-dress-for-tweens-floral-1.jpg||-||Flowers by Zoe Maxi Dress in Daisy Print|,|^|This new tween dress comes from the fabulous designer Flowers By Zoe. Flowers By Zoe is known for trendy looks and unique outfits; this hand dyed maxi dress is no differing! The rainbow dye is decorated with sweet daisies that boast of sparkling rhinestone centers. The bodice is a flowing, draped ruffle while the scoop neckline is framed with thin straps. The straps are adjustable for her own custom fit! Made with 100% Cotton. Hand wash cold water, line dry. Flowers By Zoe runs small. Please order one size up. SIZE (1) XLARGE (12/14) AVAILABLE.  ^||,|$55.50$|,||,|FLOWERS-BY-ZOE-MAXI-DRESS-DAISY-PRINT|,|$URL$flowers-by-zoe-maxi-dress-daisy-print.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-maxi-dress-in-daisy-print-1.jpg||-||Flowers By Zoe Mint Daisy and Striped Skirt Set|,|^|Minty fresh and just in time for spring, this skirt set is from Flowers By Zoe. The mint green top boasts of adjustable straps and sharkbite hemline. A large white daisy adorns the front and features a cluster of sequins at the center. The long skirt is striped with gray alternating with white, mint and lavender. Both garments are made from rayon. Hand wash, line dry. Flowers by Zoe runs small, please consider ordering one size up. SIZE MD (10) AND LARGE (10/12) ONLY REMAINING. ^||,|$39.00$|,||,|FLOWERS-BY-ZOE-MINT-DAISY-STRIPED-SKIRT-SET|,|$URL$flowers-by-zoe-mint-daisy-striped-skirt-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-mint-daisy-and-striped-skirt-set-16.jpg||-||Flowers By Zoe Misty Grey Studded Tween Jacket|,|^|From Flowers By Zoe and made to match their Misty Grey Studded Tween Shorts, she will adore this hooded jacket. Done in a soft misty grey, the jacket has a hood and long sleeves. It zips up the front and has pockets for her hands. A stripe of bright green studded with silver cone shapes runs down each sleeve. A large smiley face spreads happiness from the back of the jacket. Made from rayon. Hand wash cold, line dry. SIZE LARGE 10-12 ONLY AVAILABLE. ^||,|$29.00$|,||,|FLOWERS-BY-ZOE-MISTY-GREY-STUDDED-TWEEN-JACKET|,|$URL$flowers-by-zoe-misty-grey-studded-tween-jacket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-misty-grey-studded-tween-jacket-16.jpg||-||Flowers By Zoe Neon Coral Sequin Tween Dress|,|^|A shimmering addition to her summer wardrobe, this gorgeous coral tween dress comes from Flowers By Zoe. The sleeveless bodice features an overlay in coral over grey. The coral is done in a blousy style and has a keyhole opening at the back. The skirt shimmers with silver sequins and beads. Made from rayon/spandex. Hand wash, line dry. (1) SIZE SMALL 7-8 AVAILABLE ONLY. ^||,|$61.00$|,||,|FLOWERS-BY-ZOE-NEON-CORAL-SEQUIN-TWEEN-DRESS|,|$URL$flowers-by-zoe-neon-coral-sequin-tween-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-neon-coral-sequin-tween-dress-14.jpg||-||Flowers by Zoe Neon Orange Girls Dress|,|^|Unique from so many other designs that are offered, this Flowers By Zoe is for the bold in style and color. The sleevless dress features a collared ""V"" neckline. The waist is cinched with a drawstring that ties into a bow on the front. The dress finishes with an uneven hemline that falls down from the sides. The sheer overlay has a punch out pattern that allows the pink lining to peak through. 100% polyester. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. ^||,|$54.00$|,||,|FLOWERS-BY-ZOE-CORAL-GIRLS-DRESS|,|$URL$flowers-by-zoe-coral-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-coral-girls-dress-1.jpg||-||Flowers By Zoe Neon Orange Sequined Dress for Tweens|,|^|Chic and stylish, this tween dress comes from Flowers By Zoe and straight to her summer closet. The blousy top has an overlay in neon orange chiffon over a charcoal grey undershirt. The sleeveless neckline has a keyhole opening at the back that closes with a single button. The charcoal grey skirt sparkles with a fun design of silver beads and sequins on the front. The back of the skirt is solid grey. Made from polyester/rayon/spandex. Hand wash cold, line dry. Please note that the Flowers By Zoe brand runs small. Please consider ordering a size up. SIZE SMALL 7-8 AVAILABLE ONLY. ^||,|$61.00$|,||,|FLOWERS-BY-ZOE-NEON-ORANGE-SEQUINED-DRESS-TWEENS|,|$URL$flowers-by-zoe-neon-orange-sequined-dress-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-neon-orange-sequined-dress-for-tweens-14.jpg||-||Flowers by Zoe Neon Pink Sequin Skirt Set|,|^|A fresh new look, this tween outfit is a new arrival from Flowers By Zoe. The top has a standard, sleeveless neckline while styled for a cropped, mid drift length. The bright neon pink stands out in the sun's rays! A beautiful summer skirt accompanies the top. This skirt offers sequin detailing found upon the front, catching every bit of light in its sparkle. Rayon/spandex. Hand wash cold water, line dry. Flowers By Zoe runs small. Please order one size up. XLARGE (12/14) ONLY LEFT.  ^||,|$74.25$|,||,|FLOWERS-BY-ZOE-NEON-PINK-SEQUIN-SKIRT-SET|,|$URL$flowers-by-zoe-neon-pink-sequin-skirt-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-neon-pink-sequin-skirt-set-1.jpg||-||Flowers By Zoe Neon Pink Sequin Tween Dress|,|^|From Flowers By Zoe, she'll be the prettiest in pink in this tween dress. The bodice is sleeveless with a scoop neckline. Vibrant neon pink sequins cover the entire front of the dress. At the drop waist is a drawstring tie. The back of the dress is solid pink. Made of rayon/spandex. Hand wash cold, line dry. SIZE MEDIUM (10) AND XLARGE (12/14) ONLY LEFT.  ^||,|$39.00$|,||,|FLOWERS-BY-ZOE-NEON-PINK-SEQUIN-TWEEN-DRESS|,|$URL$flowers-by-zoe-neon-pink-sequin-tween-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-neon-pink-sequin-tween-dress-14.jpg||-||Flowers by Zoe New York Printed Leggings with Heart Top|,|^|From Flowers By Zoe, this new trendy school outfit for tweens is a lovely creation for the fall. The long sleeve top boasts of unique zipper sides that accent the trendy hi-low hem. A large black heart upon the front is made with quilted pleather. Beneath the top we find colorful leggings covered with a New York print. Running down the sides is a trim of black pleather. Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. ^||,|$82.00$|,||,|FLOWERS-BY-ZOE-NEW-YORK-PRINTED-LEGGINGS-HEART-TOP|,|$URL$flowers-by-zoe-new-york-printed-leggings-heart-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-new-york-printed-leggings-with-heart-top-1.jpg||-||Flowers by Zoe Ombre NYC Shirt with Zippers|,|^|A trendy tween top, this new shirt comes from Flowers By Zoe, a beloved brand that never disappoints. The top features a soft black knit that helps to keep her skin from the chilly air with long sleeves. A large screen print upon the front reads ""NYC"" and is filled with a city scape. Two zipper accents are also found upon the front! Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. ^||,|$39.00$|,||,|FLOWERS-BY-ZOE-OMBRE-NYC-SHIRT-ZIPPERS|,|$URL$flowers-by-zoe-ombre-nyc-shirt-zippers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-ombre-nyc-shirt-with-zippers-1.jpg||-||Flowers by Zoe Party Dress|,|^|Filled with celebration, this new designer tween dress was created by Flowers By Zoe. The dark bodice has a swoop neckline with wide shoulder straps. Lines of sparkling beads and sequins stripe from neckto waist. The white skirt is made with a sheer top layer and a solid lining. The swaying of the skirt is both elegant and graceful. Made with rayon blend. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. SIZE SMALL (7/8) AND MEDIUM (10) ONLY LEFT.  ^||,|$34.50$|,||,|FLOWERS-BY-ZOE-PARTY-DRESS|,|$URL$flowers-by-zoe-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-party-dress-1.jpg||-||Flowers By Zoe Party Dress for Tweens|,|^|Sure to stand apart at any event, this fabulous tween party dress comes from Flowers By Zoe. The black bodice has a strappy, fitted cut. The sheer black overlay boasts of its blouson fit while a single button keyhole is found on the back of the illusion neckline. The fitted skirt wraps around her legs with slight stretch found in its fabric. The front is striped with white rows while blooming cute coral flowers. The front of the skirt is accented completely with shimmer sequins. Created with rayon or rayon blend fabrics. Hand wash with care and line dry. Poly/Rayon. Hand wash cold. Flowers By Zoe runs small. Please order one size up. SIZE SMALL (7/8) AND MEDIUM (10) ONLY LEFT. ^||,|$85.50$|,||,|FLOWERS-BY-ZOE-PARTY-DRESS-TWEENS|,|$URL$flowers-by-zoe-party-dress-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-party-dress-for-tweens-1.jpg||-||Flowers By Zoe Pink Sequin Heart Tween Top|,|^|Made for fabulous fall layering, this new oversized tee for tweens comes from designer Flowers By Zoe. The long sleeve top features a solid black front spiced up with the large neon pink heart made with hundreds of rectangle sequins. The back of the top is a green army print. Made with 100% rayon. Hand wash with care and hang to dry. Please note that Flowers By Zoe runs small, please consider ordering a size up. SIZE MEDIUM (10) ONLY LEFT.  ^||,|$28.50$|,||,|FLOWERS-BY-ZOE-PINK-SEQUIN-HEART-TWEEN-SWEATSHIRT|,|$URL$flowers-by-zoe-pink-sequin-heart-tween-sweatshirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-pink-sequin-heart-tween-top-3.jpg||-||Flowers By Zoe Pink Wow Tank and Striped Maxi Skirt|,|^|Created by designer Flowers By Zoe, this new tween outfit is a summer and spring must have! The neon pink tank boasts of a ribbed knit and a large keyhole in the back. The eye catching screen print reads ""wow"" and ""lol"" as the 100% cotton is the perfect fabric for warmer days. The accompanying maxi skirt has navy and pink and orange stripes and the long style flows as she walks and moves. Hand wash both pieces with care. Flowers by Zoe runs small, please consider ordering one size up. (1) LARGE (10-12) ONLY LEFT.  ^||,|$44.00$|,||,|FLOWERS-BY-ZOE-PINK-WOW-TANK-STRIPED-MAXI-SKIRT|,|$URL$flowers-by-zoe-pink-wow-tank-striped-maxi-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-pink-wow-tank-and-striped-maxi-skirt-14.jpg||-||Flowers By Zoe Plaid Tween Dress with Peplum Skirt|,|^|Always taking the top seasonal styles to the next level, this Flowers By Zoe dress is great for school, parties, or family photos! The red plaid bodice is a fitted, sleeveless cut. Sparkling gems line the neck and arms to add a touch of glamour. The short skirt is dressed up with a darling peplum ruffle that falls from the waist. Made with rayon blend. Hand wash cold, line dry. Please note that the Flowers By Zoe brand runs small. Please consider ordering a size up. ^||,|$42.00$|,||,|FLOWERS-BY-ZOE-PLAID-TWEEN-DRESS-PEPLUM-SKIRT|,|$URL$flowers-by-zoe-plaid-tween-dress-peplum-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-plaid-tween-dress-with-peplum-skirt-2.jpg||-||Flowers By Zoe Pleather Tween Dress with Sequin Heart|,|Created in a fun pattern, this new Flowers By Zoe dress is sure to make her school days feel special. The long sleeve bodice offers a schoop neckline that also dips down in the back while the fabric is covered with a clouded pattern. The silver heart on the bodice is created by cute studs. The pleather skirt fits the highest trends of the season. If you love this pattern, be sure to look at all the other fabulous pieces that they have created this fall. Hand wash cold, line dry. |,|$34.50$|,||,|FLOWERS-BY-ZOE-PLEATHER-TWEEN-DRESS-SEQUIN-HEART|,|$URL$flowers-by-zoe-pleather-tween-dress-sequin-heart.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-pleather-tween-dress-with-sequin-heart-2.jpg||-||Flowers By Zoe Radiant Beading Silver Tween Dress|,|^|Ready for a party, this new Flowers By Zoe tween dress is also available in a white style. The sleeveless bodice features satin trim around the V neckline and her waist. The grey tulle overlay beading falls down into the top of the skirt. Lined, hand wash with care. FLOWERS BY ZOE RUNS SMALL CONSIDER ORDERING UP A SIZE. MEDIUM (10) AND LARGE (10/12) ONLY LEFT. ^||,|$49.00$|,||,|FLOWERS-BY-ZOE-RADIANT-BEADING-SILVER-TWEEN-DRESS|,|$URL$flowers-by-zoe-radiant-beading-silver-tween-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-radiant-beading-silver-tween-dress-14.jpg||-||Flowers By Zoe Rock N' Roll Tween Fringe Top|,|^|Rocking the school year with style, this new tween top from Flowers By Zoe will be a quick favorite. The top features long sleeves with fringe while the front screen print reads I heart Rock & Roll in a patriotic red, white, and blue. Rayon fabric, hand wash. Flowers by Zoe runs small, please consider ordering one size up. (1) SIZE MEDIUM 10 LEFT.  ^||,|$19.00$|,||,|FLOWERS-BY-ZOE-ROCK-ROLL-TWEEN-FRINGE-TOP|,|$URL$flowers-by-zoe-rock-roll-tween-fringe-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-rock-n-roll-tween-fringe-top-14.jpg||-||Flowers by Zoe Sequin Daisy Dress|,|^|Designed by Flowers by Zoe, this girls dress is available in tween sizes only. The strappy neckline is ready for warm summer days in the sun. The shapeless style allows for a more relaxed fit. A sheer overlay is covered with cute daisies inspired from the new blooms of spring. This dress is perfect for a casual Easter celebration or almost any party! 100% polyester. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. ^||,|$61.50$|,||,|FLOWERS-BY-ZOE-SEQUIN-DAISY-DRESS|,|$URL$flowers-by-zoe-sequin-daisy-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-sequin-daisy-dress-1.jpg||-||Flowers by Zoe Sequin Dress for Tweens|,|^|Matching another new arrival from Flowers By Zoe, this tween party dress is dazzling. The bodice offers her a sleevless and a scoop neckline. Sparkling sequins wrap around from front to back in chevron pattern. The dark navy is perfectly complimented by the fun coral pink. The skirt drapes from the waist and sways with her every movement. Made with rayon blend. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. ^||,|$79.50$|,||,|FLOWERS-BY-ZOE-SEQUIN-DRESS-TWEENS|,|$URL$flowers-by-zoe-sequin-dress-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-sequin-dress-for-tweens-1.jpg||-||Flowers by Zoe Sequin Shorts for Tweens|,|^|Filled with fun, these fabulous tween shorts have newly arrived from designer Flowers By Zoe. The blue denim shorts are a medium dye and offer classic belt loops. The button fly also has a zipper. Multi colored sequins cover the front and both legs are ended with a raw edged hemline. Pair these shorts with her favorite new top from Flowers By Zoe's spring and summer line. Made with cotton blend. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. SIZE XL (12/14) ONLY REMAINING. ^||,|$43.50$|,||,|FLOWERS-BY-ZOE-SEQUIN-SHORTS-TWEENS|,|$URL$flowers-by-zoe-sequin-shorts-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-sequin-shorts-for-tweens-11.jpg||-||Flowers By Zoe Sequin Stripes Grey Tween Party Dress|,|^|A fun shimmering new arrival, this tween party dress comes from trendy Flowers By Zoe. The short sleeves and straight shape create a styling stretch fit. The solid light grey back is complimented by the dazzling stripes of sequins the cover the front from neck to hem in a beautiful and unique blend of grey, orange, white, pink, and lime. The fabric is a rayon spandex blend, hand wash with care to protect sequins from damage. Flowers by Zoe runs small, please consider ordering one size up. SIZE MEDIUM 10 AND LARGE 10-12 REMAINING. ^||,|$49.00$|,||,|FLOWERS-BY-ZOE-SEQUIN-STRIPES-GREY-TWEEN-PARTY-DRESS|,|$URL$flowers-by-zoe-sequin-stripes-grey-tween-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-sequin-stripes-grey-tween-party-dress-14.jpg||-||Flowers By Zoe Sheer Army Top and Legging Set for Tweens|,|^|Complete from head to toe, this new tween outfit from designer Flowers By Zoe will make her first days back at school a breeze! The sheer button up top is styled by single button cuffs and the classic collar and breast pocket. The sheer fabric is printed in green army camo. A solid black tank with a fitted fabric is paired beneath the top adorned only by the gold studs lining her strappy neckline. Solid black leggings are added to finish this trendy look with faux zippers running up the outer side of both legs. Top: 100% polyester. Tank: rayon and spandex blend. Leggings: rayon and spandex blend. All three pieces are hand wash only, hang to dry. Please note that Flowers By Zoe runs small, please consider ordering a size up.  ^||,|$54.00$|,||,|FLOWERS-BY-ZOE-SHEER-ARMY-TOP-LEGGING-SET-TWEENS|,|$URL$flowers-by-zoe-sheer-army-top-legging-set-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-sheer-army-top-and-legging-set-for-tweens-2.jpg||-||Flowers by Zoe Silver Sequin Short Set|,|^|This new arrival from Flowers By Zoe is sure to be one of her favorite go-to outfits for the summer! The top is covered with silver spots decorated with touches of sparkle. The relaxed fit is comfortable as can be thanks to the fun flutter back created with elegant draping fabric. The perfect accompaniment, these gorgeous denim shorts are made with a comfortable cotton-rayon blend. Shining sequins flood the front of the shorts. Two pockets are found upon the back while a classic zipper and button combination fasten the waist. Rayon top and Cotton/Spandex short. Hand wash cold water, line dry. Flowers By Zoe runs small. Please order one size up. SIZE SMALL (7/8) ONLY REMAINING. ^||,|$74.25$|,||,|FLOWERS-BY-ZOE-SILVER-SEQUIN-SHORT-SET|,|$URL$flowers-by-zoe-silver-sequin-short-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-silver-sequin-short-set-1.jpg||-||Flowers By Zoe Sleeveless Tween Dress in Camo and Pleather|,|^|Designed for the trendy tween girl from Flowers By Zoe, this new dress is filled with style unlike any other. The bodice boasts of a sleeveless neckline and offers a slight stretch in fit. The bright neon camo is accented by small touches of matching colored sequins. The skirt opens to almost a full circle shape and is made in coordinating black pleather. Bodice: rayon and spandex blend. Skirt: nylon and spandex blend. Hand wash in cold water, line dry. Please note that Flowers By Zoe runs small, please consider ordering a size up.  ^||,|$29.00$|,||,|FLOWERS-BY-ZOE-SLEEVELESS-TWEEN-DRESS-CAMO-PLEATHER|,|$URL$flowers-by-zoe-sleeveless-tween-dress-camo-pleather.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-sleeveless-tween-dress-in-camo-and-pleather-2.jpg||-||Flowers by Zoe Smiley Face Dress with Fringe Hem|,|^|Flowers By Zoe has this newly created tween dress available for the spring and summer months. The white dress features a strappy neckline accented with cute studs. Many smiley faces turn and tumble down the dress to the long fringe hemline. This light weight fabric is comfortable for her to wear and allows the sweet breeze to cool her off. 100% rayon. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. MEDIUM (10) ONLY LEFT.  ^||,|$39.00$|,||,|FLOWERS-BY-ZOE-SMILEY-FACE-DRESS-FRINGE-HEM|,|$URL$flowers-by-zoe-smiley-face-dress-fringe-hem.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-smiley-face-dress-with-fringe-hem-11.jpg||-||Flowers by Zoe Sparkle Sequin Lips Shirt in Red and Black|,|^|A sweatshirt unlike any other, this new creation is by Flowers By Zoe. The grey top is accented with zippers found both on the front and on her long sleeves. The crowning jewel of this top is found on the front as the red, black, and white sequins create a large outline of lips. Pair this top with any of her favorite jeans or Flowers By Zoe skirts for a classic back to school outfit. Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. ^||,|$69.00$|,||,|FLOWERS-BY-ZOE-SPARKLE-SEQUIN-LIPS-SHIRT-RED-BLACK|,|$URL$flowers-by-zoe-sparkle-sequin-lips-shirt-red-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-sparkle-sequin-lips-shirt-in-red-and-black-1.jpg||-||Flowers By Zoe Star Sleeve Sweater in Pink|,|^|A soft sweater perfect for school, this new designer top comes from Flowers By Zoe. The pink fabric helps keep her warm from the chilly air and is as comfortable as a hug. The wide neckline is trimmed with ribbed knit edges to match the cuffs and hem. The sleeves both have a row of black stars. The front is unique with its faux zipper accent. 50% Cotton and 50% Rayon. Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. ^||,|$62.00$|,||,|FLOWERS-BY-ZOE-STAR-SLEEVE-SWEATER-PINK|,|$URL$flowers-by-zoe-star-sleeve-sweater-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-star-sleeve-sweater-in-pink-1.jpg||-||Flowers By Zoe Stylish Tween Pink Top with Splatter Leggings|,|^|A fun outfit for her back to school wardrobe, this new design comes from Flowers By Zoe, a trendy tween designer that is loved by all. The baseball styled tee features black long sleeves and a wide neckline decorated with sparkling accents. The rich pink color stands out and finishes with a high low hemline. Black and white clouded leggings are worn beneath with splatters of pink. 100% Rayon. Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. MEDIUM (10) AND XLARGE (12/14) REMAINING.  ^||,|$78.00$|,||,|FLOWERS-BY-ZOE-STYLISH-TWEEN-PINK-TOP-SPLATTER-LEGGINGS|,|$URL$flowers-by-zoe-stylish-tween-pink-top-splatter-leggings.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-stylish-tween-pink-top-with-splatter-leggings-1.jpg||-||Flowers by Zoe Summer Maxi Dress Neon|,|^|Joining the other fabulous designs from Flowers By Zoe this season, this maxi dress is a LaBella Flora favorite! The long dress is a bright neon pink styled with a scoop neckline and racer back. The skirt of the dress brushes against her legs with the cool summer breeze. Matching sequins adorn the bodice of this easy-to-wear high low maxi dress from Flowers by Zoe. Flowers By Zoe runs small. Please order one size up. SIZE XLARGE (12/14) ONLY LEFT. ^||,|$42.00$|,||,|FLOWERS-BY-ZOE-SUMMER-MAXI-DRESS-NEON|,|$URL$flowers-by-zoe-summer-maxi-dress-neon.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-summer-maxi-dress-neon-1.jpg||-||Flowers by Zoe Sunglass Tank with Sequin Skirt|,|^|Created for your fun-loving tween, this bright new outfit is available from the spring and summer line by trendy Flowers By Zoe. The tank boasts of a ribbed knit fabric that is comfortable to wear and styled with a keyhole back. The front of the top boasts of a large screen print of rainbow sunglasses. Paired with the tank, the short skirt is created with a fabric that has a soft stretch for fit. The front of the skirt is covered with a rainbow of dazzling sequins while the back is a solid neon pink. Rayon/spandex skirt with cotton tank top. Hand wash cold water, line dry. Flowers By Zoe runs small. Please order one size up. XLARGE (12/14) ONLY AVAILABLE. ^||,|$73.50$|,||,|FLOWERS-BY-ZOE-SUNGLASS-TANK-SEQUIN-SKIRT|,|$URL$flowers-by-zoe-sunglass-tank-sequin-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-sunglass-tank-with-sequin-skirt-1.jpg||-||Flowers by Zoe Tie Dye Shorts for Tweens|,|^|From Flowers By Zoe, these new shorts combine color and style for an unforgettable look. The shorts offer her a traditional waist with a fit secured with a zipper and button. Also found on the waist are silver studs that shine between the belt loops. A dreamy collection of pastel colors swirl together in unique dyed look. The hem is finished with a raw edge. Cotton/Spandex. Hand wash cold water, line dry. Flowers By Zoe runs small. Please order one size up. SIZE LARGE (10/12) ONLY REMAINING. ^||,|$34.50$|,||,|FLOWERS-BY-ZOE-TIE-DYE-SHORTS-TWEENS|,|$URL$flowers-by-zoe-tie-dye-shorts-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tie-dye-shorts-for-tweens-1.jpg||-||Flowers By Zoe Tie Dyed Tween Sweatshirt|,|^|Perfect for cool evenings on the beach and made to match the Tie Dyed Maxi Dress from Flowers By Zoe, this tween sweatshirt is a must have. The neckline has a raw edge with pink stitching to accent. Silver cone shaped studs adorn the tops of the sleeves. Colorful tie dye covers the entire top. A hi low hemline is another feature. Made from rayon. Hand wash cold, line dry. SIZE LARGE (10/12) AND XLARGE (12/14) ONLY LEFT.  ^||,|$36.00$|,||,|FLOWERS-BY-ZOE-TIE-DYED-TWEEN-SWEATSHIRT|,|$URL$flowers-by-zoe-tie-dyed-tween-sweatshirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tie-dyed-tween-sweatshirt-12.jpg||-||Flowers By Zoe Trendy Tween Outfit with Sequin Lips|,|^|New from Flowers By Zoe, this trendy outfit is a part of their new fall and winter line. The top is a heather grey complimented by the tie dye sleeves. A large sequin lip design is set upon the front with pink and black stripes. The hemline is a hi-low finish. Tie dye leggings are paired beneath covered with a black animal screen print. The stretch fit brings ultimate comfort to this outfit. 100% Rayon. Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. ^||,|$82.00$|,||,|FLOWERS-BY-ZOE-TRENDY-TWEEN-OUTFIT-SEQUIN-LIPS|,|$URL$flowers-by-zoe-trendy-tween-outfit-sequin-lips.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-trendy-tween-outfit-with-sequin-lips-1.jpg||-||Flowers By Zoe Trendy Tween Top and Leggings with Zippers|,|^|Designed by Flowers By Zoe, this new tween outfit is a fun creation she will love wearing. The long sleeve top boasts of a wide neckline and a light-weight feel that is perfect for layering or wearing on its own. Two zippers are found on the front while the black and white clouded pattern is colored with splashes of pink. Small touches of silver studs are found on the front as well. The paired leggings have quilted pleather sides for a great texture look. Two zippers are found on both legs. 100% Rayon. Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. SIZE SMALL (7/8) AND MEDIUM (10) ONLY LEFT.  ^||,|$92.00$|,||,|FLOWERS-BY-ZOE-TRENDY-TWEEN-TOP-LEGGINGS-ZIPPERS|,|$URL$flowers-by-zoe-trendy-tween-top-leggings-zippers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-trendy-tween-top-and-leggings-with-zippers-1.jpg||-||Flowers by Zoe Tunic with Capri for Tweens|,|^|Newly created from Flowers By Zoe, this girls outfit is a darling choice as the snow melts to make room for the new flower blooms. The long tunic is colored bright as a rainbow. A white lace overlays the vibrant fabric with a floral print. The drop waist introduces a hi-low skirt. Paired beneath are fitted leggings in a matching shade of coral. The sleeveless style is easy to layer and transition from early spring through the summer. Top: 100% polyester. Leggings: Made with rayon blend. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. ^||,|$59.00$|,||,|FLOWERS-BY-ZOE-TUNIC-CAPRI-TWEENS|,|$URL$flowers-by-zoe-tunic-capri-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tunic-with-capri-for-tweens-1.jpg||-||Flowers by Zoe Tween Back to School Outfit in Pleather|,|^|A sweet outfit, this creation comes from designer Flowers By Zoe. The blooming top is a black and white motif covered with darling roses. The fitted shape of the top is accented by the black pleather trimmings. The long sleeves offer her a touch of warmth during the fall and winter months. Paired with this top we find black pleather leggings that boast solely of their metallic silver sides. Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. ^||,|$88.00$|,||,|FLOWERS-BY-ZOE-TWEEN-BACK-SCHOOL-OUTFIT-PLEATHER|,|$URL$flowers-by-zoe-tween-back-school-outfit-pleather.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-back-to-school-outfit-in-pleather-1.jpg||-||Flowers By Zoe Tween Black Shorts with Gold Sequins|,|^|Looking fabulous underneath the wonderful new tween tops that have arrived for the fall 2013 season, these tween shorts come from Flowers By Zoe. The black shorts boast of a drawstring waist for a fit just for her while the soft rayon lining is comfortable on her skin and adds privacy. The mesh short is covered with gold sequins that sparkle and catch the light. These shorts are incredible on their own or with leggings paired beneath! Overlay: 100% polyester. Lining: 100% rayon. Hand wash with care and line dry. Please note that Flowers By Zoe runs small, please consider ordering a size up. XLARGE (12/14) AVAILABLE ONLY.  ^||,|$36.75$|,||,|FLOWERS-BY-ZOE-TWEEN-BLACK-SHORTS-GOLD-SEQUINS|,|$URL$flowers-by-zoe-tween-black-shorts-gold-sequins.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-black-shorts-with-gold-sequins-2.jpg||-||Flowers By Zoe Tween Chiffon Dress Animal Print|,|^|Making a hit at any party, this new tween girls dress comes from Flowers By Zoe. The dress boasts of a solid, sleeveless black bodice while the skirt offers an animal print chiffon overlay. Just above the elastic black waistband peaks out quaint chiffon ruffles. Hand wash and hang to dry. Flowers by Zoe runs small, please consider ordering one size up. SIZES MEDIUM(10) AND LARGE(10-12) REMAINING.  ^||,|$29.00$|,||,|FLOWERS-BY-ZOE-TWEEN-CHIFFON-DRESS-ANIMAL-PRINT|,|$URL$flowers-by-zoe-tween-chiffon-dress-animal-print.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-chiffon-dress-animal-print-14.jpg||-||Flowers By Zoe Tween Color Block Skirt with Top|,|^|Stylish as ever, this new Flowers By Zoe tween outfit is just what her fall style desires. The black top features a looser fit with a beaded neckline. The pairing skirt boasts of its rectangles of color block and shorter length. Pairs great with boots and leggings. Hand wash both pieces with care. Flowers by Zoe runs small, please consider ordering one size up.  ^||,|$39.00$|,||,|FLOWERS-BY-ZOE-TWEEN-COLOR-BLOCK-SKIRT-TOP|,|$URL$flowers-by-zoe-tween-color-block-skirt-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-color-block-skirt-with-top-17.jpg||-||Flowers by Zoe Tween Designer Sweater with Leggings in Red|,|^|A new arrival by popular designer Flowers By Zoe, this new tween outfit has arrived just in time for her to add it to her back to school wardrobe. The black sweater is create with a soft knit that helps to keep her cozy and warm during the chillier months. The front of the top boasts of its large white star. The long sleeves are accented with silver zippers. Leggings are paired beneath this sweater featuring black pleather trimming and a large reptile skin pattern upon the red fabric. Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. ^||,|$108.00$|,||,|FLOWERS-BY-ZOE-TWEEN-DESIGNER-SWEATER-LEGGINGS-RED|,|$URL$flowers-by-zoe-tween-designer-sweater-leggings-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-designer-sweater-with-leggings-in-red-1.jpg||-||Flowers by Zoe Tween Dress|,|^|From Flowers By Zoe, this tween dress is a new arrival for the spring and summer season! The wide neckline is outlined with sequins and sparkling gems. The white top of the dress leads into a fabulous colorblock blend. The dark navy matches a few other pieces from Flowers By Zoe while The bright coral pink is super fun. The dress is made with a soft rayon blend that allows slight stretch in its pull over fit. Made with rayon blend. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. ^||,|$43.50$|,||,|FLOWERS-BY-ZOE-TWEEN-DRESS|,|$URL$flowers-by-zoe-tween-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-dress-1.jpg||-||Flowers by Zoe Tween Dress Black with Daisy Print|,|^|A fabulous new dress from Flowers By Zoe, this tween outfit will certainly fill the season with fun! The black dress has a dress shirt hemline that accents the length of her legs. The waist is defined with a drawstring bow. The sleeveless bodice features a color and single pocket. the entire dress is covered with a fun flower print with large yellow centers. 100% polyester. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. SIZE MEDIUM (10) AND LARGE (10/12) ONLY LEFT.  ^||,|$55.50$|,||,|FLOWERS-BY-ZOE-TWEEN-DRESS-BLACK-DAISY-PRINT|,|$URL$flowers-by-zoe-tween-dress-black-daisy-print.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-dress-black-with-daisy-print-11.jpg||-||Flowers by Zoe Tween Fashion Top Born Chic|,|^|A new design created by trendy Flowers By Zoe, this tween shirt is one she will want to wear to school all of the time. The black top is created with a light weight fabric that is soft against her skin. The long sleeves provide a shield against the chilly air of the season. Upon the front of the top we find silver text that reads ""Born Chic."" These letters are decorated with beads and studs to complete the look. Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. ^||,|$56.00$|,||,|FLOWERS-BY-ZOE-TWEEN-FASHION-TOP-BORN-CHIC|,|$URL$flowers-by-zoe-tween-fashion-top-born-chic.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-fashion-top-born-chic-1.jpg||-||Flowers By Zoe Tween Girls Dress in Comic Book Print|,|^|Loud and loved, this new pattern from Flowers By Zoe fills their summer collection with fabulous designs like this tween dress. The dress is cut at a short length while accented with studs to frame the scoop neckline. The fitted look is provided with a straight cut and a fabric with slight stretch. A bold screen print covers the white fabric with action while clouds, stars, and exclamation points capture attention. The blend of colors are sure to be loved by all while the comic strip inspiration could not be more on trend. Created with rayon or rayon blend fabrics. Hand wash with care and line dry. Flowers By Zoe runs small. Please order one size up. ^||,|$46.50$|,||,|FLOWERS-BY-ZOE-TWEEN-GIRLS-DRESS-COMIC-BOOK-PRINT|,|$URL$flowers-by-zoe-tween-girls-dress-comic-book-print.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-girls-dress-in-comic-book-print-1.jpg||-||Flowers By Zoe Tween Girls Dress in Coral with Black Sequin Trim|,|^|Created in the popular peachy coral, this new designer tween dress comes from Flowers By Zoe. The delicate color is a perfect compliment to her summer skin. The waist is dressed with black sequins while the sleeveless neckline matches. A bold black line divides the bodice down the center in the front and the back. The A-line skirt flows loose from the waist. This dress is sure to be a favorite and can easily be accessorized with leggings and a cute headband. Created with rayon or rayon blend fabrics. Hand wash with care and line dry. Flowers By Zoe runs small. Please order one size up. SIZE SMALL (7/8) AND MEDIUM (10) ONLY LEFT. ^||,|$55.50$|,||,|FLOWERS-BY-ZOE-TWEEN-GIRLS-DRESS-CORAL-BLACK-SEQUIN-TRIM|,|$URL$flowers-by-zoe-tween-girls-dress-coral-black-sequin-trim.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-girls-dress-in-coral-with-black-sequin-trim-1.jpg||-||Flowers By Zoe Tween Girls Sweatshirt Chevron|,|^|Hitting the top trends perfectly for the fall, this new tween sweatshirt from Flowers By Zoe will be a school day favorite. The dark cornflower blue top boasts of its cold shoulders and a classic wide hem. Vibrant chevron screen prints run down both arms and the center front. Made with rayon, hand wash. Flowers by Zoe runs small, please consider ordering one size up. XLARGE (12/14) ONLY LEFT.  ^||,|$19.00$|,||,|FLOWERS-BY-ZOE-TWEEN-GIRLS-COLD-SHOULDER-SWEATSHIRT|,|$URL$flowers-by-zoe-tween-girls-cold-shoulder-sweatshirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-girls-cold-shoulder-sweatshirt-chevron-11.jpg||-||Flowers By Zoe Tween Grey Peace Short Set|,|^|Your tween will love this new design from Flowers By Zoe. A large orange peace symbol adorns the front of the soft grey top with silver studs accenting the sleeveless neckline. The fringed hem adds loads of fun and allows the neon tie dyed shorts to peak from beneath. Top is rayon, shorts are cotton. Both are hand wash, hang to dry. Flowers by Zoe runs small, please consider ordering one size up. ONE SIZE MEDIUM 10 LEFT. ^||,|$69.00$|,||,|FLOWERS-BY-ZOE-TWEEN-GREY-PEACE-SET|,|$URL$flowers-by-zoe-tween-grey-peace-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-grey-peace-short-set-14.jpg||-||Flowers By Zoe Tween Ivory Party Dress Radiant Beading|,|^|Making a gorgeous fashion statement, this new tween party dress is a new creation by designer Flowers By Zoe. The off white dress boasts of a sleeveless bodice with a V neck and touches of satin creating the illusion of a wrap style. The same satin is found at the waist while sequins and beading adorn the bodice and rain down from the waist. The chiffon overlay ends with a raw hem. Hand wash with care and hang to dry. Flowers by Zoe runs small, please consider ordering one size up. MEDIUM (10) AND LARGE (10-12) ONLY.  ^||,|$39.00$|,||,|FLOWERS-BY-ZOE-TWEEN-PARTY-DRESS-RADIAN-BEADING|,|$URL$flowers-by-zoe-tween-party-dress-radian-beading.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-ivory-party-dress-radiant-beading-14.jpg||-||Flowers By Zoe Tween Lavender Tank with Crochet Shorts|,|^|Your tween can't help but smile when she wears this smiling tank set from Flowers By Zoe. The whimsical smiley face on the lower left of the top is so cute with it's daisy eyes! The tank style bodice in lavender has thin straps and a sharkbite style hemline. The shorts boast of a multi-color crochet overlay done in a floral pattern. They are fully lined. Polyester/rayon. Hand wash, line dry both garments. Flowers by Zoe runs small, please consider ordering one size up. Deeper discount due to top being LG and shorts being XL. Fits like large. LARGE ONLY LEFT.  ^||,|$39.00$|,||,|FLOWERS-BY-ZOE-TWEEN-LAVENDER-TANK-CROCHET-SHORTS|,|$URL$flowers-by-zoe-tween-lavender-tank-crochet-shorts.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-lavender-tank-with-crochet-shorts-14.jpg||-||Flowers By Zoe Tween Leopard Top with Black Skirt|,|Another fabulous style for your tween, Flowers By Zoe is now offering this trendy outfit for her days at school. The long sleeve top boasts of a wild leopard print with vibrant colors while a black line stripes down both sleeves adorned with silver studs. The short skirt allows stretch in its fitted look. The front of the skirt is detailed with silver studs in a diamond pattern. Hand wash cold, line dry. |,|$46.00$|,||,|FLOWERS-BY-ZOE-TWEEN-LEOPARD-TOP-BLACK-SKIRT|,|$URL$flowers-by-zoe-tween-leopard-top-black-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-leopard-top-with-black-skirt-2.jpg||-||Flowers by Zoe Tween Love Sweatshirt with Comic Leggings|,|^|Inspired by the comic book trend that has hit theaters, this new girls outfit was designed by Flowers By Zoe. The black top has two accenting zippers found on the front and a large ""LOVE"" screen print covered with silver studs. The long sleeves also boast of the same large screen print. Beneath the sweater they have paired the black and white comic strip leggings. These leggings feature a pop of color in the center and offer a classic stretch fit. Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. ^||,|$110.00$|,||,|FLOWERS-BY-ZOE-TWEE-LOVE-SWEATSHIRT-COMIC-LEGGINGS|,|$URL$flowers-by-zoe-twee-love-sweatshirt-comic-leggings.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-love-sweatshirt-with-comic-leggings-17.jpg||-||Flowers By Zoe Tween Mint Daisy with Lace Shorts Set|,|^|Fresh as a daisy and laced with style, this tween shorts set is from Flowers By Zoe. The mint green top boasts of a large white sequined daisy at the center of the front. Adjustable straps are featured at the shoulders and the hem is done in the sharkbite style. The shorts are of a beautiful lace in muted tones of pastel colors and are lined. Faux pockets are on the front and lace pockets adorn the back. Top is made of rayon, shorts are made from polyester and rayon. Hand wash, line dry. Flowers by Zoe runs small, please consider ordering one size up. (1) SIZE MD (10) ONLY LEFT.  ^||,|$49.00$|,||,|FLOWERS-BY-ZOE-TWEEN-MINT-DAISY-LACE-SHORTS-SET|,|$URL$flowers-by-zoe-tween-mint-daisy-lace-shorts-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-mint-daisy-with-lace-shorts-set-13.jpg||-||Flowers by Zoe Tween Pastel Lace Dress|,|^|An undeniable style that is sure to be on her top favorite list for the season, this new tween dress comes from Flowers By Zoe. The sleeveless bodice has a strappy neckline accented with silver studs. The rainbow fabric of the dress allows slight stretch and is covered with an electric print. White lace overlays the entire dress. The skirt opens in shape from the waistline to a half circle shape. 100% polyester. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. MEDIUM (10) AND LARGE (10/12) ONLY LEFT.  ^||,|$48.00$|,||,|FLOWERS-BY-ZOE-TWEEN-PASTEL-LACE-DRESS|,|$URL$flowers-by-zoe-tween-pastel-lace-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-pastel-lace-dress-1.jpg||-||Flowers By Zoe Tween Pleather Skirt with Heart Top|,|^|Another blend of style, this Flowers By Zoe outfit looks fabulous together, but each piece will make many great outfits for the school year. The long sleeve top lays claim only to a large plaid heart that sits on the front and matches the patterned back. Silver grommets outline the shape while long sleeves help to keep her warm. A short black pleather skirt offers a silver studded waist and a shorter cut. Top: 100% rayon. Skirt: Made with nylon blend. Hand wash cold, line dry. Please note that the Flowers By Zoe brand runs small. Please consider ordering a size up. LARGE (10/12) AND XLARGE (12/14) ONLY LEFT.  ^||,|$43.00$|,||,|FLOWERS-BY-ZOE-TWEEN-PLEATHER-SKIRT-HEART-TOP|,|$URL$flowers-by-zoe-tween-pleather-skirt-heart-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-pleather-skirt-with-heart-top-2.jpg||-||Flowers by Zoe Tween Red Top in Snakeskin with Leggings|,|^|New from trendy designer Flowers By Zoe, this new outfit is a lovely creation from their fall and winter line. The tunic is covered with a large snake skin pattern, the black standing out from the red background. The long sleeves are ideal for the cooler months. The hemline is cut for a trendy Hi-Low shape. Beneath the top we find the solid black leggings that are comfortable to wear all day and are accented with two zippers. The trimming found on the side of her leg and at the waist are in pleather. Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. ^||,|$86.00$|,||,|FLOWERS-BY-ZOE-TWEEN-RED-TOP-SNAKESKIN-LEGGINGS|,|$URL$flowers-by-zoe-tween-red-top-snakeskin-leggings.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-red-top-in-snakeskin-with-leggings-1.jpg||-||Flowers By Zoe Tween Sequin Ombre Dress|,|^|Another stunning selection from Flowers By Zoe, she will be thrilled with this beautiful tween dress. The front of the dress is covered with sparkling sequins from the tank style neckline to the hemline. The sequins are in an ombre style of pink, silver, gold and white. The back of the dress is an off white knit. Made from rayon/spandex. Hand wash cold, line dry. SIZE XL 12-14 ONLY LEFT.  ^||,|$59.00$|,||,|FLOWERS-BY-ZOE-TWEEN-SEQUIN-OMBRE-DRESS|,|$URL$flowers-by-zoe-tween-sequin-ombre-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-sequin-ombre-dress-14.jpg||-||Flowers By Zoe Tween Sequin Top in Chevron Print|,|^|Guaranteed to set her apart, this new Flowers By Zoe sequin top will catch every eye. The sleeveless dressy top offers her a comfortable black fabric that she will want to keep on all day long. Colorful sequins create a fun chevron stripe pattern. Hand wash cold, line dry. MEDIUM (10) ONLY LEFT.  ^||,|$27.00$|,||,|FLOWERS-BY-ZOE-TWEEN-PARTY-DRESS-SEQUIN-CHIFFON|,|$URL$flowers-by-zoe-tween-party-dress-sequin-chiffon.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-sequin-top-in-chevron-print-2.jpg||-||Flowers By Zoe Tween Silver Pleather Shorts with Studs|,|^|A twist in style, these new Flowers By Zoe shorts are available in tween sizes only. The silver pleather has a brilliant sheen in the light while a classic zipper and button fly fasten in the front. Belt loops run around her waist for her to accessorize with a belt if desired. Stitching on the shorts create a quilted look while studs sit upon the intersections. 100% Polyester. Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. ^||,|$56.00$|,||,|FLOWERS-BY-ZOE-TWEEN-SILVER-PLEATHER-SHORTS-STUDS|,|$URL$flowers-by-zoe-tween-silver-pleather-shorts-studs.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-silver-pleather-shorts-with-studs-1.jpg||-||Flowers by Zoe Tween Skater Dress with Daisies|,|^|Cut in a style that is easy to love, this new tween dress comes from Flowers by Zoe. The ""skater"" style is defined by a fitted top and a relaxed skirt like you see figure skaters wear on the rink. The black dress features a few straps across the back and a scoop neckline. The large white flower print is covered with sparkling gems on the front and plain upon the skirt. Made with rayon blend. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. MEDIUM (10) AND LARGE (10/12) ONLY LEFT.  ^||,|$49.00$|,||,|FLOWERS-BY-ZOE-TWEEN-SKATER-DRESS-DAISIES|,|$URL$flowers-by-zoe-tween-skater-dress-daisies.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-skater-dress-with-daisies-11.jpg||-||Flowers By Zoe Tween Sparkle Pink Sequin Party Dress|,|^|She will shimmer in this creation from Flowers By Zoe. Shades of pink and orange sequins blend and flow down the front of this beautiful party dress. The solid rose pink bank compliments the sparkling style of the front. Rayon stretch blend, hand wash and hang to dry. Flowers by Zoe runs small, please consider ordering one size up. (1) LARGE (10/12) ONLY LEFT. ^||,|$49.00$|,||,|FLOWERS-BY-ZOE-TWEEN-SPARKLE-PINK-SEQUIN-PARTY-DRESS|,|$URL$flowers-by-zoe-tween-sparkle-pink-sequin-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-sparkle-pink-sequin-party-dress-14.jpg||-||Flowers By Zoe Tween Sweatpants with Silver Stars|,|^|A cozy pair of Flowers By Zoe pants, these sweatpants are unique among the rest. Her waist stretches with an elastic fit while the blue fabric is covered with a vibrant clouded print. Her left leg is accented with a metallic silver screen print. Round silver studs finish off this look perfectly. Hand wash cold, line dry. SIZE SMALL (7/8) ONLY AVAILABLE.  ^||,|$34.50$|,||,|FLOWERS-BY-ZOE-TWEEN-SWEATPANTS-SILVER-STAR|,|$URL$flowers-by-zoe-tween-sweatpants-silver-star.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-sweatpants-with-silver-stars-2.jpg||-||Flowers By Zoe Tween Sweatshirt Love|,|^|Flowers By Zoe has recently created this fabulous new sweatshirt for tweens. The white top boasts of a clouded texture while a large graphic novel heart print makes a splash of ""love"" upon the front. The cut of the top is designed for a looser fit while the short sleeves make it perfect for a touch of warmth when the day cools into the evening. The back of the sweatshirt is covered with a bold comic print filled with action words like ""pow"" and ""zoom."" Created with rayon or rayon blend fabrics. Hand wash with care and line dry. Flowers By Zoe runs small. Please order one size up. SIZE LARGE (10/12) ONLY LEFT.  ^||,|$46.50$|,||,|FLOWERS-BY-ZOE-TWEEN-SWEATSHIRT-LOVE|,|$URL$flowers-by-zoe-tween-sweatshirt-love.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-sweatshirt-love-1.jpg||-||Flowers By Zoe Tween Sweatshirt with Lightning Bolts|,|^|In a relaxed fit, this new tween sweatshirt is designed by Flowers By Zoe. The neon pink top boasts of slashed rips adding a distressed look while neon orange lightning bolt screen prints dart from shoulder to hem. The long sleeves and rayon are perfect for chilly spring nights. Hand wash and hang to dry. Flowers by Zoe runs small, please consider ordering one size up. SIZE MD (10) ONLY REMAINING. ^||,|$39.00$|,||,|FLOWERS-BY-ZOE-NEON-PINK-TWEEN-SWEATSHIRT-LIGHTNING-BOLTS|,|$URL$flowers-by-zoe-neon-pink-tween-sweatshirt-lightning-bolts.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-sweatshirt-with-lightning-bolts-14.jpg||-||Flowers By Zoe Tween Tie Dye Dress|,|^|A new creation for spring and summer, this bright girls dress is both bright and fun! The dress is given shape through the denim belt that ties in a bow around her waist. The light wash denim creates the collar and sleeveless neckline. Pearlized buttons run up the front to fasten closed. The floral lace is vibrant with tie dye in coral, orange, and yellow. Top: 100% cotton. Bottom: 100% polyester. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. SIZE MEDIUM (10) ONLY LEFT. ^||,|$59.25$|,||,|FLOWERS-BY-ZOE-TWEEN-TIE-DYE-DRESS|,|$URL$flowers-by-zoe-tween-tie-dye-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-tie-dye-dress-1.jpg||-||Flowers By Zoe Tween Top and Legging in Chevron|,|^|Cute as can be, this new tween outfit from Flowers By Zoe will fill all her classmates with envy. The long sleeve top boasts of its chevron print in a fun mix of colors. The stripes are accented with small touches of matching colored studs while the hemline has a subtle sharkbite shape. Denim colored leggings are paired beneath, solid and darker in shade. Top:100%rayon. Legging: rayon and spandex blend. Hand wash in cold water, hang to dry. Please note that Flowers By Zoe runs small, please consider ordering a size up. SIZE SMALL (7/8) ONLY LEFT. ^||,|$38.00$|,||,|FLOWERS-BY-ZOE-TWEEN-TOP-LEGGING-CHEVRON|,|$URL$flowers-by-zoe-tween-top-legging-chevron.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-top-and-legging-in-chevron-2.jpg||-||Flowers By Zoe Tween Top and Skirt Pink Lips|,|^|A designer outfit that her friends will love and envy, this new arrival comes from the fall and winter line by Flowers By Zoe. The top has a cropped finish that hits right at her waist while the lighter weight fabric makes it easy to layer. The pink long sleeves compliment the lip screen prints that cover the front and are accented with sparkling gems. A fun skirt is paired beneath covered in a white and black clouded print with touches of pink. Subtle pleather accents finish the look of the skater skirt. 100% Rayon. Hand wash and lay flat to dry. Flowers By Zoe runs small. Please order one size up. SIZE LARGE 10/12 AND XLARGE 12/14 REMAINING. ^||,|$78.00$|,||,|FLOWERS-BY-ZOE-TWEEN-TOP-SKIRT-PINK-LIPS|,|$URL$flowers-by-zoe-tween-top-skirt-pink-lips.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-top-and-skirt-pink-lips-17.jpg||-||Flowers by Zoe Tween Tunic with Leggings|,|^|Quite the pair, this new tween outfit comes from the fabulously trendy tween brand, Flowers By Zoe. The top is covered with a black aztec print while the white front is clouded with touches of color. The back of the top is created from a light grey. The neckline is sleeveless while the hi-low hemline is adorable! Solid white leggings are worn beneath this tween tunic. Both sides feature a matching screen print and colored studs. The leggings have a stretch fit and elastic waistline. Top: 100% rayon. Bottom: Made with rayon blend. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. MEDIUM (10) AND LARGE (10/12) ONLY LEFT. ^||,|$57.00$|,||,|FLOWERS-BY-ZOE-TWEEN-TUNIC-LEGGINGS|,|$URL$flowers-by-zoe-tween-tunic-leggings.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tween-tunic-with-leggings-1.jpg||-||Flowers by Zoe Tye Dye Sweatshirt with Daisy Peace Sign|,|^|The perfect sweatshirt for the chilly spring air, this new tween top comes from Flowers By Zoe. The tie die background introduces shades of blue, pink, purple, and yellow into an eclectic blend. The sweatshirt has long sleeves and a wide hemline. The front of the top is accented with a large piece sign created with white daisy appliques. Pair this piece with many of the new bottoms from the spring and summer collections from Flowers By Zoe. 100% rayon. Hand wash cold, line dry. Flowers By Zoe runs small. Please order one size up. (1) SIZE SMALL (7/8) ONLY LEFT. ^||,|$44.25$|,||,|FLOWERS-BY-ZOE-TYE-DYE-SWEATSHIRT-DAISY-PEACE-SIGN|,|$URL$flowers-by-zoe-tye-dye-sweatshirt-daisy-peace-sign.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-tye-dye-sweatshirt-with-daisy-peace-sign-1.jpg||-||Flowers By Zoe UK Love Tween Black Sweater|,|^|From designer Flowers By Zoe, this tween sweater shows a little bit of UK love. The black top offers warm long sleeves and a large smiley face screen print on the front colored like the British flag. Made with rayon, hand wash. Flowers by Zoe runs small, please consider ordering one size up. ONLY AVAILABLE IN SIZES SMALL (7/8) AND MEDIUM (10). ^||,|$19.00$|,||,|FLOWERS-BY-ZOE-UK-LOVE-TWEEN-BLACK-SWEATER|,|$URL$flowers-by-zoe-uk-love-tween-black-sweater.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-uk-love-tween-black-sweater-14.jpg||-||Flowers By Zoe White Leopard Print Tween Jacket|,|^|The perfect accessory for her summer attire from Flowers By Zoe, this jacket is so fun! The leopard print in white is accented with pink and mint down the sides of the jacket and inner edges of the sleeves. An array of silver studs grace the top panel beside the collar of the jacket. Silver buttons close the front as well as the top two pockets. Two hand pockets are also located on the lower half of the jacket. Cotton/spandex. Hand wash, line dry. Flowers by Zoe runs small, please consider ordering one size up. SMALL (7/8) AND XLARGE (12/14) ONLY LEFT. ^||,|$39.00$|,||,|FLOWERS-BY-ZOE-WHITE-LEOPARD-PRINT-TWEEN-JACKET|,|$URL$flowers-by-zoe-white-leopard-print-tween-jacket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-white-leopard-print-tween-jacket-15.jpg||-||Flowers By Zoe White Summer Top with Flag Graphic|,|^|Flowers By Zoe created this new tween top with love and style. The white short sleeve top is cut for a relaxed fit while the light weight fabric breathes easily in the hot sun. The front of the top has a mouth screen print accessorized with a stars and stripe lipstick. Touches of sparkle are added with many small studs. Matches the new flag leggings perfectly! Created with rayon or rayon blend fabrics. Hand wash with care and line dry. Flowers By Zoe runs small. Please order one size up. ^||,|$29.00$|,||,|FLOWERS-BY-ZOE-WHITE-SUMMER-TOP-FLAG-GRAPHIC|,|$URL$flowers-by-zoe-white-summer-top-flag-graphic.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-white-summer-top-with-flag-graphic-1.jpg||-||Flowers By Zoe Zap Pow Girls Pom Pom Shorts|,|^|Newly created by Flowers By Zoe, these fabulous tween shorts are sure to make a splash. The white fabric is soft and comfortable for all day wear while the elastic waistband has a secure, stretch fit. The loud pattern is inspired by the loved super hero graphic novels while it is filled with bold colors. The hem line is covered with a dancing pom pom trim. The relaxed fit of this style is one that she can love and is sure to match perfectly with all of the new ""comic love"" tops. Created with rayon or rayon blend fabrics. Hand wash with care and line dry. Flowers By Zoe runs small. Please order one size up. ^||,|$27.00$|,||,|FLOWERS-BY-ZOE-ZAP-POW-GIRLS-POM-POM-SHORTS|,|$URL$flowers-by-zoe-zap-pow-girls-pom-pom-shorts.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-zap-pow-girls-pom-pom-shorts-1.jpg||-||Flowers By Zoe Zap Top with Comic Book Skirt|,|^|A match made in graphic novel heaven, this fabulous tween girls summer outfit is sure to grab her friends' attention. The black tank is cut at a cropped length and offers a relaxed fit. A large action star is outlined in white on the front and filled with a stud adorned ""ZAP."" The shirt is paired with an adorable, bold skirt. The skirt boasts of a twirling fit that dances around her legs with her every step. The comic strip print is filled with both action and color. Created with rayon or rayon blend fabrics. Hand wash with care and line dry. Flowers By Zoe runs small. Please order one size up. SIZE SMALL (7/8) AND XLARGE (12/14) ONLY LEFT.  ^||,|$58.50$|,||,|FLOWERS-BY-ZOE-ZAP-TOP-COMIC-BOOK-SKIRT|,|$URL$flowers-by-zoe-zap-top-comic-book-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/flowers-by-zoe-zap-top-with-comic-book-skirt-1.jpg||-||Funtasia Too Duck Infant Girls Swimsuit|,|A fabulous new little girls designer swimsuit, this adorable creation comes from designer Funtasia Too. The neckline is accented with a pleated ribbon with white pick stitches. The seersucker fabric is made specifically for warmer seasons and is in a light blue and white print. A small ruffle skirt runs around her waist, finished with the same ribbon at the hem. Three waddling duck appliques are placed in a row on the front. Made with polyester blend. Made in USA. Machine wash cold, tumble dry low. |,|$39.00$|,||,|FUNTASIA-TOO-DUCK-INFANT-GIRLS-SWIMSUIT|,|$URL$funtasia-too-duck-infant-girls-swimsuit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/funtasia-too-duck-infant-girls-swimsuit-1.jpg||-||Funtasia Too Girls Coverup Dress with Flower|,|Sweet and darling, this new girls coverup dress comes from Funtasia Too to match their fabulous new halter swimsuit. The white fabric is soft and comfortable against her skin while providing a shield for the breeze in between swims. The cap sleeves are made with a seersucker fabric lined with a blue ribbon. The front of the dress is decorated solely with a daisy applique created with an orange center and loops of ribbon. The dress falls down in a relaxed fit to the blue ruffle hemline. Made with polyester blend. Made in USA. Machine wash cold, tumble dry low. |,|$31.00$|,||,|FUNTASIA-TOO-GIRLS-COVERUP-DRESS-FLOWER|,|$URL$funtasia-too-girls-coverup-dress-flower.html|,|http://ep.yimg.com/ay/yhst-17102259411242/funtasia-too-girls-coverup-dress-with-flower-1.jpg||-||Funtasia Too Girls Coverup with Ducks|,|Soft and comfortable, this adorable swimwear coverup comes from designer Funtasia Too to match the new duck swim pieces. The long sleeve piece gives her warmth on her way to the pool or in between swims. The cozy hood is edged with a seersucker ruffle that falls down the center and wraps around the hem. The edge of ribbon is a coordinating blue. The appliques found on the front create small waves of water and has a single, swimming duck. Made with cotton blend. Made in the USA. Machine wash cold, tumble dry low. |,|$39.00$|,||,|FUNTASIA-TOO-GIRLS-COVERUP-DUCKS|,|$URL$funtasia-too-girls-coverup-ducks.html|,|http://ep.yimg.com/ay/yhst-17102259411242/funtasia-too-girls-coverup-with-ducks-1.jpg||-||Funtasia Too Girls Hooded Coverup in Terry|,|^|Adorable and sweet, this fabulous new designer girls coverup comes from Funtasia Too. The piece is designed to match the two new floral swimsuits released in their summer collection. The long sleeves and cozy hood help keep her warm after a swim. A row of buttons run up the center next the seersucker ruffle trimmed in pink polka dot ribbon. Two blooming flowers are found on the front, growing from the hemline. The lime rick rack ribbon creates the perfect stem for the pretty flowers. Made with a cotton blend. Made in the USA. Machine wash cold, tumble dry low. SIZE 4 ONLY AVAILABLE.  ^||,|$39.00$|,||,|FUNTASIA-TOO-GIRLS-HOODED-COVERUP-TERRY|,|$URL$funtasia-too-girls-hooded-coverup-terry.html|,|http://ep.yimg.com/ay/yhst-17102259411242/funtasia-too-girls-hooded-coverup-in-terry-1.jpg||-||Funtasia Too Girls Lobster Dress Coverup|,|A friendly creation, this fun filled swimwear coverup comes from Funtasia Too. The white dress falls in a relaxed fit that pulls on easily and protects her from the wind after a swim. The ruffled cap sleeves are decorated with two rick rack ribbons, one in red and one in blue. The tiny white polka dots cover the cute lobster applique upon the front. A matching seersucker ruffle runs around the hemline with the same ribbon. Cotton. Machine wash cold. |,|$31.00$|,||,|FUNTASIA-TOO-GIRLS-LOBSTER-DRESS-COVERUP|,|$URL$funtasia-too-girls-lobster-dress-coverup.html|,|http://ep.yimg.com/ay/yhst-17102259411242/funtasia-too-girls-lobster-dress-coverup-1.jpg||-||Funtasia Too Girls Lobster Swimsuit Two Piece|,|A blue and red swimsuit that is sure to be a part of much of this summer's fun, this new arrival comes from designer Funtasia Too. Blue and white stripes cover the seersucker fabric while a thin strap ties behind her neckline. A perfect match to the one piece suit, a small polka dot lobster applique is stitched to the front. A rickrack ribbon introduces the cute little ruffle on the hemline. The swimsuit is finished with a ruffle that wraps around the bottoms with the same ribbon. The back of the top is smocked for a stretch fit. Poly/Cotton. Machine wash cold. |,|$38.00$|,||,|FUNTASIA-TOO-GIRLS-LOBSTER-SWIMSUIT-TWO-PIECE|,|$URL$funtasia-too-girls-lobster-swimsuit-two-piece.html|,|http://ep.yimg.com/ay/yhst-17102259411242/funtasia-too-girls-lobster-swimsuit-two-piece-1.jpg||-||Funtasia Too Girls Two Piece Swimsuit with Flowers|,|Funtasia Too always designs creative designer swimwear that entices imagination, this new arrival is no different. Their unique seer sucker fabric is a light blue and white stripe. The halter top ties around her neck with a bow. A single daisy is found off to the right side of the hem that dances with the ribbon-lined ruffle. Matching bottoms are worn beneath. The waving skirt is accented with the wide ribbon hem, upon which we find another adorable flower applique. Made with polyester blend. Made in USA. Machine wash cold, tumble dry low. |,|$39.00$|,||,|FUNTASIA-TOO-GIRLS-TWO-PIECE-SWIMSUIT-FLOWERS|,|$URL$funtasia-too-girls-two-piece-swimsuit-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/funtasia-too-girls-two-piece-swimsuit-with-flowers-1.jpg||-||Funtasia Too Ice Cream Cone Coverup for Girls|,|^|Matching the ""One Piece Girls Swimsuit with Cone"" this new Funtasia Too coverup dress is sure to be loved. Touches of pink gingham seersucker fabric is found at the ruffled cap sleeves and the cute ruffling hemline. A wide pink ribbon dressed with yellow polka dots is added for good measure. The front of the cozy white fabric is decorated with a single scoop, ice cream applique. The fun blend of pinks and greens is as refreshing as watermelon! Cotton/Poly. Machine wash cold. ^||,|$31.00$|,||,|FUNTASIA-TOO-ICE-CREAM-CONE-COVERUP-GIRLS|,|$URL$funtasia-too-ice-cream-cone-coverup-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/funtasia-too-ice-cream-cone-coverup-for-girls-1.jpg||-||Funtasia Too Lobster Swimsuit One Piece for Girls|,|Filled with patriotic colors, this new girls swimsuit was designed by the wonderful Funtasia Too. The suit is made with a light weight seersucker fabric that is unique from other swimwear. The front of the piece is adorned with a large red polka dot lobster applique. A cute ruffle skirts around the suit and features a blue and red rick rack ribbon. The dark blue and white stripes run vertically down the piece. Poly/Cotton. Machine wash cold. |,|$39.00$|,||,|FUNTASIA-TOO-LOBSTER-SWIMSUIT-ONE-PIECE-GIRLS|,|$URL$funtasia-too-lobster-swimsuit-one-piece-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/funtasia-too-lobster-swimsuit-one-piece-for-girls-1.jpg||-||Funtasia Too One Piece Girls Swimsuit with Cone|,|A bold pink swimsuit to accompany her to the pool or beach, this fabulous girls swimsuit from Funtasia Too is available in several size ranges. The hot pink seersucker fabric is a summer gingham and offers her a smocked back that stretches for a comfortable fit. The light weight fabric stands apart from other swimsuits. A wide ruffle mimics the look of a skirt on this one piece swimsuit while finished off with a polka dot ribbon. Chevron stripes are turned into a cone while a strawberry scoop sits on top with a colorful green cherry. Poly/Cotton. Machine wash cold. |,|$39.00$|,||,|FUNTASIA-TOO-ONE-PIECE-GIRLS-SWIMSUIT-CONE|,|$URL$funtasia-too-one-piece-girls-swimsuit-cone.html|,|http://ep.yimg.com/ay/yhst-17102259411242/funtasia-too-one-piece-girls-swimsuit-with-cone-1.jpg||-||Funtasia Too Purple Girls Swimsuit with Flower|,|Funtasia Too is now offering this adorable girls two piece swimsuit for the sun filled fun this summer. The seersucker fabric is covered with a thin lavender stripe that runs vertically from the neckline down to the hem. The halter strap ties comfortably around her neck while the stretch-fit back is a comfortable wear. The cute little ruffle is finished with a scallop hem decked with pink ribbon. The matching bottoms have a short skirt that is accented with the same polka dot ribbon. Made with a polyester blend. Made in the USA. Machine wash cold, tumble dry low. |,|$39.00$|,||,|FUNTASIA-TOO-PURPLE-GIRLS-SWIMSUIT-FLOWER|,|$URL$funtasia-too-purple-girls-swimsuit-flower.html|,|http://ep.yimg.com/ay/yhst-17102259411242/funtasia-too-purple-girls-swimsuit-with-flower-1.jpg||-||Funtasia Too Seersucker Girls Swimsuit with Flower|,|A new spring or summer bloom, this little girls swimsuit is available from size 3M all the way to 6X. The light lavender fabric is a thin stripe pattern and a light weight seersucker. The back of the bodice stretches with its smocked style. A green rickrack ribbon is used as a cute stem upon the center of the front. Light pink ribbon covered with subtle polka dots creates the fresh bloom. A small ruffle runs around her waist and is finished with the same darling ribbon. Made with a polyester blend. Made in the USA. Machine wash cold, tumble dry low. |,|$39.00$|,||,|FUNTASIA-TOO-SEERSUCKER-GIRLS-SWIMSUIT-FLOWER|,|$URL$funtasia-too-seersucker-girls-swimsuit-flower.html|,|http://ep.yimg.com/ay/yhst-17102259411242/funtasia-too-seersucker-girls-swimsuit-with-flower-1.jpg||-||Funtasia Too Towel with Ducks|,|To go with her new swimsuit, this Funtasia Too girls beach towel is the perfect way to complete her swim. The towel is a soft white that feels like a warm hug when she leaves the pool. The towel certainly has its ducks in a row with the darling, blue striped appliques that are quacking their way across the bottom. A single addition of blue ribbon is stitched behind the waddling birds. 100% cotton. Made in the USA. Machine wash cold, tumble dry low. |,|$31.00$|,||,|FUNTASIA-TOO-TOWEL-DUCKS|,|$URL$funtasia-too-towel-ducks.html|,|http://ep.yimg.com/ay/yhst-17102259411242/funtasia-too-towel-with-ducks-1.jpg||-||Funtasia Too Towel with Purple Flower|,|Made to match the new swimsuits and the coverup, this girls pool towel comes from designer Funtasia Too. The towel is solid white and warm against her skin. The front is decorated with a ruffled pink ribbon. A waving green stem sprouts from the ribbon and leads to the large lavender flower applique. Matching pink ribbon creates the flower's center. 100% cotton. Made in the USA. Machine wash cold, tumble dry low. |,|$31.00$|,||,|FUNTASIA-TOO-TOWEL-PURPLE-FLOWER|,|$URL$funtasia-too-towel-purple-flower.html|,|http://ep.yimg.com/ay/yhst-17102259411242/funtasia-too-towel-with-purple-flower-1.jpg||-||Giggle Moon Baby Girl Romper Green Pastures|,|^|Dressing her in only the cutest fashion, this new infant romper comes from the wonderful Giggle Moon as a part of their ""Green Pastures"" collection. The sweet stripes wrap around her body. The quaint neckline is accented with a scalloped ruffle with a tiny eyelet design. A rich, deep pink rosette is found sitting solo on the bodice. The center front of the romper features three fun ruffles in green and pink floral. Changing snaps are added to the inseam of her legs while the bell hems are a lined print with small roses. SIZE NEWBORN ONLY LEFT.  ^||,|$47.20$|,||,|GIGGLE-MOON-BABY-GIRL-ROMPER-GREEN-PASTURES|,|$URL$giggle-moon-baby-girl-romper-green-pastures.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-baby-girl-romper-green-pastures-14.jpg||-||Giggle Moon Baby Green Pastures Tillie Apron Dress|,|Giggle Moon Baby offers adorable little girls clothing with comfort in mind. Beautiful cabbage roses spring across the green fabric skirting while a ruffled blue apron sits atop. The coordinating fabric waistband features a trio of buttons. The dress is completed with a soft cotton knit bodice and eyelet trim. Wash cool gentle cycle, lay flat to dry. Made in the USA. |,|$57.60$|,||,|GIGGLE-MOON-BABY-GREEN-PASTURES-TILLIE-APRON-DRESS|,|$URL$giggle-moon-baby-green-pastures-tillie-apron-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-baby-green-pastures-tillie-apron-dress-13.jpg||-||Giggle Moon Dance For Joy Girls Party Dress |,|Darling and unique for the holiday season, this fabulous girls party dress comes from designer Giggle Moon. The long sleeve, striped bodice boasts of the ruffles found on her shoulder and the single red flower at the waist. The skirt is tiered with coordinating fabrics. A single ruffle in a cool green adds texture to the skirt while the full circle shape dances around her legs with every move. |,|$46.80$|,||,|GIGGLE-MOON-DANCE-JOY-GIRLS-PARTY-DRESS|,|$URL$giggle-moon-dance-joy-girls-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-dance-for-joy-girls-party-dress-preorder-17.jpg||-||Giggle Moon Dance For Joy Tutu Dress with Legging |,|New from Giggle Moon, this darling version of their Tutu Dress will not last long. The grey striped bodice is finished with sheer black ruffles on the cuffs and one around her neckline. The sheer black tulle skirt is hemmed by the famous three tiered ruffles. Matching solid grey leggings are paired beneath. The punch of red is introduced by the waist band that ties in the back and is garnished by a single flower. |,|$46.80$|,||,|GIGGLE-MOON-DANCE-JOY-TUTU-DRESS-LEGGING|,|$URL$giggle-moon-dance-joy-tutu-dress-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-dance-for-joy-tutu-dress-with-legging-preorder-7.jpg||-||Giggle Moon Fall Blossom Bow Swing Set for Girls |,|^|Part of the ""Fall Blossoms"" collection by Giggle Moon for the fall, this little girls swing set will knock your socks off. Long sleeves on the bodice help keep her warm as the orange chevron strips zig and zag around her. The green waist is tied in a bow while the brown skirt brings a vibrant punch of rich reds along with it. The bell pants feature the same stripes and are trimmed with vintage script. SIZE 6 MOS ONLY LEFT. ^||,|$39.00$|,||,|GIGGLE-MOON-FALL-BLOSSOM-BOW-SWING-SET-GIRLS|,|$URL$giggle-moon-fall-blossom-bow-swing-set-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-fall-blossom-bow-swing-set-for-girls-preorder-18.jpg||-||Giggle Moon Fall Blossom Girls Tutu Dress with Legging |,|^|Surprising with its mix of colors, this tutu dress from Giggle Moon is perfect for fall parties and birthdays. The long sleeve bodice is covered with the ivory vintage script print as a large lime bow sits upon the wide waist that ties into a bow. The skirt is covered with a coral tulle overlay frosted with a triple ruffle hemline. The chevron leggings feature matching bell ruffles on their hem. SIZE 3 MOS AND 12 MOS ONLY LEFT. ^||,|$46.80$|,||,|GIGGLE-MOON-FALL-BLOSSOM-GIRLS-TUTU-DRESS-LEGGING|,|$URL$giggle-moon-fall-blossom-girls-tutu-dress-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-fall-blossom-girls-tutu-dress-with-legging-preorder-18.jpg||-||Giggle Moon Girls Headband Treasured Possession PREORDER|,|^|An accessory to match all of the wonderful new creations, this Giggle Moon headband is from their ""Treasured Possession"" collection. The band stretches for a comfortable fit around her head. Off to one side we find two fabric blooms. One rosette is made with an orange chiffon while it is seated next to a gray petal flower. Subtle sequin accents are added to the piece. Please note that this item is a PreOrder and is not currently in stock. This item is expected to arrive between July 18, 2014 and September 30, 2014. ^||,|$27.00$|,||,|GIGGLE-MOON-GIRLS-HEADBAND-TREASURED-POSSESSION|,|$URL$giggle-moon-girls-headband-treasured-possession.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-girls-headband-treasured-possession-preorder-1.jpg||-||Giggle Moon Girls Party Dress Starlight Shine |,|^|The Giggle Moon Girls Party Dress for the ""Starlight Shine"" collection is the perfect dress for a casual spring or summer occasion or just any time! The details on this party dress are great. There are so many fun, floral patterns on this dress to make it perfect for any girl! Just to add an extra element, this dress has a pretty yellow bow in the back, too! It's 100% cotton and machine washable, so it's perfect for little girls who might be a little messy! (1) SIZE 3 MOS ONLY LEFT. ^||,|$29.00$|,||,|GIGGLE-MOON-GIRLS-PARTY-DRESS-STARLIGHT-SHINE|,|$URL$giggle-moon-girls-party-dress-starlight-shine.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-girls-party-dress-starlight-shine-19.jpg||-||Giggle Moon Girls Party Dress Treasured Possession PREORDER|,|^|Matching several new arrivals, this new Giggle Moon dress is part of the ""Treasured Possession"" collection for fall. The bodice is covered in wide stripes and offers long sleeves. The cuffs are dressed with ruffles while the neckline is trimmed with a sheer, scallop ruffle. The skirt opens to a full circle shape. Alternating fabrics are filled with bold colors that blend together for a unique look! Please note that this item is a PreOrder and is not currently in stock. This item is expected to arrive between July 18, 2014 and September 30, 2014. ^||,|$74.00$|,||,|GIGGLE-MOON-GIRLS-PARTY-DRESS-TREASURED-POSSESSION|,|$URL$giggle-moon-girls-party-dress-treasured-possession.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-girls-party-dress-treasured-possession-preorder-1.jpg||-||Giggle Moon Girls Swing Set Sweet as Honey|,|^|A fun new arrival from designer Giggle Moon, this girls swing set is part of the ""Sweet as Honey"" collection for spring and summer. The sleeveless top boasts of its vibrant yellow damask print. A deep pink yoke is decorated with two centered buttons and a lace border. The hemline dances with a fun blue ruffle that is accented with matching lace. The matching pants are striped from her elastic hemline. The same colorful print creates the loved bell hem. SIZE 3 MOS AND 6 MOS ONLY LEFT. ^||,|$52.00$|,||,|GIGGLE-MOON-GIRLS-SWING-SET-SWEET-AS-HONEY|,|$URL$giggle-moon-girls-swing-set-sweet-as-honey.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-girls-swing-set-sweet-as-honey-10.jpg||-||Giggle Moon Green Pastures Connie Skirt Set|,|^|A wonderful spring arrival from Giggle Moon, this girls skirt and top are part of the blooming ""Green Pastures"" collection. The striped top features a wide hemline that ruffles around in the sweet vintage floral and line print. Two large buttons are found just beneath the jewel neckline framed with an eyelet ruffle. Behind the buttons we find a large floral print that really pops out from the neutral fabrics. The fun, full circle skirt boasts of a blooming green print, elastic waistline, and a blue dot print that peeks out as it ruffles just beneath. The extra fabric provides great movement with her every step! ^||,|$65.60$|,||,|GIGGLE-MOON-GREEN-PASTURES-CONNIE-SKIRT-SET|,|$URL$giggle-moon-green-pastures-connie-skirt-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-green-pastures-connie-skirt-set-6.jpg||-||Giggle Moon Green Pastures Floral Headwrap|,|^|Created to match the new arrivals from Giggle Moon's ""Green Pastures"" collection, this girls headband is a fun way to accessorize her new outfits! The blue fabric is covered with a unique dotted print. Tying the head wrap at the back of her head allows for a custom fit. Off set to one side is a fun duo of flowers in matching shades. ^||,|$21.60$|,||,|GIGGLE-MOON-GREEN-PASTURES-FLORAL-HEADWRAP|,|$URL$giggle-moon-green-pastures-floral-headwrap.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-green-pastures-floral-headwrap-1.jpg||-||Giggle Moon Green Pastures Knit Headband|,|^|Matching the ""Green Pastures"" collection from Giggle Moon, this girls headband is a delightful accessory for the spring and summer seasons! The soft fabric stretches around her head in a comfortable fit. The neutral stripe pattern is finished with a raw edge while two pink and green flowers sit off to one side. ^||,|$21.60$|,||,|GIGGLE-MOON-GREEN-PASTURES-KNIT-HEADBAND|,|$URL$giggle-moon-green-pastures-knit-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-green-pastures-knit-headband-1.jpg||-||Giggle Moon Green Pastures Suzy Pant Set|,|^|Giggle Moon is now offering this fun girls outfit from their ""Green Pastures"" collection for the spring. The tank top is a soft fabric that allows slight stretch in its comfortable fit. A single blue dot pocket is off centered to the side and skirted with a fun eyelet fabric that is finished with a scallop edge. A single large button adorns the pocket. The neutral stripes can be paired with just about anything! Paired beneath are the fun green floral bottoms that have a stretch, pink waist ruffled with eyelet to match the floral bell ruffle hem. ^||,|$59.00$|,||,|GIGGLE-MOON-GREEN-PASTURES-SUZY-PANT-SET|,|$URL$giggle-moon-green-pastures-suzy-pant-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-green-pastures-suzy-pant-set-1.jpg||-||Giggle Moon Green Pastures Twirl Dress|,|^|A new part of the Giggle Moon ""Green Pastures"" collection, this girls dress is sure to be one of favorites! The pink empire bodice has a wide, elastic neckline that bunches to a cute peasant design. The blue waist is covered with dots and ties in a large bow on her back. The single large sheer flower is a deep shade and off centered. Opening to a full shape, the three tiers of fabric found on the skirt alternate between two floral prints. The shade of green is perfect to welcome in the spring time sun! ^||,|$59.20$|,||,|GIGGLE-MOON-GREEN-PASTURES-TWIRL-DRESS|,|$URL$giggle-moon-green-pastures-twirl-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-green-pastures-twirl-dress-1.jpg||-||Giggle Moon Hair Accessory for Girls Treasured Possession PREORDER|,|^|Giggle Moon now offers this head wrap to match her new outfits from their ""Treasured Possession"" collection. The cotton fabric is colored with a pattern colored in turquoise and green. The accessory is tied at the back of her head for a custom fit. Off to the side of her head we find a flower duet. The bold orange and relaxed grey make an unlikely pair while sequins add a small touch. Please note that this item is a PreOrder and is not currently in stock. This item is expected to arrive between July 18, 2014 and September 30, 2014. ^||,|$27.00$|,||,|GIGGLE-MOON-HAIR-ACCESSORY-GIRLS-TREASURED-POSSESSION|,|$URL$giggle-moon-hair-accessory-girls-treasured-possession.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-hair-accessory-for-girls-treasured-possession-preorder-6.jpg||-||Giggle Moon Happy and Joyful Lucy Dress|,|^|A hit from the ""Happy and Joyful"" collection by designer Giggle Moon, the Lucy dress is quickly becoming a must have item for the fall. The long sleeve bodice is wrapped in a damask print and features a touch of ruffles at the cuff. A large pink bow sits at the empire waist while the skirt is made with several bright colored prints. Made in the USA with a cotton blend. Machine wash gentle, tumble dry low. SIZE 6 AND 6X ONLY LEFT. ^||,|$42.90$|,||,|GIGGLE-MOON-HAPPY-JOYFUL-LUCY-DRESS-LARGE-BOW|,|$URL$giggle-moon-happy-joyful-lucy-dress-large-bow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-happy-and-joyful-lucy-dress-preorder-17.jpg||-||Giggle Moon Happy and Joyful Madison Dress with Pant|,|Fanciful, this Giggle Moon Madison dress is classy and playful. The black damask, long sleeve bodice has a punch of pink with the waistband that ties in a bow adorned with a single flower. The layered skirt adds in yellows and oranges in two different prints. The matching damask pants are hemmed with double ruffles. Made in the USA with a cotton blend. Machine wash gentle, tumble dry low. |,|$49.40$|,||,|GIGGLE-MOON-HAPPY-JOYFUL-MADISON-DRESS-PANT|,|$URL$giggle-moon-happy-joyful-madison-dress-pant.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-happy-and-joyful-madison-dress-with-pant-preorder-11.jpg||-||Giggle Moon Happy and Joyful Tutu Dress with Legging |,|^|One of Giggle Moon's most popular dresses in a trendy color mix, this girls tutu dress is part of the ""Happy and Joyful"" collection. The damask, long sleeve bodice is embellished with lace ruffle cuffs and a wide green fabric that ties into a bow at the back of her waist and upon it sits a pink flower. The pink tulle skirt dances with her movements while the three tiers of white ruffles on the hem are like the frosting on a cake. Paired with black leggings. Made in the USA with a cotton blend. Machine wash gentle, tumble dry low. SIZE 3 MONTH REMAINING. ^||,|$46.80$|,||,|GIGGLE-MOON-HAPPY-JOYFUL-TUTU-DRESS-LEGGING|,|$URL$giggle-moon-happy-joyful-tutu-dress-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-happy-and-joyful-tutu-dress-with-legging-preorder-13.jpg||-||Giggle Moon Harvest Party Girls Lucy Dress |,|^|Vibrant and warm, this girls Lucy dress comes from designer Giggle Moon. The bodice is wrapped with orange and white stripes and finished off with a large orange bow on her empire waist. The skirt is made with a classic A shape and a light refreshing print. The hem is wide and coordinates with the other fabrics. Long sleeves keep her warm. Made in the USA with a cotton blend. Machine wash gentle, tumble dry low. SIZE 6 LEFT. ^||,|$39.00$|,||,|GIGGLE-MOON-HARVEST-PARTY-GIRLS-LUCY-DRESS|,|$URL$giggle-moon-harvest-party-girls-lucy-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-harvest-party-girls-lucy-dress-preorder-17.jpg||-||Giggle Moon Mabel Dress with Ruffled Legging|,|Designed by Giggle Moon, this new girls dress is perfect for the warmer months. The bright yellow damask print covers the drop waist bodice. Her sleeveless neckline is trimmed with a lace ruffle on both shoulders to match the framing of the buttons that run down the center. The skirt is a fun deep pink print fabric. Matching yellow leggings are worn beneath with fun stripes. The double bell hem flips the stripes vertical and the elastic waist offers a comfortable fit. |,|$54.00$|,||,|GIGGLE-MOON-MABEL-DRESS-RUFFLED-LEGGING|,|$URL$giggle-moon-mabel-dress-ruffled-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-mabel-dress-with-ruffled-legging-5.jpg||-||Giggle Moon Mabel Girls Outfit Treasured Possession PREORDER|,|^|Giggle Moon has created this beautiful little girls outfit as a part of their ""Treasured Possession"" collection. The mabel top boasts of a drop waist fit wrapped with bold green and blue ruffles. The long sleeves are capped off with polka dot ruffle cuffs. The hemline has a wide ruffle that skirts around in a bold orange fabric. Down the center of the top we have a ruffle bed upon which we find a trio of large buttons. The matching pants placed beneath are created with the same fabric that has a soft stretch fit. The hem of both legs are bell ruffles to finish the outfit off perfectly! Please note that this item is a PreOrder and is not currently in stock. This item is expected to arrive between July 18, 2014 and September 30, 2014. ^||,|$72.00$|,||,|GIGGLE-MOON-MABEL-GIRLS-OUTFIT-TREASURED-POSSESSION|,|$URL$giggle-moon-mabel-girls-outfit-treasured-possession.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-mabel-girls-outfit-treasured-possession-preorder-1.jpg||-||Giggle Moon Maddison Girls Outfit Thankful Hearts|,|^|Matching many new pieces created by Giggle Moon, this dress and pant set is filled with the orange and lime of the ""Thankful Hearts"" collection. The bold striped bodice has an empire waistline that ties into a bow on the back. The fruit pattern is a sweet addition found on the cotton skirt. The matching pants have a casual fit with an elastic waistline. A double ruffle bell finishes off both legs to match the cuffs. ^||,|$78.00$|,||,|GIGGLE-MOON-MADDISON-GIRLS-OUTFIT-THANKFUL-HEARTS|,|$URL$giggle-moon-maddison-girls-outfit-thankful-hearts.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-maddison-girls-outfit-thankful-hearts-preorder-27.jpg||-||Giggle Moon Madison Dress Set in Wedding Bells|,|^|A sweet new look from designer Giggle Moon, this designer girls outfit is part of the ""Wedding Bells"" collection created for the season of new life and fragrant blooms. The bodice of the dress offers a lace overlay while the jewel neckline is sleeveless. The empire waist is adorned by a vintage script fabric and a large, off-centered flowers. The skirt has a light blue background that is dressed with rich roses. A matching polka dot ruffle peeks out from just beneath. The dress is paired with matching damask pants that boast of a double bell hem. Machine wash cool, gently cycle. Lay flat to dry. Made in the USA. SIZE 3 MOS AND 6 MOS ONLY LEFT.  ^||,|$60.80$|,||,|GIGGLE-MOON-MADISON-DRESS-SET-WEDDING-BELLS|,|$URL$giggle-moon-madison-dress-set-wedding-bells.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-madison-dress-set-in-wedding-bells-15.jpg||-||Giggle Moon Morning Glory Dress with Capri|,|^|A beautiful blend of color, this new girls dress from Giggle Moon is a part of the ""Morning Glory"" collection. The empire bodice has a sleeveless neckline while dressed with a green and ivory chevron stripe print. The dotted waistline ties in the back while a single, off-centered flower is found on the front. The floral skirt is filled with rich tones and a ruffle peeks out beneath the hem. Matching capris are paired beneath with double bells at the hem. ^||,|$59.00$|,||,|GIGGLE-MOON-MORNING-GLORY-DRESS-CAPRI|,|$URL$giggle-moon-morning-glory-dress-capri.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-morning-glory-dress-with-capri-27.jpg||-||Giggle Moon Morning Glory Emma Tunic with Capri|,|^|From designer Giggle Moon, this new arrival is a darling girls outfit for spring and summer. The green and ivory top stripes around her and features a classic sleeveless style. The two pink buttons are framed with floral ruffles. A matching touch of pink introduces the two tiers of ruffles at the hemline. Matching pink capris are paired beneath. Their solid shade is easy to match with many tops while the fun hemline features ruffles. Be sure to check out the other ""Morning Glory"" pieces for matching outfits! ^||,|$49.00$|,||,|GIGGLE-MOON-MORNING-GLORY-EMMA-TUNIC-CAPRI|,|$URL$giggle-moon-morning-glory-emma-tunic-capri.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-morning-glory-emma-tunic-with-capri-7.jpg||-||Giggle Moon Morning Glory Girls Party Dress|,|^|Part of Giggle Moon's spring collection, ""Morning Glory,"" this girls dress is filled with new life and lots of pink! The bodice is covered with a lattice print and the sleeveless neckline is accented with ruffles. The orange, empire waistline ties in a bow on her back and is dressed with a large flower in the front. The skirt opens in shape as it leads down to the hemline. Three different fabrics are tiered and coordinate in a unique look. A sheer ruffle peeks out beneath the skirt to finish the look! ^||,|$49.00$|,||,|GIGGLE-MOON-MORNING-GLORY-GIRLS-PARTY-DRESS|,|$URL$giggle-moon-morning-glory-girls-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-morning-glory-girls-party-dress-7.jpg||-||Giggle Moon Morning Glory Girls Swing Set|,|^|A fun outfit for girls from Giggle Moon, this new arrival is part of the ""Morning Glory"" collection. The sleeveless top boasts of its blend of two-tone, pink patterns. The hem is dressed with two tiers of printed fabric ruffles and just above we find a large orange flower. The bottoms are covered with a green and ivory stripe. The waist stretches with elastic for all day comfort while the bell hem has two layers and a pop of floral. ^||,|$52.80$|,||,|GIGGLE-MOON-MORNING-GLORY-GIRLS-SWING-SET|,|$URL$giggle-moon-morning-glory-girls-swing-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-morning-glory-girls-swing-set-23.jpg||-||Giggle Moon Morning Glory Lucy Dress for Girls|,|A spring and summer dress that welcomes warm sunrays, this new arrival was designed by Giggle Moon. The strappy bodice is green and ivory while the straight neckline is accented with a fun texture of trim. The pink rose fabric creates the skirt while two scoop pockets sit upon the front, accented with trims. The orange sorbet hemline is covered with fun spots to finish this look off right! |,|$49.00$|,||,|GIGGLE-MOON-MORNING-GLORY-LUCY-DRESS-GIRLS|,|$URL$giggle-moon-morning-glory-lucy-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-morning-glory-lucy-dress-for-girls-7.jpg||-||Giggle Moon Morning Glory Tutu Dress with Capri|,|^|Sure to be a popular piece this coming spring and summer, this fabulous tutu dress from Giggle Moon is a part of their ""Morning Glory"" collection. The sleeveless bodice is striped in green and ivory, featuring a fabric that allows slight stretch in its fit. The wide floral waist is dressed with a orange rosette and ties behind her back. The skirt drapes in a full circle shape from her waist. The pink and orange tulle is as sweet as sorbet and gracefully dances around as she moves. Matching capris are found beneath boasting only of the double bell hemline. ^||,|$59.20$|,||,|GIGGLE-MOON-MORNING-GLORY-TUTU-DRESS-CAPRI|,|$URL$giggle-moon-morning-glory-tutu-dress-capri.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-morning-glory-tutu-dress-with-capri-1.jpg||-||Giggle Moon Precious Jewel Summer Dress for Girls|,|^|She'll be the hit of the party in this beautiful dress from Giggle Moon. The patterned white bodice is adorned by a sleeveless pink floral neckline. A deep pink flower offsets the sash waist above tiers of alternating fabric to create the full skirt. Deep pink tulle peaks from beneath the hemline. 100% cotton, machine washable. Made in the USA. (2) 3 MONTH ONLY REMAINING. ^||,|$29.00$|,||,|GIRLS-SUMMER-DRESSES|,|$URL$girls-summer-dresses.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-precious-jewel-summer-dress-for-girls-17.jpg||-||Giggle Moon Ruby Red Girls Party Dress |,|^|A combination too darling, Giggle Moon's new Ruby Red collection is perfectly suited to fall and winter. The long sleeve bodice is in a red floral print and the empire waistline is adorned with animal print rosettes. The full circle skirt has such a pleasant body and mixes two coordinating patterns wonderfully. Red tulle peaks out from beneath the hem. SIZE 3 MOS ONLY REMAINING. ^||,|$39.00$|,||,|GIGGLE-MOON-RUBY-RED-HOLIDAY-GIRLS-PARTY-DRESS|,|$URL$giggle-moon-ruby-red-holiday-girls-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-ruby-red-girls-party-dress-18.jpg||-||Giggle Moon Simply Beautiful Lace Apron Dress|,|^|A sweet new creation from Giggle Moon, this darling pink apron dress is part of the ""Simply Beautiful"" collection. The empire bodice features wide shoulder straps and a lacey ruffle that accents the neckline. The wide waist is accented with a single, off-centered fabric rose. The light pink skirt is covered with a floral pattern and boasts of the dreamy lace apron front. The bottom of the apron is tiered in adorable ruffles, making this a piece filled with feminine charm. ^||,|$49.00$|,||,|GIGGLE-MOON-SIMPLY-BEAUTIFUL-LACE-APRON-DRESS|,|$URL$giggle-moon-simply-beautiful-lace-apron-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-simply-beautiful-lace-apron-dress-5.jpg||-||Giggle Moon Simply Beautiful Pink Romper|,|^|A sweet design for your darling daughter, this new baby girl romper comes from the famous Giggle Moon. The light pink fabric allows slight stretch in its fit while covered with a blooming swirl print. Her shoulders have flutter cap sleeves made with sheer lace while a large wrap rosette is found at her empire waistline. Three rows of flowers are tiered in the center and wrap all the way around. The soft floral fabric is also found on the bell ruffle that is placed as the hem for both legs. Changing her is easy with the classic snaps that line the inseam. SIZE 6 MOS ONLY LEFT.  ^||,|$47.20$|,||,|GIGGLE-MOON-SIMPLY-BEAUTIFUL-PINK-ROMPER|,|$URL$giggle-moon-simply-beautiful-pink-romper.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-simply-beautiful-pink-romper-30.jpg||-||Giggle Moon Simply Beautiful Pink Tutu Dress with Capri|,|^|A darling dress for birthdays or any spring celebration, this new tutu dress is from designer Giggle Moon. The light pink bodice boasts of a fitted cut and a fabric that allows a slight stretch. The empire waist is accented with a softer floral print that ties in a cute bow on her back and features a rosette on the front. The skirt is draped with light pink tulle that is frosted with ivory lace ruffles on the hemline. The skirt sways beautifully around her legs with each movement. Paired beneath are pink and ivory striped capris with double bell ruffles. SIZE 3 MOS ONLY LEFT.  ^||,|$59.20$|,||,|GIGGLE-MOON-SIMPLY-BEAUTIFUL-PINK-TUTU-DRESS-CAPRI|,|$URL$giggle-moon-simply-beautiful-pink-tutu-dress-capri.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-simply-beautiful-pink-tutu-dress-with-capri-5.jpg||-||Giggle Moon Simply Beautiful Swing Set|,|^|A purely innocent sweetness, this new girls outfit from Giggle Moon is filled with love. The light pink top is tiered with three ruffles alternating from floral pattern to sweet ivory lace. The cotton fabric of the bodice allows slight stretch in its fit. Matching pink striped capris are worn beneath. Two ivory lace ruffles create a dreamy bell hemline. Matches all of the new arrivals in the ""Simply Beautiful"" collection for spring and summer. ^||,|$49.00$|,||,|GIGGLE-MOON-SIMPLY-BEAUTIFUL-SWING-SET|,|$URL$giggle-moon-simply-beautiful-swing-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-simply-beautiful-swing-set-5.jpg||-||Giggle Moon Sweet as Honey Dress with Capri|,|^|""Sweet as Honey,"" this new spring and summer collection from Giggle Moon is filled with wonderful girls dresses just like this 'Maddison' dress! The empire waist bodice is a bright yellow fabric that allows slight stretch in its fit. A rich pink fabric is found on the front of the waist, adorned with a green sheer flower. The kaleidoscope floral print covers the blue skirt while a cute ruffle peeks out from beneath. The capris are striped with the same rich shade and offers a double bell hem on both legs. ^||,|$59.00$|,||,|GIGGLE-MOON-SWEET-AS-HONEY-DRESS-CAPRI|,|$URL$giggle-moon-sweet-as-honey-dress-capri.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-sweet-as-honey-dress-with-capri-5.jpg||-||Giggle Moon Sweet as Honey Floral Headwrap|,|^|An adorable new accessory, this Giggle Moon headwrap is designed to match the Sweet as Honey collection, but she will want to wear it with everything! The blue floral fabric has touches of pink and yellow in the pattern. Tie the wrap at the back of her head with a knot or a bow. Off to one side of the front, a large pink flower is accompanied with a vibrant yellow bloom! YOUTH ONLY REMAINING.  ^||,|$19.00$|,||,|GIGGLE-MOON-SWEET-AS-HONEY-FLORAL-HEADWRAP|,|$URL$giggle-moon-sweet-as-honey-floral-headwrap.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-sweet-as-honey-floral-headwrap-10.jpg||-||Giggle Moon Sweet as Honey Yellow Romper|,|^|A vibrant new arrival, this Giggle Moon shortall is part of their ""Sweet as Honey"" collection for the spring and summer. The sleeveless baby romper boasts of a bright yellow vintage print that captures every eye. The burgundy yoke is accented with two large buttons and a lace ruffle borders the fabric. The inseam is lined with classic changing snaps. The hem is a blue print ruffle finished with matching lace. The soft cotton is gentle on her skin and the sleeveless style is easy to layer if the winds still have a touch of chill. ^||,|$47.00$|,||,|GIGGLE-MOON-SWEET-AS-HONEY-YELLOW-ROMPER|,|$URL$giggle-moon-sweet-as-honey-yellow-romper.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-sweet-as-honey-yellow-romper-10.jpg||-||Giggle Moon Thankful Hearts Baby Romper|,|^|Ready to celebrate fall, this new baby girls romper from Giggle Moon is part of their gorgeous ""Thankful Hearts"" collection. The romper features a beautiful blend of orange and lime green. The bodice boasts of a yoke collar decorated with two buttons and an eyelet ruffle. The long sleeves are finished with striped ruffles to match the double bell ruffle that caps off both legs. A row of changing snaps line her inseam. The fabric is a soft cotton that allows stretch in fit and is delicate on her skin. ^||,|$61.00$|,||,|GIGGLE-MOON-THANKFUL-HEARTS-BABY-ROMPER|,|$URL$giggle-moon-thankful-hearts-baby-romper.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-thankful-hearts-baby-romper-preorder-17.jpg||-||Giggle Moon Thankful Hearts Party Dress for Girls|,|A Giggle Moon creation, this new dress is a sweet design that both mother and daughter will love. The dress features a full circle skirt tiered by alternating patterns of fabrics. Her long sleeve bodice is completed by bell ruffle cuffs. The blend of warm oranges and lime green is filled with the feeling of the fall season. A green polka dot yoke is trimmed with an eyelet ruffle and accented by two buttons in the center. |,|$74.00$|,||,|GIGGLE-MOON-THANKFUL-HEARTS-PARTY-DRESS-GIRLS|,|$URL$giggle-moon-thankful-hearts-party-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-thankful-hearts-party-dress-for-girls-preorder-17.jpg||-||Giggle Moon Thankful Hearts Wrap Headband|,|^|From Giggle Moon, this girls hair accessory is the perfect match to any of the pieces from the ""Thankful Hearts"" collection. The fabric headband is tied at the back of her head, allowing her a fit that is all her own. Two flowers are placed upon the fabric, meant to sit off to one side of her head. One of the flowers is a rich orange layered with tulle while the other is a soft ivory with a sequin center. ^||,|$27.00$|,||,|GIGGLE-MOON-THANKFUL-HEARTS-WRAP-HEADBAND|,|$URL$giggle-moon-thankful-hearts-wrap-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-thankful-hearts-wrap-headband-preorder-17.jpg||-||Giggle Moon Tickles and Giggles Tutu Dress with Legging |,|^|Perfect in Pink, this Giggle Moon tutu dress from the ""Tickles and Giggles"" collection makes a stunning little girls birthday dress. The light pink fabric on the bodice is covered with a grey vintage toile print. A trio of rosettes resting on a bed of faux fur is found on her waist. The skirt is made with soft pink tulle overlay and finished with the bubbling grey tulle ruffles tiered at the hemline. Solid grey leggings are paired beneath to keep her warm. ^||,|$46.80$|,||,|GIGGLE-MOON-TICKLES-GIGGLES-TUTU-DRESS-LEGGING|,|$URL$giggle-moon-tickles-giggles-tutu-dress-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-tickles-and-giggles-tutu-dress-with-legging-preorder-38.jpg||-||Giggle Moon Treasured Possession Romper For Infants PREORDER|,|^|New from Giggle Moon, this adorable arrival is a perfect addition to her closet for the fall! From the ""Treasured Possession"" collection, this baby girls romper features blends of green, orange, and blue in its various patterns of fabric. The bodice is a soft fabric that allows slight stretch in its fit while covered with large polka dots . Her long sleeves are finished with single bell ruffles. The rest of the top is layered in alternating fabrics and adorned by a large orange fabric rose. The legs of this romper are in the same polka dots and finished with a matching ruffle. A row of snaps line the inseam for easy changing. Please note that this item is a PreOrder and is not currently in stock. This item is expected to arrive between July 18, 2014 and September 30, 2014. ^||,|$61.00$|,||,|GIGGLE-MOON-TREASURED-POSSESSION-ROMPER-INFANTS|,|$URL$giggle-moon-treasured-possession-romper-infants.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-treasured-possession-romper-for-infants-preorder-1.jpg||-||Giggle Moon Treasured Possession Top and Ruffle Pant PREORDER|,|^|Part of the unique ""Treasured Possession"" collection, this new arrival comes from Giggle Moon. The top boasts of an empire waist that ties into a large bow on her back and is accented with a single fabric bloom on the front. The long sleeves are finished with a single ruffle while the skirt of the tunic is a bold orange, paisley print. The pants are covered with the same fun stripes found on the bodice. Double bell hems are layered with two different cotton fabrics. Please note that this item is a PreOrder and is not currently in stock. This item is expected to arrive between July 18, 2014 and September 30, 2014. ^||,|$78.00$|,||,|GIGGLE-MOON-TREASURED-POSESSEION-TOP-RUFFLE-PANT|,|$URL$giggle-moon-treasured-posesseion-top-ruffle-pant.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-treasured-possession-top-and-ruffle-pant-preorder-1.jpg||-||Giggle Moon Tutu Dress and Legging Thankful Hearts|,|One of the famous styles from Giggle Moon, this tutu dress looks perfect in photographs! The empire bodice is covered with a modern flower print while a single ruffle creates the cuff on both long sleeves. The polka dot waist ties into a bow on her back while the yoke collar is home to two quaint buttons and a touch of eyelet fabric. The skirt is draped with a full circle, tulle overlay in orange with frosting ruffles in green. Matching leggings come with the dress to complete the outfit! |,|$76.00$|,||,|GIGGLE-MOON-TUTU-DRESS-LEGGING-THANKFUL-HEARTS|,|$URL$giggle-moon-tutu-dress-legging-thankful-hearts.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-tutu-dress-and-legging-thankful-hearts-preorder-22.jpg||-||Giggle Moon Tutu Dress Sweet as Honey|,|^|Giggle Moon is now offering this unique girls dress from their ""Sweet as Honey"" collection. The bodice boasts of a fun damask print in yellow while the fabric allows slight stretch in fit. The empire waistline is a blue floral print that ties in the back. A large bow is found in the front, boasting of a patterned center. The skirt is draped with vibrant yellow tulle. The tiers of ruffles are like frosting on a cake as they gracefully move with her every step and sway. Matching striped leggings are placed beneath and finished with a double ruffle hemline. SIZE 3 MOS AND 4 ONLY LEFT.  ^||,|$59.00$|,||,|GIGGLE-MOON-TUTU-DRESS-SWEET-AS-HONEY|,|$URL$giggle-moon-tutu-dress-sweet-as-honey.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-tutu-dress-sweet-as-honey-10.jpg||-||Giggle Moon Wedding Bells Girls Party Dress|,|^|Their most popular cut, this cute girls party dress is designed by Giggle Moon as a part of their ""Wedding Bells"" collection for the spring. The sweet bodice has a soft lace overlay and a sleeveless neckline to welcome the warmer weather. The front waist is lined with a row of large, sheer flowers. The matching skirt is tiered with three separate prints and opens to a full circle shape. The extra fabric frolics around her legs with each movement while blue tulle peaks out from the hemline. The floral patterns are made with a gorgeous blend of light blue and deep pink. The fun polka dot sits in the center. Machine wash cool, gently cycle. Lay flat to dry. Made in the USA. (1) 4T AND (1) 4 ONLY LEFT.  ^||,|$57.60$|,||,|GIGGLE-MOON-WEDDING-BELLS-GIRLS-PARTY-DRESS|,|$URL$giggle-moon-wedding-bells-girls-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-wedding-bells-girls-party-dress-7.jpg||-||Giggle Moon Wedding Bells Tutu Dress with Legging|,|^|New from Giggle Moon, this tutu dress for girls is sure to become a popular spring look. The bodice is cut for a fitted look and offers her a sleeveless neckline. The light damask print draws from vintage inspiration while the fabric allows slight stretch. The wide floral waist is dressed with a large fabric flower that is off centered to the side. This fabric is tied into a large beautiful bow on her back. The classic skirt is created with a sugar blue tulle that is accented with a darker brown that dances in tiered ruffles around her legs. Matching striped leggings are paired beneath with bell hems. Match this design to the other pieces found in Giggle Moon's ""Wedding Bells"" collection for sweet sister photos. Machine wash cool, gently cycle. Lay flat to dry. Made in the USA. 9 MOS ONLY LEFT.  ^||,|$59.20$|,||,|GIGGLE-MOON-WEDDING-BELLS-TUTU-DRESS-LEGGING|,|$URL$giggle-moon-wedding-bells-tutu-dress-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/giggle-moon-wedding-bells-tutu-dress-with-legging-7.jpg||-||Girls Handmade Headband in Pink and Silver|,|^|Quickly becoming a favorite way to top off all of her beautiful outfits, this handmade pink headband is now available. The pink lace allows stretch to fit around her head while a matching light pink puff flower is made up of skinny loops of raw-edged tulle. Sitting to the side we find a sparkling silver flower and a darker grey flower splattered with intermittent glitter and featuring a pearl center. (1) MEDIUM (2T-4T) ONLY REMAINING.  ^||,|$21.75$|,||,|GIRLS-HANDMADE-HEADBAND-PINK-SILVER|,|$URL$girls-handmade-headband-pink-silver.html|,|http://ep.yimg.com/ay/yhst-17102259411242/girls-handmade-headband-in-pink-and-silver-12.jpg||-||Girls Handmade Peach Flower Clip with Jewel Center|,|Arriving just in time to compliment her many fall and winter outfits, this new girls hair clip is handmade with great love. The peach satin circles gather in the center and layer with their raw edges. A quaint jeweled center finishes off the clip with a dazzle. Placed upon an alligator pinch clip. |,|$12.00$|,||,|GIRLS-HANDMADE-PEACH-FLOWER-CLIP-JEWEL-CENTER|,|$URL$girls-handmade-peach-flower-clip-jewel-center.html|,|http://ep.yimg.com/ay/yhst-17102259411242/girls-handmade-peach-flower-clip-with-jewel-center-11.jpg||-||Girls Headband Made to Match Giggle Moon|,|Such a darling new arrival, this handmade boutique girls headband will finish off her new Giggle Moon outfit with whimsical beauty. The colors blend beautifully from the lime green, coral pink, and warm autumn orage. The trio of flowers boast of four separate textures introducting, chiffon, raw edges, satin, and sparkling tulle. The chocolate brown lace stretches around her head and perfectly compliments the vibrant garden. |,|$14.00$|,||,|GIRLS-HEADBAND-MADE-MATCH-GIGGLE-MOON|,|$URL$girls-headband-made-match-giggle-moon.html|,|http://ep.yimg.com/ay/yhst-17102259411242/girls-headband-made-to-match-giggle-moon-3.jpg||-||Glam Hatter Hot Pink Polka Dot Birthday Crown|,|^|Bright party colors make this new birthday crown offered from the Glam Hatter a certain delight. Polka dots fill the background as bright orange and yellow crepe paper trim the edges and the center. The ""Its My Birthday"" banner is framed with two pink crepe paper roses and two cloth ribbons tie in the back for a custom fit. ONE ONLY LEFT.  ^||,|$9.00$|,||,|GLAM-HATTER-HOT-PINK-POLKA-DOT-BIRTHDAY-CROWN|,|$URL$glam-hatter-hot-pink-polka-dot-birthday-crown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/glam-hatter-hot-pink-polka-dot-birthday-crown-11.jpg||-||Halabaloo Blue and White Infant and Toddler Dress|,|Halabaloo is now offering this new dress as a part of their fun-filled spring collection. The dress features a shapeless fit created with a fabric that has a carefree drape. The front of the dress is framed with a scrolling print. The scoop neckline is made with thin black straps while the pleats fall down to open a relaxed fit. A keyhole in the back is tied shut with a matching bow. Cotton/Poly blend. Hand wash and line dry. |,|$52.50$|,||,|HALABALOO-BLUE-WHITE-INFANT-TODDLER-DRESS|,|$URL$halabaloo-blue-white-infant-toddler-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-blue-and-white-infant-and-toddler-dress-1.jpg||-||Halabaloo Blue Flare Dress with Pom Poms|,|A sweet new design by loved Halabaloo, this new girls dress is a part of their spring and summer collection. The boat neckline features thin shoulder straps and a sweet row of pom poms. The piece features an easy pull over fit that she can even do herself. The shape opens to a full circle, introduced by the panels of periwinkle blue fabric. The excess fabric flowers around her with every step that she takes. |,|$52.50$|,||,|HALABALOO-BLUE-FLARE-DRESS-POM-POMS|,|$URL$halabaloo-blue-flare-dress-pom-poms.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-blue-flare-dress-with-pom-poms-1.jpg||-||Halabaloo Elegant Girls Dress in Blue Lace|,|A true show stopper for the holiday season, this new Halabaloo dress is sure to make memories last a lifetime. The bodice features a classic waist and sheer cap sleeves. The metallic silver lining shines through the navy contrast as a hidden zipper closes the back. The sweet floral lace covers her from neck to hem while a matching satin sash ties around her waist in a bow. This dress is perfect for photos, gatherings, celebrations, and recitals! Lace: viscose and nylon; Lining: nylon and metal. Gently hand wash and line dry. |,|$47.00$|,||,|HALABALOO-ELEGANT-GIRLS-DRESS-BLUE-LACE|,|$URL$halabaloo-elegant-girls-dress-blue-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-elegant-girls-dress-in-blue-lace-2.jpg||-||Halabaloo Elegant Sparkle Tutu Dress for Little Girls|,| |,|$114.00$|,||,|HALABALOO-ELEGANT-SPARKLE-TUTU-DRESS-LITTLE-GIRLS|,|$URL$halabaloo-elegant-sparkle-tutu-dress-little-girls.html|,|||-||Halabaloo Garden Party Ivory Girls Dress|,|Prepared for whatever event may be in her calendar, this new designer girls flower dress comes from Halabaloo. The dress is draped from the neck to the hem with a sheer fabric covered with a quaint dot print. The strappy neckline has a scoop shape while accented with a garden of pastel flowers finished with shimmering centers. A small keyhole on the back with button closure. Nylon. Hand wash. Line dry. |,|$49.00$|,||,|HALABALOO-GARDEN-PARTY-IVORY-GIRLS-DRESS|,|$URL$halabaloo-garden-party-ivory-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-garden-party-ivory-girls-dress-1.jpg||-||Halabaloo Geo Print Dress for Girls|,|Bright and lively, this new designer dress for girls was created by New York brand, Halabaloo. The fun printed fabric is covered with orange, lime, and sky blue with small touches of pink. The dress features a high, wide neckline accented with a single fabric rosette. The back of the dress has a cute keyhole feature secured with a button. The fabric drapes down the dress with a flare, shapeless fit. The fabric responds actively to her movements has it sways around her legs. Cotton. Hand wash gently in cold water. Hang to dry. |,|$49.00$|,||,|HALABALOO-GEO-PRINT-DRESS-GIRLS|,|$URL$halabaloo-geo-print-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-geo-print-dress-for-girls-17.jpg||-||Halabaloo Girls Fuchsia Feather Dress|,|^|From designer Halabaloo, this girls fuchsia feather dress has that wow factor! Resplendent in fuchsia, the dress has a mesh overlay simply covered in fuchsia feathers that dance about the front and back. The circular neckline has wide straps over her shoulders. A lining of the same dark fuchsia is found underneath the overlay. Made from nylon/polyester/acetate. Hand wash gently in cold water, line dry. Can also be dry cleaned. SIZE 2T ONLY AVAILABLE.  ^||,|$39.00$|,||,|HALABALOO-GIRLS-FUCHSIA-FEATHER-DRESS|,|$URL$halabaloo-girls-fuchsia-feather-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-girls-fuchsia-feather-dress-14.jpg||-||Halabaloo Girls Polka Dot Dress in Pink|,|Perfect for Easter and birthday celebrations, this new Halabaloo design is an adorable polka dot dress. The straight neckline offers her a comfortable smocked fit that allows stretch. The thin shoulder straps tie in a bow on the top of both shoulders. The sheer fabric is covered with the large dots and falls gracefully. The hemline is introduced with tiers of coordinating ruffles. Poly. Hand wash and line dry. |,|$49.50$|,||,|HALABALOO-GIRLS-POLKA-DOT-DRESS-PINK|,|$URL$halabaloo-girls-polka-dot-dress-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-girls-polka-dot-dress-in-pink-1.jpg||-||Halabaloo Glitter Dot Girls Long Sleeve Dress with Bow|,|This new casual girls dress from designer Halabaloo speaks to her playful side. The comfortable knit bodice features long sleeves and a cute oversized bow just beneath the neckline. The skirt boasts of its tulle overlay covered with silver glitter polka dots. Perfect for the active little girl with style! Made with a stretch cotton blend, hand wash only with care. |,|$37.00$|,||,|HALABALOO-GLITTER-DOT-GIRLS-LONG-SLEEVE-DRESS-BOW|,|$URL$halabaloo-glitter-dot-girls-long-sleeve-dress-bow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-glitter-dot-girls-long-sleeve-dress-with-bow-14.jpg||-||Halabaloo Gold Special Occasion Dress|,|A sparkling delight, this new Halabaloo girls dress comes just in time for all of your winter celebrations! The sleeveless bodice has a timeless cut and a hidden zipper that closes the back. The golden texture print on the front adds elegance. The dreamy skirt has a fairytale fell with the high low cut and layers of tulle. The top layer is covered with golden glitter while a single rosette sits at the waist. Bodice: Cotton blend, skirt: 100% polyester. Fully lined in a poly cotton blend. Hand wash with care and line dry. |,|$99.00$|,||,|HALABALOO-GOLD-SPECIAL-OCCASION-DRESS|,|$URL$halabaloo-gold-special-occasion-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-gold-special-occasion-dress-17.jpg||-||Halabaloo Ivory Dress Flower Girl|,|A couture gown for girls, this new designer dress was created by Halabaloo. The light ivory endears itself to our hearts as it is dressed in rich, rosette texture. The sleeveless neckline is a jewel shape. A hidden zipper fastens in the back. A light sash is tied in a bow around her waist to define the empire height. The skirt is filled with volume that speaks to the grace of the dress. The rosette flowers glimmer in the light with a satin sheen. Polyester. Dry clean only. |,|$73.50$|,||,|HALABALOO-IVORY-DRESS-FLOWER-GIRL|,|$URL$halabaloo-ivory-dress-flower-girl.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-ivory-dress-flower-girl-1.jpg||-||Halabaloo Navy Dot Anchor Girls Dress|,|^|She'll drop anchor in style in this navy dot anchor girls dress from Halabaloo. It's a summer classic that never goes out of style. Large navy dots cover the entire dress. The sleeveless bodice has button closures at the shoulders. The racer back is wrapped in red and white stripes. The A-line shape of the dress features two small slits on the sides. A large anchor of red and white stripes adorns the front of the dress. Outer dress is 100% cotton. Lining is made from cotton and polyester. Hand wash gently in cold water, line dry. Can also be dry cleaned. SIZE 6 ONLY LEFT. ^||,|$29.00$|,||,|HALABALOO-NAVY-DOT-ANCHOR-GIRLS-DRESS|,|$URL$halabaloo-navy-dot-anchor-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-navy-dot-anchor-girls-dress-14.jpg||-||Halabaloo Neon Girls Party Dress|,|A brilliant new design, this fabulous girls dress comes from Halabaloo. The bright neon colors of yellow, orange, and pink stripe from head to hem. The wide boat neckline is accentuated by the straight stripes while a hidden zipper closes the fit in the back. The skirt opens in shape immediately from the waist. The sheer fabric falls gracefully and is fully lined. Poly. Hand wash. Line Dry. |,|$58.50$|,||,|HALABALOO-NEON-GIRLS-PARTY-DRESS|,|$URL$halabaloo-neon-girls-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-neon-girls-party-dress-1.jpg||-||Halabaloo Neon Rainbow Dress for Girls|,|^|Matching the fabulous neon dress, this new design from Halabaloo is for the fashionista with a bright style. The flare dress drapes elegantly from the scoop neckline to the dancing hem. The pleats that fall from the neck open the shape while a cute bow ties the keyhole found on the back. The neon orange, pink and yellow fabric is sheer and feminine. The dress is lined in white. Poly. Hand wash cold and line dry. SIZE 24 MOS AND 2T ONLY LEFT.  ^||,|$52.50$|,||,|HALABALOO-NEON-RAINBOW-DRESS-GIRLS|,|$URL$halabaloo-neon-rainbow-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-neon-rainbow-dress-for-girls-1.jpg||-||Halabaloo Pink Tulle Dress with Rosettes|,|A delicate, feminine design, this new girls dress comes from Halabaloo. The soft shade of pink holds an elegance of its own that is amplified by the swaying drape of the sheer, polka dot fabric. The neckline has a classic shape and a sleeveless cut while a single button fastens on the back. The hemline falls to an uneven shape. Small pink flowers are sprinkled upon the skirt. The sheer fabric opens to a full circle shape making it a perfect twirl dress. Nylon. Hand wash. Line dry. |,|$64.50$|,||,|HALABALOO-PINK-TULLE-DRESS-ROSETTES|,|$URL$halabaloo-pink-tulle-dress-rosettes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-pink-tulle-dress-with-rosettes-1.jpg||-||Halabaloo Red Sequin Dress for Girls|,|^|Unlike any other dress she owns, this new Halabaloo dress is a fun-filled design sure to make her smile. The red dress offers slight gathers at the neckline and a hidden zipper that secures the fit. Her cap sleeves are simply darling! Large red sequins fall in lines on the red tulle overlay. This dress is fully lined for her comfort and privacy. Made with 100% polyester and 100% acetate. Hand wash delicately and hang to dry. SIZE 3T AND 6X ONLY LEFT. ^||,|$49.00$|,||,|HALABALOO-RED-SEQUIN-HOLIDAY-DRESS-GIRLS|,|$URL$halabaloo-red-sequin-holiday-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/halabaloo-red-sequin-holiday-dress-for-girls-2.jpg||-||Handmade Girls Headband Pink Scallop Lace|,|A beautiful design for your darling daughter's new outfits, this girls headband is handmade with great attention to the details. The stretch band is a light pink lace with scalloped edges and a slight sheen to the floral design. An open bloom and spiral rosette sit off centered on her head while a gem center shines out. Small touches of tulle are found in the rosette as well as creating a small fan to peak out from behind the design. |,|$32.00$|,||,|HANDMADE-GIRLS-HEADBAND-PINK-SCALLOP-LACE|,|$URL$handmade-girls-headband-pink-scallop-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/handmade-girls-headband-pink-scallop-lace-13.jpg||-||Handmade Girls Pink Headband|,|^|Handmade by a local Indiana artist, Myka Stutzman, this new girls headband is absolutely a work of art. The light pink knit headband wraps around her head and boasts of a unique flower adornment. The wrapped rosette is accented with a crystal gem while the unique petal rosettes are created with flat satin, lace, and tulle. The trio of flowers measure roughly 5"" X 4.5"" and sit off to one side of her head. SIZE 4 TO 6X ONLY AVAILABLE. ^||,|$19.00$|,||,|HANDMADE-GIRLS-PINK-HEADBAND|,|$URL$handmade-girls-pink-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/handmade-girls-pink-headband-11.jpg||-||Handmade Red Headband |,|^|Absolutely gorgeous, this new girls headband outshines anything compared to it. The oversized flower boasts of multiple fabric and texture in the same warm shade. From satin to French netting and sheer shimmer ribbon, this girls headband is truly remarkable. A shimmering gem center compliments this fancy design. The flower is placed upon a stretch black lace band. This flower is a perfect match for the Giggle Moon Dance for Joy collection as well as many other LaBella Flora designers. Perfect for the holiday season! SIZE LARGE (Age 4-10) ONLY LEFT.  ^||,|$19.00$|,||,|HANDMADE-RED-HEADBAND-SELLA-DESIGNS|,|$URL$handmade-red-headband-sella-designs.html|,|http://ep.yimg.com/ay/yhst-17102259411242/handmade-red-headband-1.jpg||-||Handmade Teal Blue Sparkling Butterfly Headband|,|Made by local artisan, Myka Stutzman, this gorgeous headband is sure to please. Made to pair with the Moxie and Mabel Amelia Dress in Rodeo Blue, she will adore it. Whimsical fabric butterflies flit about on the teal blue headband. Rhinestone accents on their wings give some sparkle. |,|$19.50$|,||,|HANDMADE-TEAL-BLUE-SPARKLING-BUTTERFLY-HEADBAND|,|$URL$handmade-teal-blue-sparkling-butterfly-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/handmade-teal-blue-sparkling-butterfly-headband-16.jpg||-||Hannah Banana Black Flower Girls Tutu Skirt|,|Turning her favorite new tops into a stunning outfit, this tween tutu skirt comes from Hannah Banana. The black skirt is covered with a flower pattern to add great texture. The under layer of tulle that provides the great volume and movement peaks out from underneath the hem. 100% polyester. Hand wash cold, flat dry. |,|$32.40$|,||,|HANNAH-BANANA-BLACK-FLOWER-GIRLS-TUTU-SKIRT|,|$URL$hannah-banana-black-flower-girls-tutu-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-black-flower-girls-tutu-skirt-2.jpg||-||Hannah Banana Black Pleather Girls Dress with Lace|,|Revealing the punk inspirations found in her wardrobe, this new Hannah Banana dress is rocking. The bodice boasts of a fitted shape, with the structure for this piece provided by the tucking on the front. Short sleeves and a hidden zipper finish the bodice along with a silver stud design. The black pleather opens up at the front of the skirt to allow the sweet black lace to peak out. Made with polyester blend. Hand wash cold, flat dry. |,|$44.40$|,||,|HANNAH-BANANA-BLACK-PLEATHER-GIRLS-DRESS-LACE|,|$URL$hannah-banana-black-pleather-girls-dress-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-black-pleather-girls-dress-with-lace-2.jpg||-||Hannah Banana Boutique Girls Dress Shark Bite Hem|,|^|Hannah Banana is now offering this adorable girls dress from their ""Magic Pink"" collection. The Bodice has an A-line cut and features an embroidered applique upon the front. The sweet notebook stripes alternate between white and pink. The skirt has a touch of glitter polka dot tulle. Brushed lace is found accenting the sides and defining the sharkbite shape. Polyester/Cotton. Hand wash inside out in cold water. Hang to dry. ^||,|$78.00$|,||,|HANNAH-BANANA-BOUTIQUE-GIRLS-DRESS-SHARK-BITE-HEM|,|$URL$hannah-banana-boutique-girls-dress-shark-bite-hem.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-boutique-girls-dress-shark-bite-hem-15.jpg||-||Hannah Banana Couture Dress for Tweens in White|,|The perfect casual dress for your tween this summer, this new design is from the loved brand, Hannah Banana. The bodice of this dress has a sleeveless neckline and an exposed zipper. Touches over lace overlay on the front and are complete with fun studs. The waist is defined with the same lacy fabric while the skirt falls in three tiers. The white sheer fabric is found on top while a lace creates the bottom layer. 100% cotton with polyester/spandex lining. Hand wash cold inside out, dry flat. |,|$63.00$|,||,|HANNAH-BANANA-COUTURE-DRESS-TWEENS-WHITE|,|$URL$hannah-banana-couture-dress-tweens-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-couture-dress-for-tweens-in-white-1.jpg||-||Hannah Banana Faux Leather Tween Jegging with Studs|,|^|Edgy and trendy, these new jeggings from designer Hannah Banana will catch your tween's eye for style. The black legging boasts of its faux leather look insuring that no animal was harmed in their making. With the classic fitted look, these jeggings look great paired with tunics, dresses, and skirts. Catching the light and adding that perfect small touch, silver studs run down the outer side of both legs. Made with a polyester blend. Hand wash cold. SIZE 10 AND 14 ONLY AVAILABLE.  ^||,|$33.60$|,||,|HANNAH-BANANA-FAUX-LEATHER-TWEEN-JEGGING-STUDS|,|$URL$hannah-banana-faux-leather-tween-jegging-studs.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-faux-leather-tween-jegging-with-studs-3.jpg||-||Hannah Banana Girls A-Line Dress in Geometric PREORDER|,|^|Patterned with geometric shapes, this new girls dress was created by Hannah Banana. The dress features long sleeves in pink and a brown trim around the neck. Three large buttons fall from the center of the neckline while the stretch in the fabric allows for an easy pull over fit. The back of the dress matches the black and white ruffle hemline. Please note that this is a PreOrder item and is NOT currently in stock. This Hannah Banana item is expected to arrive by October 3, 2014. ^||,|$72.00$|,||,|HANNAH-BANANA-GIRLS-A-LINE-DRESS-GEOMETRIC|,|$URL$hannah-banana-girls-a-line-dress-geometric.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-girls-a-line-dress-in-geometric-12.jpg||-||Hannah Banana Girls Back to School Dress|,|This new girls dress from Hannah Banana is a darling design that will look fabulous on the playground. The dress is cut for a straight, casual fit and features leopard print fabric creating the long sleeves. A zipper runs up the back of the dress to fasten the fit. A fabric applique forms a blooming flower upon the front, complete with two leaves. Polyester/Rayon/Spandex. Hand wash inside out in cold water. Hang to dry. |,|$62.00$|,||,|HANNAH-BANANA-GIRLS-BACK-SCHOOL-DRESS|,|$URL$hannah-banana-girls-back-school-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-girls-back-to-school-dress-16.jpg||-||Hannah Banana Girls Dress with Daisies|,|In a bold pink, this new Hannah Banana dress is part of the collection for spring and summer. The bodice of the dress features a white lining and a neckline that rises higher in the front. The back of the bodice has an exposed metal zipper. A braided belt ties around her waist in a knot or a bow while the ends are finished with colorful tassels. The skirt has the same lining that peaks through the pink mesh. Large sunflowers pattern the sheer fabric and the sleeveless neckline is easy to layer. You can almost do no wrong when accessorizing this fun piece! 100% polyester. Hand wash cold, lay flat to dry. |,|$39.00$|,||,|HANNAH-BANANA-GIRLS-DRESS-DAISIES|,|$URL$hannah-banana-girls-dress-daisies.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-girls-dress-with-daisies-17.jpg||-||Hannah Banana Girls Lace Dress in Ivory|,|In a white, this new girls dress comes from designer Hannah Banana and is such an adorable style. The sleeveless bodice features a neckline accented with a chevron stripe. The center of the bodice is accented with fabric applique lines. The skirt begins high because of the empire waistline. The lining is draped with a sweet white lace patterned in a flower print. The piece is finished with a handkerchief hemline. Hand wash cold, dry flat. 100% cotton with nylon lining. |,|$54.00$|,||,|HANNAH-BANANA-GIRLS-LACE-DRESS-IVORY|,|$URL$hannah-banana-girls-lace-dress-ivory.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-girls-lace-dress-in-ivory-17.jpg||-||Hannah Banana Girls Legging Outfit with Lace|,|Hannah Banana is now offering this wonderful tunic and legging outfit for girls. The taupe top falls to a hi-low hem. The front of the top boasts of several different textures of fabric and color. This decoration includes crochet lace and an embroidered design found near the center. The bottom of the tunic features an ivory lace that falls from beneath the hem. Accompanying the top, the capri leggings are covered with a unique flower print. This outfit will be unlike anything else she has. Poly/rayon blend. Hand wash inside out, dry flat. |,|$78.00$|,||,|HANNAH-BANANA-GIRLS-LEGGING-OUTFIT-LACE|,|$URL$hannah-banana-girls-legging-outfit-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-girls-legging-outfit-with-lace-28.jpg||-||Hannah Banana Girls Tunic Dress with Leggings Purple|,|Positively sweet, this dress and legging set from Hannah Banana is created in rich purple shades. The solid dress is a skater shape that opens in fit as it nears the hemline. A wide neckline is framed with long sleeves. The dress is paired with rose printed leggings that have a comfortable, all day fit. The bottom of the leggings are dressed with soft faux fur. Cotton/Spandex Blend. Hand Wash in Cold Water. Lay Flat to Dry. |,|$68.00$|,||,|HANNAH-BANANA-GIRLS-TUNIC-DRESS-LEGGINGS-PURPLE|,|$URL$hannah-banana-girls-tunic-dress-leggings-purple.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-girls-tunic-dress-with-leggings-purple-27.jpg||-||Hannah Banana Grey Military Inspired Jacket|,|^|Helping create a simply adorable outfit, this darling girls jacket comes from the loved designer Hannah Banana. The long sleeve jacket is created in a dark grey fabric boasting of contrast stiching accenting the tucks on the front and both cuffs. Purple pleated edging lines the neck, hemline, and the two front pockets. Six metal buttons adorn the front to finish off this incredible look! Be sure to look for the matching skirt. Made with a cotton blend. Hand wash cold. SIZES 7 AND 14 ONLY REMAINING.  ^||,|$37.20$|,||,|HANNAH-BANANA-GREY-MILITARY-INSPIRED-JACKET|,|$URL$hannah-banana-grey-military-inspired-jacket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-grey-military-inspired-jacket-2.jpg||-||Hannah Banana Grey Mini Skirt for Tweens|,|^|Matching a new jacket created by Hannah Banana for the fall, this mini skirt is adorable. The grey skirt boasts of two purple pleated stripes running down the front while two large buttons were found on both front pockets. The hemline is accented by contrast white stitching. Made with a cotton blend, hand wash cold. SIZE 12 ONLY LEFT.  ^||,|$24.90$|,||,|HANNAH-BANANA-GREY-MINI-SKIRT-TWEENS|,|$URL$hannah-banana-grey-mini-skirt-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-grey-mini-skirt-for-tweens-3.jpg||-||Hannah Banana Hi-Low Girls Graphic Top|,|^|A style all its own, this new tween top comes from designer Hannah Banana. The ivory top features long sleeves to help keep her warm and a classic jewel neckline. The top is finished off with a very trendy hi-low hemline. A large graphic screen print sits upon the front in a black and ivory fashion. Pairs great with the Hannah Banana flower tutu skirt! Made with rayon blend. Hand wash cold, flat dry. SIZE 12 AND 14 REMAINING.  ^||,|$29.00$|,||,|HANNAH-BANANA-HI-LOW-GIRLS-GRAPHIC-TOP|,|$URL$hannah-banana-hi-low-girls-graphic-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-hi-low-girls-graphic-top-3.jpg||-||Hannah Banana Ivory Tween Tunic with Tiered Hem|,|^|New from designer Hannah Banana, this tween girls top will be the show stopper in any of her outfit creations this fall. The long sleeve bodice is a light ivory shade and features a scoop neckline embellished by studs. The tunic's elegant style is enhanced by the light ruffled tiers of matching sheer fabric falling down to the hemline. Made with rayon blend. Hand wash cold, flat dry. 12 AND 14 AVAILABLE. ^||,|$35.40$|,||,|HANNAH-BANANA-IVORY-TWEEN-TUNIC-TIERED-HEM|,|$URL$hannah-banana-ivory-tween-tunic-tiered-hem.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-ivory-tween-tunic-with-tiered-hem-2.jpg||-||Hannah Banana Little Girls Chiffon Dress|,|Filled with fun and a unique look, this new designer girls dress is a new design from Hannah Banana. The bodice is wrapped in blue stripes and the back of the bodice is longer than the front. The fabric is cut for a more fitted look and the punch of yellow on the neckline is a row of dangling pom poms. The sides offer a lace overlay. The pink skirt coordinates well with a blue floral print. The light weight chiffon is a refreshing fabric in the warm sun. The high low hem really ties the piece together while a matching lining is underneath the skirt. Polyester. Hand wash inside out, dry flat. |,|$39.00$|,||,|HANNAH-BANANA-LITTLE-GIRLS-CHIFFON-DRESS|,|$URL$hannah-banana-little-girls-chiffon-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-little-girls-chiffon-dress-1.jpg||-||Hannah Banana Little Girls Dress with Fringe|,|A new creation from designer Hannah Banana, this fabulous girls dress is sure to accompany many adventures in the coming months. The dress features a trendy racer back cut with a wide scoop neckline. The neckline is accented with fringe both in the front and the back. The dress has a color block chevron stripe that is complimented with the three tiers of fringe. The shades of pink include coral and a pale pink. This dress is sure to be one that she fall in love with every time she wears it. Poly/rayon blend. Hand wash inside out, dry flat. |,|$42.00$|,||,|HANNAH-BANANA-LITTLE-GIRLS-DRESS-FRINGE|,|$URL$hannah-banana-little-girls-dress-fringe.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-little-girls-dress-with-fringe-1.jpg||-||Hannah Banana Little Girls Floral Dress in Black|,|^|Cute in pink, this fabulous casual girls dress was designed by Hannah Banana as a part of their spring and summer collection. The fitted bodice is in an eraser pink and is covered with an overlay. The sheer fabric is embroidered with a swirly flower design. The waistline is giving a unique look with the shape of the draping skirt. A chiffon skirt is both elegant and cool in the warm sun rays. The black is a striking contrast to the bodice while the floral print is large and colorful. The skirt is finished with a ruffle and hi-low hemline. Polyester. Hand wash inside out, dry flat. (2) SIZE 5 ONLY LEFT.  ^||,|$44.25$|,||,|HANNAH-BANANA-LITTLE-GIRLS-FLORAL-DRESS-BLACK|,|$URL$hannah-banana-little-girls-floral-dress-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-little-girls-floral-dress-in-black-1.jpg||-||Hannah Banana Metallic Leggings for Tweens in Bronze|,|A perfect choice to wear beneath her new dresses and tunics, these metallic tween leggings were designed by Hannah Banana. The leggings have a stretch fit and have a faux finish in metallic silver. The stretch waist is made with elastic. The shimmer from the finish catches the light beautifully. Rayon/Spandex Blend. Hand Wash in Cold Water. Lay Flat to Dry. |,|$34.00$|,||,|HANNAH-BANANA-METALLIC-LEGGINGS-TWEENS-BRONZE|,|$URL$hannah-banana-metallic-leggings-tweens-bronze.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-metallic-leggings-for-tweens-in-bronze-16.jpg||-||Hannah Banana Plaid Chiffon Girls Top with Shorts|,|Helping her set the bar high in style, this new girls outfit comes from Hannah Banana. The long sleeve top features dark blue trimming and a sheer plaid fabric. The collar and button flaps are all adorne dby studs while a solid tank is paired beneath. The matching navy shorts boast of the same embellishments on the pocket flaps. Top: 100% polyester. Tank: Cotton blend. Shorts: 100% cotton. Hand wash cold. |,|$57.60$|,||,|HANNAH-BANANA-PLAID-CHIFFON-GIRLS-TOP-SHORTS|,|$URL$hannah-banana-plaid-chiffon-girls-top-shorts.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-plaid-chiffon-girls-top-with-shorts-2.jpg||-||Hannah Banana Studded Tween Jacket Faux Leather|,|^|A cute new pleather jacket from designer Hannah Banana, this creation is taking the fall and winter season by storm. The coat features long sleeves and a great shape! The trickling studs that adorn the front are a silver, bring the perfect measure of sparkle. The wrap front zippers off centered to the left. Made with polyester blend. Hand wash cold, flat dry. SIZE 8 ONLY LEFT.  ^||,|$46.80$|,||,|HANNAH-BANANA-STUDDED-TWEEN-JACKET-FAUX-LEATHER|,|$URL$hannah-banana-studded-tween-jacket-faux-leather.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-studded-tween-jacket-faux-leather-2.jpg||-||Hannah Banana Turquoise Ruffle Trimmed Girls Dress|,|^|Trendy in turquoise, this girls dress from Hannah Banana is a beautiful addition to her closet for spring. The ruffled elastic neckline can be worn off one shoulder if she desires. Half length sleeves end in a bell ruffle of three layers. The drop waist is elasticized for comfort and stretch. A double row of ruffles sits just below the drop waist and the hem is finished in a double row of ruffles. The turquoise color is accented beautifully with a delicate pink flower pattern throughout. The sheer fabric is lined with a removable inner slip in turquoise. Polyester. Hand wash cold, hang to dry. SIZE 4 AVAILABLE. ^||,|$39.00$|,||,|HANNAH-BANANA-TURQUOISE-RUFFLE-TRIMMED-GIRLS-DRESS|,|$URL$hannah-banana-turquoise-ruffle-trimmed-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-turquoise-ruffle-trimmed-girls-dress-7.jpg||-||Hannah Banana Tween Chevron Maxi Dress|,|^|Stylish and cute, this new casual tween dress comes from designer Hannah Banana. The back of the top is accented with criss cross fabric while the front has a unique look. Stripes and stitches of fabric create the appliques and a few buttons are lined up in the center. The main portion of the dress is the deep blue skirt. The background is covered with a retro inspired print that takes on a new look for the popular chevron stripes. Small boxes make up each line in a new shade of blue or green. Cotton/Poly/Spandex Blend. Hand wash inside out, dry flat. SIZE 12 AND 14 ONLY LEFT. ^||,|$43.50$|,||,|HANNAH-BANANA-TWEEN-CHEVRON-MAXI-DRESS|,|$URL$hannah-banana-tween-chevron-maxi-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-tween-chevron-maxi-dress-1.jpg||-||Hannah Banana Tween Color Block Belted Dress|,|^|Your tween will have a one of a kind look in this dress from Hannah Banana. No two of these will look alike due to the variations in the way the cloth is cut. Stripes of varying widths in red, white and blue adorn the sleeveless bodice and paneled skirt. A faux leather belt sits at the waist. Dress is lined and features a full zipper at the back. 100% polyester. Hand wash, hang dry. SIZE 10 ONLY AVAILABLE.  ^||,|$39.00$|,||,|HANNAH-BANANA-TWEEN-COLOR-BLOCK-BELTED-DRESS|,|$URL$hannah-banana-tween-color-block-belted-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-tween-color-block-belted-dress-15.jpg||-||Hannah Banana Tween Dark Rhinestone Trim Jeans|,|^|Just for tweens, these dark wash denim jeans are from designer Hannah Banana. The front of the jeans and the back pockets are embellished with rhinestones for a stylish look. They are made of a cotton blend. Hand wash, line dry. SIZE 10 AND 12 AVAILABLE  ^||,|$19.00$|,||,|HANNAH-BANANA-TWEEN-DARK-RHINESTONE-TRIM-JEANS|,|$URL$hannah-banana-tween-dark-rhinestone-trim-jeans.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-tween-dark-rhinestone-trim-jeans-15.jpg||-||Hannah Banana Tween Double Cardigan|,|Unique in style, this new double cardigan from designer Hannah Banana will fill any tween girl with delight. The black sweater is covered with black sequins and features large buttons to close up the front. Two front pockets finish the look while the inner layer is attached and features buttons that run down the front. Made with cotton and polyester, hand wash only. |,|$29.00$|,||,|HANNAH-BANANA-TWEEN-DOUBLE-CARDIGAN-COWL-NECK|,|$URL$hannah-banana-tween-double-cardigan-cowl-neck.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-tween-double-cardigan-with-cowl-neck-11.jpg||-||Hannah Banana Tween Faux Pleather Jacket|,|^|In a shorter cut, this stylish new pleather jacket has just arrived from designer Hannah Banana. The long sleeves features single button cuffs and a standing collar. The shape and texture found on the front is created from tucks. A zipper running up the front and a button on the collar block out the wind perfectly. Made with polyurathane blend. Dry clean for best result. (1) 7 ONLY LEFT.  ^||,|$58.80$|,||,|HANNAH-BANANA-TWEEN-FAUX-LEATHER-JACKET|,|$URL$hannah-banana-tween-faux-leather-jacket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-tween-faux-pleather-jacket-2.jpg||-||Hannah Banana Tween Girls Fall Jacket|,|Adding warmth to her wardrobe, this new tween jacket was created by Hannah Banana. The piece offers long sleeves with a contrasting roll cuff. The same fabric is found upon the front and adorning the pockets. A ribbed knit lines beneath the large buttons and around the cozy hood. Polyester/Cotton. Hand wash inside out in cold water. Hang to dry. |,|$86.00$|,||,|HANNAH-BANANA-TWEEN-GIRLS-FALL-JACKET|,|$URL$hannah-banana-tween-girls-fall-jacket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-tween-girls-fall-jacket-42.jpg||-||Hannah Banana Tween Girls Top with Beading|,|Beginning with a subtly twisted neckline, this new tween top from designer Hannah Banana is a true gem for the coming cool months. The black top features long dolman styled sleeves right on trend while shimmering studs and beads create a radiating design on her right shoulder. Stretch rayon blend, hand wash and hang to dry. |,|$19.00$|,||,|HANNAH-BANANA-TWEEN-GIRLS-BATWING-TOP-BEADING|,|$URL$hannah-banana-tween-girls-batwing-top-beading.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-tween-girls-batwing-top-with-beading-14.jpg||-||Hannah Banana Tween Hi Low Dress in Berry|,|By fabulous Hannah Banana, this new girls dress is a trendy arrival from their fall and winter line. The dress features a square yoke that is finished with a scallop edge and boasts of a trio of buttons that are found in the center. The tiny flower print covers the fabric while accented with a bell cuff on both sleeves. The hi-low hemline is a cute finish to the skirt. This dress is a perfect piece for every day wear! 100% Polyester. Hand Wash in Cold Water. Lay Flat to Dry. |,|$78.00$|,||,|HANNAH-BANANA-TWEEN-HI-LOW-DRESS-BERRY|,|$URL$hannah-banana-tween-hi-low-dress-berry.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-tween-hi-low-dress-in-berry-10.jpg||-||Hannah Banana Tween Tunic with Lace|,|This new tween top from Hannah Banana is sure to be a part of many creative and stylish outfits during this spring and summer. The top features short, rolled sleeves, and a raw edge neckline. Gem appliques add a touch of sparkle just beneath the neck. The hemline of the tunic is made with a wide ruffle draped in ivory and accented with a crochet ribbon. Made with polyester blend. Hand wash cold, lay flat to dry. |,|$42.00$|,||,|HANNAH-BANANA-TWEEN-TUNIC-LACE|,|$URL$hannah-banana-tween-tunic-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-tween-tunic-with-lace-1.jpg||-||Hannah Banana Tween Tutu Dress with Vintage Phone|,|^|Sure to be one of the hot new items for this season, this new tween dress was designed by the fashionable Hannah Banana. The cap sleeve bodice offers a tee shirt look with the blouson affect at the waist. The waist is fitted and covered with a swirling design leading into the dreaming skirt made with layers of black tulle printed with white flowers. A large vintage telephone graphic sits on the bodice and is embellished by a touch of sparkling accents. Made with a polyblend. Dry clean only. SIZE 10 AND 14 ONLY LEFT.  ^||,|$57.00$|,||,|HANNAH-BANANA-TWEEN-TUTU-DRESS-VINTAGE-PHONE|,|$URL$hannah-banana-tween-tutu-dress-vintage-phone.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hannah-banana-tween-tutu-dress-with-vintage-phone-2.jpg||-||Haute Baby Amys Garden Hair Clip|,|Made to match her Amy's Garden clothing by Haute Baby. A pink crocheted flower is accented with faux gems with a touch of bling. |,|$4.00$|,||,|HAUTE-BABY-AMY-S-GARDEN-HAIR-CLIP|,|$URL$haute-baby-amy-s-garden-hair-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-amys-garden-hair-clip-9.jpg||-||Haute Baby April Bloom Fancy Take Home Gown|,|A lavish infant take home gown, this fancy creation comes from infant designer Haute Baby. The light pink bodice is covered with a sequin polka dot print. Cute cap sleeves frame the neckline while the back fastens closed. The empire waistline is bedecked by a large orange bow who's center boasts of a large flower. The skirt of this gown is layered with dreamy pink tulle. Look for the matching headband to complete the outfit! Polyester. Dry clean only. Made in the USA. |,|$39.00$|,||,|HAUTE-BABY-APRIL-BLOOM-FANCY-TAKE-HOME-GOWN|,|$URL$haute-baby-april-bloom-fancy-take-home-gown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-april-bloom-fancy-take-home-gown-1.jpg||-||Haute Baby April Bloom Girls Headband|,|^|From designer Haute Baby, this headband will go with so many of her little pink outfits. The stretch band has a comfortable fit around her head. Off centered to one side is a sumptuous floral arrangement placed upon sequin adorned leaves. This hair accessory was designed specifically to go with the lavish dresses found in their ""April Bloom"" collection. ^||,|$14.25$|,||,|HAUTE-BABY-APRIL-BLOOM-GIRLS-HEADBAND|,|$URL$haute-baby-april-bloom-girls-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-april-bloom-girls-headband-1.jpg||-||Haute Baby April Bloom Infant and Toddler Dress|,|Perfect for any special occasion this spring, this new elegant girls dress comes from Haute Baby. The fitted bodice is cut with sleeveless neckline. The fabric is covered with a pink sequin polka dot pattern. The sequins catch the glimmer of the light every where she goes. The orange waist is high and ties in the back. The center front is adorned by an over sized flower. Beneath the flower we find sequin accented leaves. The light pink tulle layers with a great shape. Polyester. Dry clean only. Made in the USA. |,|$49.00$|,||,|HAUTE-BABY-APRIL-BLOOM-INFANT-TODDLER-DRESS|,|$URL$haute-baby-april-bloom-infant-toddler-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-april-bloom-infant-and-toddler-dress-1.jpg||-||Haute Baby Butterfly Blanket Flitter Flutter|,|Standing apart from the traditional pink that covers many baby girls blankets, this new accessory comes from Haute Baby. The white blanket is covered with blue patterns with small touches of yellow. The reversible blanket is simply flip flopped from one side to the other, both blending a fluttering butterfly print with a zany chevron stripe. The ruffle that trims the edge adds the perfect touch of femininity. |,|$36.75$|,||,|HAUTE-BABY-BUTTERFLY-BLANKET-FLITTER-FLUTTER|,|$URL$haute-baby-butterfly-blanket-flitter-flutter.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-butterfly-blanket-flitter-flutter-1.jpg||-||Haute Baby Charlotte Rose Infant Hat|,|^|Filled with sweet love, this new baby girls hat is a perfect match to the darling new Charlotte Rose romper from Haute Baby. The white hat boasts of a sweet floral print that is complimented with coordinated polka dots. The roll brim of the hat offers quaint accents and a single satin bow with a rhinestone heart center. Whether she is going home for the first time or just visiting with family, she will look darling as can be! 100% cotton. Hand wash cold, lay flat to dry. Made in the USA. SIZE 6-9 MONTH LEFT.  ^||,|$14.25$|,||,|HAUTE-BABY-CHARLOTTE-ROSE-INFANT-HAT|,|$URL$haute-baby-charlotte-rose-infant-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-charlotte-rose-infant-hat-1.jpg||-||Haute Baby Charlotte Rose Red Polka Dot Romper|,|^|New from Haute Baby, this infant romper is absolutely adorable! The empire bodice is spotted with polka dots while the short sleeves have elastic cuffs that make them poof out. The white trimmed waist is completed with a satin bow that has a gem center. The bubble legs of the romper changes to a coordinating floral print down to the polka dot ruffle hem. Easy changing snaps are found on the inseam and the cotton fabric is comfortable on her delicate new skin. 100% cotton. Hand wash cold, lay flat to dry. Made in the USA. SIZE 3-6 MOS ONLY LEFT.  ^||,|$39.00$|,||,|HAUTE-BABY-CHARLOTTE-ROSE-RED-POLKA-DOT-ROMPER|,|$URL$haute-baby-charlotte-rose-red-polka-dot-romper.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-charlotte-rose-red-polka-dot-romper-1.jpg||-||Haute Baby Chic Baby Blanket Dusty Pink|,|A beautiful blanket, this new arrival comes from Haute Baby and is sure to create timeless memories. The ivory blanket is covered with a tulle overlay. This overlay is dressed with a textured, trellis pattern accented with chiffon roses. The edge of the blanket is rapped with a soft champagne velvet ruffle. This gorgeous design matches several new garments also available in the fall and winter collection. Cotton/Polyester Blend. Hand Wash in Cold Water. Hang to Dry. Measures 31 inches wide long 31 inches long. |,|$54.00$|,||,|HAUTE-BABY-CHIC-BABY-BLANKET-DUSTED-PINK|,|$URL$haute-baby-chic-baby-blanket-dusted-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-chic-baby-blanket-dusty-pink-preorder-6.jpg||-||Haute Baby Chic Baby Outfit Swan Lake PREORDER|,|^|This sweet outfit has just arrived from the ""Swan Lake"" collection created by Haute Baby. The top features an empire bodice and long sleeves finished with a ruffle cuff. The unique texture of the fabric is a cute touch while the waist is dressed in boa feathers and a large bow. The pieces of sheer fabric that cover the skirt dance with her movement. Matching leggings are worn beneath with a sweet feather hemline. Please note that this Haute Baby item is a PreOrder and is NOT currently in stock. We expect this item to arrive by the end of September 2014. For further information please view our PreOrder page. ^||,|$78.00$|,||,|HAUTE-BABY-CHIC-BABY-OUTFIT-SWAN-LAKE|,|$URL$haute-baby-chic-baby-outfit-swan-lake.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-chic-baby-outfit-swan-lake-preorder-1.jpg||-||Haute Baby Child Feather Headband Snow PREORDER|,|^|This hair accessory from Haute Baby is made to match a few new arrivals from their fall and winter collections. The stretch headband allows for a comfortable fit and hugs to her head. Ribbon and boa feathers create a beautiful design upon which we find the wrapped rosette. Wear the decorations off to one side of her head for a truly darling look! Please note that this Haute Baby item is a PreOrder and is NOT currently in stock. We expect this item to arrive by the end of September 2014. For further information please view our PreOrder page. ^||,|$26.00$|,||,|HAUTE-BABY-CHILD-FEATHER-HEADBAND-SNOW|,|$URL$haute-baby-child-feather-headband-snow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-child-feather-headband-snow-preorder-1.jpg||-||Haute Baby Elegant Baby Girls Gown Ivory and Pink - Exclusive|,|^|A special creation from designer Haute Baby, this new infant gown is a part of their ""Creme de la Creme"" collection. The gown boasts of its warm ivory shade and soft, luxurious lining. The neckline is ruffled with the sheer mesh dot that creates the long sleeves and ruffle cuffs. This same soft tulle overlays the entire gown with a sweet frosting ruffle at the hem. The empire waist is defined by the rose pink velvet and a large pink bow. The center of this bow is decorated with a square of pearl beads. A single button keyhole styles the back. Looking for a perfect baby gift? Several matching accessories can also be found from the ""Creme de la Creme"" collection while quantities last. Made in the USA, this gown is 100% polyester. Delicately hand wash and lay flat to dry. ^||,|$54.00$|,||,|HAUTE-BABY-ELEGANT-BABY-GIRLS-GOWN-IVORY-PINK|,|$URL$haute-baby-elegant-baby-girls-gown-ivory-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-elegant-baby-girls-gown-ivory-and-pink-1.jpg||-||Haute Baby Elegant Baby Outfit Dusty Pink|,|Designed in elegance from Haute Baby, this new girls outfit will look fabulous in photographs. The tunic top features a wrap neckline that is accented with a velvet ruffle. The sheer tulle overlay creates long sleeves while covered with a fun trellis texture and fabric flowers. A touch of pink ribbon creates a bow while matching ruffles are found on the hemline. The leggings are a solid ivory finished in a double bell hem. Cotton/Polyester Blend. Hand Wash in Cold Water. Hang to Dry. |,|$68.00$|,||,|HAUTE-BABY-ELEGANT-BABY-OUTFIT-DUSTED-PINK|,|$URL$haute-baby-elegant-baby-outfit-dusted-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-elegant-baby-outfit-dusty-pink-preorder-6.jpg||-||Haute Baby Elegant Christmas Dress for Girls PREORDER|,|^|From Haute Baby, this elegant girls dress is a beautiful holiday selection. The sleeveless neckline is trimmed in tulle ruffles. A flower texture complete with sequin accents covers the bodice completely. The wide sash upon the waist is tied on her back into a bow. A hidden zipper runs up the back and secures the fit. The skirt is covered with a sheer overlay. Please note that this Haute Baby item is a PreOrder and is NOT currently in stock. We expect this item to arrive by the end of September 2014. For further information please view our PreOrder page. ^||,|$86.00$|,||,|HAUTE-BABY-ELEGANT-CHRISTMAS-DRESS-GIRLS|,|$URL$haute-baby-elegant-christmas-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-elegant-christmas-dress-for-girls-preorder-1.jpg||-||Haute Baby Elegant Headband for Little Girls|,|^|From Haute Baby, this girls headband is created to compliment the dresses and outfits from their ""Ivory Roses"" collection. The headband is a soft, champagne velvet that stretches for a comfy fit. Off to one side of her head we find a vintage inspired adornment. The garden of fabric flowers are in soft, elegant tones and are placed around a pearl center. A touch of tulle brings the look home! ^||,|$26.00$|,||,|HAUTE-BABY-ELEGANT-HEADBAND-LITTLE-GIRLS|,|$URL$haute-baby-elegant-headband-little-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-elegant-headband-for-little-girls-preorder-6.jpg||-||Haute Baby Fancy Baby Dress April Bloom|,|^|Part of the ""April Blooms"" spring and summer collection by designer Haute Baby, this new infant dress is perfect for any up coming occasion. The empire waist features an oversized, structured orange bow with a large pink flower placed in the center. Just beneath the flower is a hint of sparkle in the sequin leaves. The bodice is covered with sequin polka dots and has cap sleeves. The matching skirt is finished with an over layer of tulle that adds an elegant finish. Polyester. Dry clean only. Made in the USA. ^||,|$49.50$|,||,|HAUTE-BABY-FANCY-BABY-DRESS-APRIL-BLOOM|,|$URL$haute-baby-fancy-baby-dress-april-bloom.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-fancy-baby-dress-april-bloom-1.jpg||-||Haute Baby Fancy Girls Dress Rosette Flutter|,|Helping to create an enchanting experience, this elegant new girls dress from Haute Baby is part of their Ivory Roses collection for fall and winter. The bodice is covered with a rose covered overlay that introduces a unique and lovely texture. The neckline is framed with a flutter cap sleeves. A single button keyhole is found on the back. The drop waist is dressed with a large ribbon bow on the front while the skirt is divided into two tiers. Cotton/Polyester Blend. Hand Wash in Cold Water. Hang to Dry. |,|$74.00$|,||,|HAUTE-BABY-FANCY-GIRLS-DRESS-ROSETTE-FLUTTER|,|$URL$haute-baby-fancy-girls-dress-rosette-flutter.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-fancy-girls-dress-rosette-flutter-preorder-6.jpg||-||Haute Baby Fancy Girls Headband with Rosettes|,|Filled with fabrics that match several new pieces from the Haute Baby collection, this new little girls headband is a sweet accessory to finish the outfit off right. A stretch ivory band fits comfortably around her head. The trio of flowers boast of three fabrics: A pale pink creating the larger of the three, a chocolate brown covered with a white circle print, and an ivory tulle finished with a heart center. |,|$26.00$|,||,|HAUTE-BABY-FANCY-GIRLS-HEADBAND-ROSETTES|,|$URL$haute-baby-fancy-girls-headband-rosettes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-fancy-girls-headband-with-rosettes-20.jpg||-||Haute Baby Fancy Headband for Baby|,| |,|$22.00$|,||,|HAUTE-BABY-FANCY-HEADBAND-BABY|,|$URL$haute-baby-fancy-headband-baby.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-fancy-headband-for-baby-1.jpg||-||Haute Baby Feathered Infant Hat PREORDER|,|^|The perfect match to the ""Haute Baby Frilly Baby Gown Snow White,"" this baby girls accessory is a must have to complete the gift! The hate is covered with a sweet small dot texture. The fabric allows stretch in its comfortable fit. A large flower is set upon the hat and looks darling just off to one side of her head. The center of the bloom is a large gem with dancing boa feather accents. Please note that this Haute Baby item is a PreOrder and is NOT currently in stock. We expect this item to arrive by the end of September 2014. For further information please view our PreOrder page. ^||,|$22.00$|,||,|HAUTE-BABY-FEATHERED-INFANT-HAT|,|$URL$haute-baby-feathered-infant-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-feathered-infant-hat-preorder-1.jpg||-||Haute Baby Frilly Baby Gown Snow White PREORDER|,|^|A take home gown designed for a princess, this new Haute Baby design is the perfect newborn gift! The empire bodice is covered with a polka dot texture while the sleeves and neckline are trimmed in ribbon. The waist is accented with boa feathers and a sweet ribbon bow. The long skirt to this gown is covered with falling, sheer feathers. The fairy tale look of this piece is beautiful in person and in her first photographs! Please note that this Haute Baby item is a PreOrder and is NOT currently in stock. We expect this item to arrive by the end of September 2014. For further information please view our PreOrder page. ^||,|$66.00$|,||,|HAUTE-BABY-FRILLY-BABY-GOWN-SNOW-WHITE|,|$URL$haute-baby-frilly-baby-gown-snow-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-frilly-baby-gown-snow-white-preorder-1.jpg||-||Haute Baby Frilly Christmas Dress for Toddlers Ruby PREORDER|,|^|Coordinating with her younger sister, this little girls Christmas dress is new from Haute Baby's fall and winter collections. The bodice features a classic neckline framed with ruffle cap sleeves. The front of the bodice is covered with a chiffon and sequin texture that resembles flowers. The velvet ribbon around the waist is tied into a bow off to one side. The skirt opens to a full circle shape and is draped in matching, sheer fabric. Please note that this Haute Baby item is a PreOrder and is NOT currently in stock. We expect this item to arrive by the end of September 2014. For further information please view our PreOrder page. ^||,|$78.00$|,||,|HAUTE-BABY-FRILLY-CHRISTMAS-DRESS-TODDLERS-RUBY|,|$URL$haute-baby-frilly-christmas-dress-toddlers-ruby.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-frilly-christmas-dress-for-toddlers-ruby-preorder-1.jpg||-||Haute Baby Garden Party Girls Dress|,|^|Matching several other new arrivals, this Haute Baby dress for girls is a treasured design for the coming summer season. The bodice is fitted and colored with wide yellow stripes. The green empire waist has a blue onion pattern while tying into a knot or bow on her back. The full circle skirt is layered in blue and white ruffles. The white fabric is covered with an eyelet pattern that introduces a new texture into the dress. Be sure to check out all of the pieces from the ""Garden Party"" collection if you are interested in creating a sister pair. ^||,|$59.00$|,||,|HAUTE-BABY-GARDEN-PARTY-GIRLS-DRESS|,|$URL$haute-baby-garden-party-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-garden-party-girls-dress-1.jpg||-||Haute Baby Girls Couture Skirt Set with Rosettes|,|A sophisticated style she will adore, this new arrival from fabulous Haute baby is sure to be loved. The ivory top is an elegant design that will look fabulous mixed and matched with other bottoms found in her wardrobe. The sheer overlay is covered with a swiss dot pattern and creates the long, sheer sleeves. Ruffles accent not only the hemline and cuffs but also her neck. A single keyhole button is found upon the back. The matching skirt is a fun circle print covered with a tulle overlay. Large ribbon rosettes spiral to accent the skirt. Cotton/Polyester. Hand wash cold. Hang to dry. |,|$82.00$|,||,|HAUTE-BABY-GIRLS-COUTURE-SKIRT-SET-ROSETTES|,|$URL$haute-baby-girls-couture-skirt-set-rosettes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-girls-couture-skirt-set-with-rosettes-6.jpg||-||Haute Baby Girls Floral Capri Set|,|Made with sugar and spice and a splash of sass, this new designer girls summer outfit comes from Haute Baby. The sleeveless tunic has an empire waist adorned with a thin ruffle and a pink flower. The bodice is covered with a zebra inspired print while the neckline is cut in the classic jewel shape. The skirt of the tunic is a light and bright floral print. The hem draws back to the zebra two tone print as it ruffles around with a small touch of tulle found just beneath. Matching pants are found beneath the tunic and are finished with a ruffle hem. The fabric is soft and comfortable for all day wear. |,|$46.50$|,||,|HAUTE-BABY-GIRLS-FLORAL-CAPRI-SET|,|$URL$haute-baby-girls-floral-capri-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-girls-floral-capri-set-1.jpg||-||Haute Baby Girls Leopard Tutu Dress in Velvet|,|^|This Haute Baby leopard velvet tutu dress is perfect for any fall or winter occasion! Your little girl will look absolutely stunning in the velvet leopard top adorned with ruffles and a flower on the neckline. The cute flower is accented with a simple turquoise gem stone. The elegant flowing skirt is made of layers of turquoise and brown tulle and is fully lined. She will walk into any holiday function looking like a star! Made with 100% polyester in the USA. Hand wash in cold water and lay flat to dry. SIZE 5 ONLY AVAILABLE.  ^||,|$49.00$|,||,|HAUTE-BABY-GIRLS-LEOPARD-TUTU-DRESS-VELVET|,|$URL$haute-baby-girls-leopard-tutu-dress-velvet.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-girls-leopard-tutu-dress-in-velvet-2.jpg||-||Haute Baby Girls Size 4 to 8 Easter Dress April Bloom|,|^|Whether she is attending an Easter celebration or part of a wedding, this pink girls dress is sure to catch the light in her eyes. A hidden zipper runs up the back while the sleeveless neckline has a straight shape. The precious skirt is made with the same things that weave her dreams at night. The light pink resembles a rose while layers of tulle are found just above. The shape of the skirt is sure to make her feel like a princess while going beautifully with her dress shoes. Several matching designs are also found in the ""April Bloom"" collection for spring and summer. Polyester. Dry clean only. Made in the USA. ^||,|$59.00$|,||,|HAUTE-BABY-GIRLS-SIZE-EASTER-DRESS-APRIL-BLOOM|,|$URL$haute-baby-girls-size-easter-dress-april-bloom.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-girls-size-4-to-8-easter-dress-april-bloom-1.jpg||-||Haute Baby Girls Swing Outfit Garden Party|,|A bright new addition the Haute Baby spring and summer line, this fabulous outfit will encourage her imagination. Ruffled cap sleeves characterize the yellow striped bodice While a wide green fabric sash ties around the waist to define its empire height. The skirt of the top is created with three ruffles, the middle one made with a sweet eyelet fabric. The matching pants worn beneath have a double bell ruffle hemline in white eyelet and yellow stripe. |,|$39.00$|,||,|HAUTE-BABY-GIRLS-SWING-OUTFIT-GARDEN-PARTY|,|$URL$haute-baby-girls-swing-outfit-garden-party.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-girls-swing-outfit-garden-party-1.jpg||-||Haute Baby Holiday Dots Headband with Pink Bow|,|^|Part of the ""Creme de la Creme"" collection this new designer baby headband comes from Haute Baby. The headband has a soft stretch for a comfortable and personal fit around her head. The band is a light ivory and is roughly an inch and a half wide. An alligator clip attaches a gorgeous tulle adornment. The ivory tulle is covered in quaint dots while creating the bed for a large pink bow. A square of pearl beads decorate the center. All Haute Baby items are made in the USA. Look for the matching gown, blanket, and hat while quantities last for a truly memorable baby girls gift. ^||,|$22.00$|,||,|HAUTE-BABY-HOLIDAY-DOTS-HEADBAND-PINK-BOW|,|$URL$haute-baby-holiday-dots-headband-pink-bow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-holiday-dots-headband-with-pink-bow-1.jpg||-||Haute Baby Honey Child Little Girls Swing Capri Outfit|,|Part of the Honey Child collection from designer Haute Baby, this new infant and toddler outfit is ready for the warm sunshine! The top is a fun yellow floral print with three tiers of ruffles that wrap around the back. The unique neckline boasts of an adjustable pink strap that ties into a bow on her left shoulder. Matching capris are paired beneath the relaxed fit of the top. The capris finish with a bell ruffle hem. 100% cotton. Machine wash cold, tumble dry low. Made in the USA. |,|$49.50$|,||,|HAUTE-BABY-HONEY-CHILD-LITTLE-GIRLS-SWING-CAPRI-OUTFIT|,|$URL$haute-baby-honey-child-little-girls-swing-capri-outfit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-honey-child-little-girls-swing-capri-outfit-1.jpg||-||Haute Baby Infant Footie Skirt Espresso Baby|,|Ready for tea time, this new infant outfit was created by Haute Baby. The bodice offers long sleeve striped in pale blue. The front is dressed with a large fabric applique creating a saucer and tea cup. A fun skirt falls from her waist in a full circle shape, divided by three fabric patterns. The legs are finished with closed feet and offer changing snaps found on the inseam. 100% Cotton. Machine wash cold inside out. Tumble dry on low. |,|$59.00$|,||,|HAUTE-BABY-INFANT-FOOTIE-SKIRT-ESPRESSO-BABY|,|$URL$haute-baby-infant-footie-skirt-espresso-baby.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-infant-footie-skirt-espresso-baby-preorder-6.jpg||-||Haute Baby Infant Hat Flitter Flutter|,|^|Matching the new infant short set with butterflies, this fabulous Haute Baby infant hat is too cute! The soft fabric is covered with a blue chevron stripe while the roll brim features the large butterfly print. The front of the hat is adorned with a single yellow flower that is worn off centered to one side. Making it easy to complete the outfit, this hat is the perfect piece to wear with her new bloomer shorts. The butterfly print is a fun way to welcome summertime. SIZE 3-6 MOS ONLY LEFT.  ^||,|$14.25$|,||,|HAUTE-BABY-INFANT-HAT-FLITTER-FLUTTER|,|$URL$haute-baby-infant-hat-flitter-flutter.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-infant-hat-flitter-flutter-1.jpg||-||Haute Baby Infant Shorts Set with Butterflies|,|Fluttering her high with style, this Haute Baby outfit is available in infant sizes. The short sleeve top features a chevron print on her sleeves to match the ruffle that runs down, hiding the snaps that close the wrap style. A yellow flower is found off to the right side, matching perfectly to the small peek of yellow tulle. The white cotton is covered with a blue butterfly print. The matching bloomer shorts are paired beneath. The cute bubble shape is irresistible while ruffle is found on both legs. |,|$40.50$|,||,|HAUTE-BABY-INFANT-SHORTS-SET-BUTTERFLIES|,|$URL$haute-baby-infant-shorts-set-butterflies.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-infant-shorts-set-with-butterflies-1.jpg||-||Haute Baby Innocence Headband with Pink Flowers|,|^|Matching all of the new arrivals found in the ""Innocence"" collection by designer Haute Baby, this little girls headband is a must have! The headband is charming with its pink floral decoration that is off set to one side. The headband is made with a checkered stretch material that comfortably fits around her head. ^||,|$14.25$|,||,|HAUTE-BABY-INNOCENCE-HEADBAND-PINK-FLOWERS|,|$URL$haute-baby-innocence-headband-pink-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-innocence-headband-with-pink-flowers-1.jpg||-||Haute Baby Ivory Baby Gown Holiday Dots|,| |,|$54.00$|,||,|HAUTE-BABY-IVORY-BABY-GOWN-HOLIDAY-DOTS|,|$URL$haute-baby-ivory-baby-gown-holiday-dots.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-ivory-baby-gown-holiday-dots-17.jpg||-||Haute Baby Ivory Holiday Hat Holiday Dots|,| |,|$22.00$|,||,|HAUTE-BABY-IVORY-HOLIDAY-HAT-HOLIDAY-DOTS|,|$URL$haute-baby-ivory-holiday-hat-holiday-dots.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-ivory-holiday-hat-holiday-dots-1.jpg||-||Haute Baby Ivory Special Occasion Blanket for Girls|,|^|A timeless baby girls gift that will become a cherished heirloom, this new baby blanket comes from Haute Baby. The vintage inspired blanket is a warm ivory covered with a sheer, soft tulle. The tulle is patterned with polka dots to add a spot of fun. A ruffle runs around the trim of this blanket to complete the darling look. A single corner is dressed with a pink bow, this would be the perfect corner to add a special embroidered message to guarantee that this piece is well loved and held dear. The blanket measures roughly 26"" X 27"". Made in the USA. 100% polyester. Hand wash and lay flat to dry. ^||,|$46.00$|,||,|HATUE-BABY-IVORY-SPECIAL-OCCASION-BLANKET-GIRLS|,|$URL$hatue-baby-ivory-special-occasion-blanket-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-ivory-special-occasion-blanket-for-girls-1.jpg||-||Haute Baby Lazy Dazy Tunic with Capri|,|^|Haute Baby has created this darling new little girls outfit as a part of their ""Lazy Dazy"" collection for summer. The swing top has a relaxed A-line fit. The top boasts of a gathered neckline that is accented with the wide gingham straps that tie into a bow on both shoulders. The large orange flower that sits in the center stands out among the print of yellow flowers. A ruffle finishes off the top in the same fabric. Capri leggings are paired beneath the top and are covered with a yellow and white stripe. The bottoms offer the comfortable elastic waistline and stretch in its fit. ^||,|$46.50$|,||,|HAUTE-BABY-LAZY-DAZY-TUNIC-CAPRI|,|$URL$haute-baby-lazy-dazy-tunic-capri.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-lazy-dazy-tunic-with-capri-1.jpg||-||Haute Baby Leopard Girls Skirt Set|,|Featuring an updated look to a gorgeous vintage inspiration, this new little girls skirt set comes from Haute Baby. The sleeveless top is covered with a scroll and flower print in a wispy white. A scoop yoke is lined with a tulle ruffle and introduces the sweet pink leopard print. Three flower shaped buttons sit in the center upon a ribbon. The top has a more fitted look that is accented by the volume of the skirt. A touch of ruffles and pink tulle overlay make this skirt one that will be loved by all! 100% cotton. Hand wash cold, lay flat to dry. |,|$44.25$|,||,|HAUTE-BABY-LEOPARD-GIRLS-SKIRT-SET|,|$URL$haute-baby-leopard-girls-skirt-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-leopard-girls-skirt-set-1.jpg||-||Haute Baby Little Girls Dress Vintage Twirl|,|A darling creation, this new designer girls dress comes from Haute Baby. The dress has a striped bodice accented with two round buttons. A peter pan collar is trimmed with crochet on the edge. The full circle skirt is layered in different coordinating fabrics. This dress is perfect for just about any errand or day at school! 100% Cotton. Machine wash cold inside out. Tumble dry on low. |,|$69.00$|,||,|HAUTE-BABY-LITTLE-GIRLS-DRESS-VINTAGE-TWIRL|,|$URL$haute-baby-little-girls-dress-vintage-twirl.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-little-girls-dress-vintage-twirl-preorder-6.jpg||-||Haute Baby Little Girls Fancy White Feather Dress PREORDER|,|^|Haute Baby created this gorgeous new dress in their ""Swan Lakes"" collection. The dress has a sleeveless neckline that is framed with a fluttering ruffle of tulle. The bodice is covered with a white sequin flower pattern. The skirt is covered with the fun feather layers that boast of their graceful movement. This dress matches a few other arrivals to make family photos a breeze! Please note that this Haute Baby item is a PreOrder and is NOT currently in stock. We expect this item to arrive by the end of September 2014. For further information please view our PreOrder page. ^||,|$86.00$|,||,|HAUTE-BABY-LITTLE-GIRLS-FANCY-WHITE-FEATHER-DRESS|,|$URL$haute-baby-little-girls-fancy-white-feather-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-little-girls-fancy-white-feather-dress-preorder-1.jpg||-||Haute Baby Little Girls Floral Tunic Set|,|^|Haute Baby has created this adorable little girls outfit as a part of their ""Ruby Rose"" collection. The long sleeve top is a fair shade of grey and is covered with bold pink rose blooms. The hem of the tunic is a sweet pink ruffle introduced by a touch of lace and a single flower sitting upon the left side. Matching pants accompany the tunic and are finished with the same double ruffle on both legs. 100% Cotton. Hand Wash in Cold Water. Lay Flat to Dry. ^||,|$62.00$|,||,|HAUTE-BABY-LITTLE-GIRLS-FLORAL-TUNIC-SET|,|$URL$haute-baby-little-girls-floral-tunic-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-little-girls-floral-tunic-set-preorder-6.jpg||-||Haute Baby Little Girls Jacket in Ivory|,|A soft designer girls jacket, this new arrival is from designer Haute Baby. This designer girls jacket is made with a textured ivory fabric that is covered in a floral pattern. The sleeves are finished with a single ruffle while a peter pan collar runs around the neckline. A large cluster button is found just beneath the button and fastens to close the top. A matching ruffle is found on the hemline. 100% Polyester. Machine wash cold inside out. Dry on low. |,|$49.00$|,||,|HAUTE-BABY-LITTLE-GIRLS-JACKET-IVORY|,|$URL$haute-baby-little-girls-jacket-ivory.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-little-girls-jacket-in-ivory-1.jpg||-||Haute Baby Little Girls Swing Set in Ivory Lace|,|^|As sweet as cake, this new little girls outfit from designer Haute Baby is the perfect outfit for birthdays or afternoon tea with her teddies. The wrap neckline on the bodice boasts of an empire waist adorend by a pink rose and long sleeves to protect her arms from the chilly air. The light blue floral print on the waist ties in a bow in the back and pairs perfectly with the vintage inspired chair print found on the skirt. The wide lace hem offers a scallop finish to the top. Solid grey leggings are paired beneath featuring a triple bell ivory lace hem. Made in the USA. 100% cotton. Hand wash and lay flat to dry. SIZE 0/3 MOS ONLY LEFT.  ^||,|$39.60$|,||,|HAUTE-BABY-LITTLE-GIRLS-SWING-SET-IVORY-LACE|,|$URL$haute-baby-little-girls-swing-set-ivory-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-little-girls-swing-set-in-ivory-lace-34.jpg||-||Haute Baby Little Girls Vintage Headband with Rosettes|,|Haute Baby has created this little girls headband to match several new arrivals from their fall and winter collection. The stretch headband is wrapped with off white and baby blue stripes. Two turned rosettes sit side by side off to one side of her head. One is made with a multi colored pattern while the other is placed upon crochet lace and finished with a real center. |,|$26.00$|,||,|HAUTE-BABY-LITTLE-GIRLS-VINTAGE-HEADBAND-ROSETTES|,|$URL$haute-baby-little-girls-vintage-headband-rosettes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-little-girls-vintage-headband-with-rosettes-preorder-6.jpg||-||Haute Baby Matching Baby Girls Hat Ivory Dots|,|^|A perfect match to the new ""Haute Baby Elegant Baby Girls Gown Ivory and Pink,"" this girls hat is a welcomed part of the ""Creme de la Creme"" collection. The cap is a soft, fitted hat that is filled with warmth and love. The front center of the hat is dressed with a large pink bow completed with a beaded center. The ivory baby hat is covered with a sheer mesh overlay that is patterned with small polka dots. This hat is made in the USA with 100% polyester. Hand wash with care and lay flat to dry. ^||,|$22.00$|,||,|HAUTE-BABY-MATCHING-BABY-GIRLS-HAT-IVORY-DOTS|,|$URL$haute-baby-matching-baby-girls-hat-ivory-dots.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-matching-baby-girls-hat-ivory-dots-13.jpg||-||Haute Baby Mocha Swing Set for Little Girls in Velvet|,|Matching to her sisters' new darling holiday pieces, this infant and toddler outfit from the Purrfect line is filled with classic Haute Baby grace. The swing top features long sleeves and a textured mocha velvet that catches the light and is oh so soft! A sweet bow with a heart gem center is placed upon her empire waist while the skirt is covered with a light coral lace accented with chic swirls of flowers. Matching velvet pants are worn beneath and are finished by a bell ruffle hem. Haute Baby pieces are made in the USA. 100% polyester, hand wash only. Lay flat to dry. |,|$39.00$|,||,|HAUTE-BABY-MOCHA-SWING-SET-LITTLE-GIRLS-VELVET|,|$URL$haute-baby-mocha-swing-set-little-girls-velvet.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-mocha-swing-set-for-little-girls-in-velvet-2.jpg||-||Haute Baby Newborn Blanket Pretty in Pink|,| |,|$46.00$|,||,|HAUTE-BABY-NEWBORN-BLANKET-PRETTY-PINK|,|$URL$haute-baby-newborn-blanket-pretty-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-newborn-blanket-pretty-in-pink-1.jpg||-||Haute Baby Newborn Hat Pretty in Pink|,| |,|$19.00$|,||,|HAUTE-BABY-NEWBORN-HAT-PRETTY-PINK|,|$URL$haute-baby-newborn-hat-pretty-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-newborn-hat-pretty-in-pink-2.jpg||-||Haute Baby Party Tunic for Little Girls with Rosettes|,|A unique style that is simply adorable, this new designer outfit for little girls is sure to be a beautiful choice for any event. The tunic features a chocolate brown skirt that is covered with a circle pattern that is finished with a sheer overlay. Large pink ribbon roses are found upon the skirt and add a touch of pink. The bodice of the tunic has a wide chocolate brown waistline and cute sheer ruffles that dress the neckline and cuffs. Matching pants are worn beneath in the same textured ivory. Cotton/Polyester. Hand wash cold. Hang to dry. |,|$58.00$|,||,|HAUTE-BABY-PARTY-TUNIC-LITTLE-GIRLS-ROSETTES|,|$URL$haute-baby-party-tunic-little-girls-rosettes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-party-tunic-for-little-girls-with-rosettes-6.jpg||-||Haute Baby Pink and Leopard Blanket|,|About 28 inches square, this pink cotton baby girls blanket has a trendy leopard trim on one corner. Made in the USA by Haute Baby, machine washable. |,|$19.00$|,||,|HAUTE-BABY-LEOPARD-BLANKET|,|http://www.labellaflorachildrensboutique.com/haute-baby-leopard-blanket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-pink-and-leopard-blanket-13.jpg||-||Haute Baby Purple Baby Gown and Cap Paisley Fun|,|Created by Haute Baby this paisley gown is a beautiful choice for the new baby girl in your life. The gown offers her long sleeves to help with the chilly air and an elastic hem. The line of snaps that runs down the center is hidden by the ruffle accent and a small touch of flowers. The gown is accompanied by a matching cap that is styled with a folded brim and matching flower accents. 100% Cotton. Hand Wash in Cold Water. Lay Flat to Dry. |,|$67.00$|,||,|HAUTE-BABY-PURPLE-BABY-GOWN-CAP-PAISLEY-FUN|,|$URL$haute-baby-purple-baby-gown-cap-paisley-fun.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-purple-baby-gown-and-cap-paisley-fun-15.jpg||-||Haute Baby Raspberry Party Dress for Little Girls|,|^|No matter what the occasion, this darling dress from Haute Baby will suit her sweet style. The pink bodice offers long sleeves, a polka dot waistline that ties in a cute bow in the back. A large raspberry lace flower sits front and center and is removeable for washing. The layered skirt boasts of its full circle shape, leaving plenty of fabric to dance around her legs. The tiers of patterns blend beautifully! Made in the USA with 100% cotton. Hand wash with care and lay flat to dry. 12 MOS ONLY LEFT.  ^||,|$39.00$|,||,|HAUTE-BABY-RASPBERRY-PARTY-DRESS-LITTLE-GIRLS|,|$URL$haute-baby-raspberry-party-dress-little-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-raspberry-party-dress-for-little-girls-34.jpg||-||Haute Baby Ruby Red Baby Bonnet PREORDER|,|^|Matching the new ruby red holiday gown for baby, this Haute Baby infant bonnet is a perfect accessory. The bonnet is covered with chiffon flowers that shimmer with bold sequin centers. The hem of the hat is created by a ruffle of soft velvet. A small bow accents the hat and finishes the look. Pair this with the matching dress for gorgeous holiday photos! Please note that this Haute Baby item is a PreOrder and is NOT currently in stock. We expect this item to arrive by the end of September 2014. For further information please view our PreOrder page. ^||,|$22.00$|,||,|HAUTE-BABY-RUBY-RED-BABY-BONNET|,|$URL$haute-baby-ruby-red-baby-bonnet.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-ruby-red-baby-bonnet-preorder-1.jpg||-||Haute Baby Ruby Red Headband for Little Girls PREORDER|,|^|A beautiful piece made to match her new holiday dress, this headband for girls was designed by Haute Baby as a part of their red ""Holiday Sparkle"" collection. The headband is a soft stretch fabric that hugs her head comfortably. The flower design is accented with sequins and set upon a bed of tulle. Please note that this Haute Baby item is a PreOrder and is NOT currently in stock. We expect this item to arrive by the end of September 2014. For further information please view our PreOrder page. ^||,|$26.00$|,||,|HAUTE-BABY-RUBY-RED-HEADBAND-LITTLE-GIRLS|,|$URL$haute-baby-ruby-red-headband-little-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-ruby-red-headband-for-little-girls-preorder-1.jpg||-||Haute Baby Ruby Red Holiday Gown for Baby PREORDER|,|^|Looking fabulous during the holiday season, this new red baby girls dress is from Haute Baby. The empire bodice features a textured front accented with sequins. A thin velvet ribbon finishes in a bow at the center of her waist and matching the soft, long sleeves. The skirt is layered with mesh and has an elegant movement. This dress is beautiful on its own and paired with tights and darling holiday flats! Please note that this Haute Baby item is a PreOrder and is NOT currently in stock. We expect this item to arrive by the end of September 2014. For further information please view our PreOrder page. ^||,|$62.00$|,||,|HAUTE-BABY-RUBY-RED-HOLIDAY-GOWN-BABY|,|$URL$haute-baby-ruby-red-holiday-gown-baby.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-ruby-red-holiday-gown-for-baby-preorder-1.jpg||-||Haute Baby Special Occasion Infant Outfit with Pink Rosettes|,|Haute Baby designed this gorgeous little girls outfit as a part of their fall and winter collections. The tunic has an A-line fit and elegant sheer sleeves. The neckline is dressed with a ruffle to match the hemline and a single ribbon bow. A snap closes at the back. The overlay is dressed with a fun texture that is accented with fabric roses. Beneath the tiered hemline we find the solid matching leggings to complete the look. Cotton/Polyester Blend. Hand Wash in Cold Water. Hang to Dry. |,|$69.00$|,||,|HAUTE-BABY-SPECIAL-OCCASION-INFANT-OUTFIT-PINK-ROSETTES|,|$URL$haute-baby-special-occasion-infant-outfit-pink-rosettes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-special-occasion-infant-outfit-with-pink-rosettes-preorder-6.jpg||-||Haute Baby Special Occasion Ivory Baby Blanket|,| |,|$46.00$|,||,|HAUTE-BABY-SPECIAL-OCCASION-IVORY-BABY-BLANKET|,|$URL$haute-baby-special-occasion-ivory-baby-blanket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-special-occasion-ivory-baby-blanket-1.jpg||-||Haute Baby Take Home Gown for Newborn|,| |,|$46.00$|,||,|HAUTE-BABY-TAKE-HOME-GOWN-NEWBORN|,|$URL$haute-baby-take-home-gown-newborn.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-take-home-gown-for-newborn-10.jpg||-||Haute Baby Tunic Set for Little Girls Aqua Stripe|,|Matching her younger sisters outfit, this new little girls tunic set comes from Haute Baby. The tunic offers her a long sleeve bodice in baby blue. The waist is defined with a brown espresso dot sash that ties into a bow on her back. The skirt of the tunic is divided into panels of fabric and features a single scoop pocket. Matching striped pants are worn beneath with a quaint ruffle run around the hemline. 100% Cotton. Machine wash cold inside out. Tumble dry on low. |,|$66.00$|,||,|HAUTE-BABY-TUNIC-SET-LITTLE-GIRLS-AQUA-STRIPE|,|$URL$haute-baby-tunic-set-little-girls-aqua-stripe.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-tunic-set-for-little-girls-aqua-stripe-preorder-6.jpg||-||Haute Baby Va Va Bloom Girls Infant Bubble|,|^|New from fabulous designer Haute Baby, this new baby girls romper is simply adorable. The piece features a bubble shape that is accented with the elastic hem on both legs. The empire bodice is covered with a two-tone pink animal print and a few easy snaps that fasten in the back. The cap sleeves are made with quaint ruffles. A ribbon trim defines the waistline and a fake flower is off centered to the left. The light blue background of the pants are covered with a large floral print. Both legs are finished with an animal print ruffle. Be sure to look for the matching capri set to create a sister pair! SIZE 3-6 MOS ONLY LEFT. ^||,|$40.50$|,||,|HAUTE-BABY-VA-VA-BLOOM-GIRLS-INFANT-BUBBLE|,|$URL$haute-baby-va-va-bloom-girls-infant-bubble.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-va-va-bloom-girls-infant-bubble-1.jpg||-||Haute Baby Va Va Bloom Little Girls Swing Set|,|^|Created to match her little sister's new Haute Baby outfit, this darling swing set is filled with sweet southern inspiration. The large floral print blooms among the green leaves and is the perfect choice to pop out from the light blue back ground. The empire waist has a V neckline that is created by a wrap style while the two tone pink zebra print accents her waist and ties into a bow on her back. A single flower sits off center. The waist is skirted by a light pink ruffle. Pink Zebra leggings are worn beneath to finish off this look. Haute Baby designs their infant wear with comfortable 100% cotton. The flower pin is removable, hand wash and lay flat to dry. Made in the USA. ONLY 12 MONTH LEFT.  ^||,|$37.20$|,||,|HATUE-BABY-VA-VA-BLOOM-LITTLE-GIRLS-SWING-SET|,|$URL$hatue-baby-va-va-bloom-little-girls-swing-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-va-va-bloom-little-girls-swing-set-3.jpg||-||Haute Baby Vintage Little Girls Dress|,|^|Matching to another new arrival from designer Haute Baby, this darling dress is sure to add charm to any occasion. The light tan bodice is covered in large white polka dots and offers her long sleeves for the cooler months. The ivory lace found on her waist has a scalloped finish and is completed by a rose pink flower. The full circle skirt is perfect for twirling and blends a vintage inspired chair print with the blooming blue floral for an unforgettable look! Made in the USA. 100% cotton. Hand wash for best results and lay flat to dry. SIZE 12 MOS ONLY LEFT.  ^||,|$39.00$|,||,|HAUTE-BABY-VINTAGE-INSPIRED-LITTLE-GIRLS-DRESS|,|$URL$haute-baby-vintage-inspired-little-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-vintage-inspired-little-girls-dress-27.jpg||-||Haute Baby White Eyelet Baby Blanket Innocence|,|^|Graceful yet grand, this fabulous girls baby blanket was designed by Haute Baby as a part of their ""Innocence"" collection. The blanket is all white and filled with frill. A white eyelet fabric overlays the piece while a matching scallop ruffle races around the edge. A single corner is wrapped with three large pink flowers. The flowers are created with a light fabric. ^||,|$62.00$|,||,|HAUTE-BABY-WHITE-EYELET-BABY-BLANKET-INNOCENCE|,|$URL$haute-baby-white-eyelet-baby-blanket-innocence.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-white-eyelet-baby-blanket-innocence-1.jpg||-||Haute Baby White Eyelet Girls Bloomer Set|,|^|A sweet and pleasing design, this fabulous new little girls outfit comes from Haute Baby in their ""Innocence"" collection for summer. The top boasts of a neckline that gathers from the tie that is threaded through the front and the back to create the shoulder straps. This strap ties into a bow on one of her shoulders. The top is covered with the darling white eyelet while a touch of scallop edging runs around the bottom. A few light pink flowers are also added as beloved decorations. The bloomers paired beneath are a light pink cotton. The stretch waist is comfortable while the ruffle hem on both legs is created by a touch of elastic. ^||,|$51.00$|,||,|HAUTE-BABY-WHITE-EYELET-GIRLS-BLOOMER-SET|,|$URL$haute-baby-white-eyelet-girls-bloomer-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-white-eyelet-girls-bloomer-set-1.jpg||-||Haute Baby White Eyelet Girls Dress Innocence|,|Newly created by Haute Baby, this designer girls dress is ready for summer! The lovely piece is filled with impeccable style that stands out amongst the crowd. Scallop trim creates the cap sleeves while A row of flowers hide the neckline. The dress has a straight, A-line shape that is subtly elegant. The white overlay is covered with an eyelet pattern and finished with a matching scallop hem. Just beneath we find a touch of light pink. |,|$48.00$|,||,|HAUTE-BABY-WHITE-EYELET-GIRLS-DRESS-INNOCENCE|,|$URL$haute-baby-white-eyelet-girls-dress-innocence.html|,|http://ep.yimg.com/ay/yhst-17102259411242/haute-baby-white-eyelet-girls-dress-innocence-1.jpg||-||Hudson Jeans Black Knit Pants for Tweens with Sequins|,|A dazzling new design by Hudson Jeans for kids, these fabulous tween pants are perfect for her next recital or special occasion. The black knit pants offer a truly comfortable fit and two button-flap back pockets. Belt loops are provided on her waist while a button and zipper fly secures her fit. The front is covered with a black tulle overlay that is dressed with small black sequins which catch every ray of light. Contrary to appearance, the front does not have pockets. The legs are cut for a straight or skinny fit. This fabric blends polyester, rayon, and spandex; allowing a slight stretch. Machine washable. Tumble dry. |,|$34.50$|,||,|HUDSON-JEANS-BLACK-KNIT-PANTS-TWEENS-SEQUINS|,|$URL$hudson-jeans-black-knit-pants-tweens-sequins.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hudson-jeans-black-knit-pants-for-tweens-with-sequins-1.jpg||-||Hudson Jeans Blue Jean Skinnies for Tweens|,|The perfect shade of dye to fit any occasion, these new tween jeans come from the designer brand Hudson. The medium dark wash can be dressed up or down while distressed tears, fading, and whiskering give great depth to the color. The zipper fly is closed with a single button. The back boasts of classic button flap pockets. Creating comfort with the stretch cotton blend, machine wash and lay flat to dry. |,|$29.50$|,||,|HUDSON-JEANS-BLUE-JEAN-SKINNIES-TWEENS|,|$URL$hudson-jeans-blue-jean-skinnies-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hudson-jeans-blue-jean-skinnies-for-tweens-2.jpg||-||Hudson Jeans Dark Skinny Jeans for Tweens|,|Designed by Hudson Jeans for kids, this new arrival is sure to become a common piece in many of her favorite outfits. The rich dark wash of the jean makes it easy to dress up while the slight stretch in fit adds greatly to her comfort all day long. These pants offer the classic 5 pockets, two with button flaps on the back. The skinny cut is not only trendy but also compliments her legs. Faint fading and whiskering gives a great worn look. Pair these tween jeans with her tunics, tops, sweaters, and so much more! The cotton and elastane blend is machine washable, tumble dry. |,|$24.50$|,||,|HUDSON-JEANS-DARK-SKINNY-JEANS-TWEENS|,|$URL$hudson-jeans-dark-skinny-jeans-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hudson-jeans-dark-skinny-jeans-for-tweens-1.jpg||-||Hudson Jeans Dark Wash Skinny Jeans for Tweens|,|Designed to keep her comfortable while trendy, great care and love is stitched into these fabulous Hudson jeans. The rich dark wash gives a casual dressy feel while the slim fit hugs her legs with a soft stretch cotton blend. Classic fading and slight whiskering helps define the shade of the wash while button flap pockets are found on the back. Machine wash these jeans with like colors and lay flat to dry. |,|$24.50$|,||,|HUDSON-JEANS-DARK-WASH-SKINNY-JEANS-TWEENS|,|$URL$hudson-jeans-dark-wash-skinny-jeans-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hudson-jeans-dark-wash-skinny-jeans-for-tweens-2.jpg||-||Hudson Jeans Girls Blue Shorts in Province|,|From Hudson Jeans for Kids, these new tween shorts are sure to accompany her on many summer days. The dark blue shorts are accented with a light blue stripe on the outer side of both legs. The waist matches these stripes and offers classic belt loops. A single metal button and zipper fly secure the fit. Both legs are finished with a straight hem and five pockets are offered. Made with cotton blend. Machine wash cold, tumble dry medium. |,|$16.00$|,||,|HUDSON-JEANS-GIRLS-BLUE-SHORTS-PROVINCE|,|$URL$hudson-jeans-girls-blue-shorts-province.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hudson-jeans-girls-blue-shorts-in-province-1.jpg||-||Hudson Jeans Grey Skinny Jean with Black Contrast|,|Unique from all other jeans, these Hudson tween jeans show off her great style. The grey pant boasts of its skinny cut that flatters her shape. The added black contrast on the knees is continued on the inside of both legs down to the hem. A black insert wraps almost completely around her waist. Her front pockets are accented with small zippered pockets that are layered beneath. Cotton-elastane blend. Machine wash, tumble dry if necessary. Recommended: Avoid the dryer and lay flat to dry in order to protect the color longer. |,|$39.50$|,||,|HUDSON-JEANS-GREY-SKINNY-JEAN-BLACK-CONTRAST|,|$URL$hudson-jeans-grey-skinny-jean-black-contrast.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hudson-jeans-grey-skinny-jean-with-black-contrast-2.jpg||-||Hudson Jeans Studded Red Skinny Jeans for Girls|,|A bright splash of color, these new tween skinny jeans come from designer Hudson. The true red stands out during the fall and winter months and will create a beautiful contrast with many colors. The pant has a slim fit from waist to ankle and boasts of square silver studs that wrap around her waist and down the side of both legs. Buttons secure the back pocket flaps. Created with a stretch cotton. Machine wash with like colors, air dry flat. |,|$39.50$|,||,|HUDSON-JEANS-STUDDED-RED-SKINNY-JEANS-GIRLS|,|$URL$hudson-jeans-studded-red-skinny-jeans-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hudson-jeans-studded-red-skinny-jeans-for-girls-2.jpg||-||Hudson Jeans Trendy Skinny Tween Jeans|,|Sure to become one of the most used pieces in her closet, these staple jeans come from Hudson for girls. The trendy pant offers a great slim fit in a gorgeous dye. Slight distressing is found with the three rips on the front along with fading and whiskering. These skinnies offer five pockets to hold her most precious treasures. A light stretch adds to the comfort of the fit. Created with a cotton stretch blend, machine washable. Do not tumble dry, but instead lay flat. |,|$29.50$|,||,|HUDSON-JEANS-TRENDY-SKINNY-TWEEN-JEANS|,|$URL$hudson-jeans-trendy-skinny-tween-jeans.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hudson-jeans-trendy-skinny-tween-jeans-2.jpg||-||Hudson Jeans Turquoise Tween Skinny Jeans|,|New from designer Hudson, these tween skinny jeans will be envied by all of her peers. The turquoise pant boasts of a two tone wash that gives off the impression of camo. The slim silhouette is created by the fitted cut that hugs her legs from waist to ankle. The pant boasts of five pockets and a button zipper fly. The stretch cotton fabric is light and comfortable. Machine wash with like colors, avoid the dryer and lay flat to dry. |,|$34.50$|,||,|HUDSON-JEANS-TURQUOISE-TWEEN-SKINNY-JEANS|,|$URL$hudson-jeans-turquoise-tween-skinny-jeans.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hudson-jeans-turquoise-tween-skinny-jeans-2.jpg||-||Hudson Jeans Tween Girls Denim Jacket|,|A great layering piece for any closet, this new tween jacket was designed by Hudson Jeans. The medium, blue stone wash is filled with authenticity while textured with light fading and patches of distressed ripping. Classic metal buttons run up the front and two button flap pockets complete the style. The traditional tucks in the fabric give this jacket structure and long sleeves add warmth. Her cuffs have a single button. Slight stretch is found in the fit due to the cotton and elastane blend fabric. Machine wash and tumble dry |,|$37.00$|,||,|HUDSON-JEANS-TWEEN-GIRLS-DENIM-JACKET|,|$URL$hudson-jeans-tween-girls-denim-jacket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hudson-jeans-tween-girls-denim-jacket-1.jpg||-||Hudson Jeans Tween Skinny Jean in Grey and Black|,|A classic fit with a subtle twist, these new tween jeans were designed by the fabulous Hudson brand. The grey jeans boast of a slim fit and a light stretch cotton blend that provides an all day comfort. The grey is textured with a darker camo print. The jeans offer five pockets, a button zipper fly, and traditional belt loops. Cotton elastane blend. Machine wash and lay flat to air dry. |,|$34.50$|,||,|HUDSON-JEANS-TWEEN-SKINNY-JEANS-GREY-BLACK|,|$URL$hudson-jeans-tween-skinny-jeans-grey-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hudson-jeans-tween-skinny-jean-in-grey-and-black-2.jpg||-||Hudson Jeans Tween Skinny Jeans with Studs|,|A fabulous new arrival from Hudson Jeans for kids, these tween pants are filled with fun and wonder. The unique wash is a darker blue accented with fading, whiskering, and distressed fraying. The front of these fabulous pants are sprinkled with small silver studs giving a completely unique feel. The skinny leg is right on trend while faux front pockets stay true to your classic blue jean look. Her back pockets are dressed with a single button flap. Created with a stretch cotton blend; machine wash and tumble dry. |,|$29.50$|,||,|HUDSON-JEANS-TWEEN-SKINNY-JEANS-STUDS|,|$URL$hudson-jeans-tween-skinny-jeans-studs.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hudson-jeans-tween-skinny-jeans-with-studs-1.jpg||-||Hudson Jeans Tween Skinny Pant in Black Knit|,|Offering a comfortable way to dress up her favorite tops, these new tween pants come from the designer Hudson. The black knit fabric hugs her legs with the slight stretch in its fit. Cut in a slim shape from waist down to her ankle, these pants are trendy and easy to wear at any occasion. A zipper button fly closes the front while the pant boasts of five pockets. Fabric is a polyester-rayon blend with 5% spandex. Machine wash with like colors, tumble dry if necessary. Recommended: lay flat to dry to preserve color longer. |,|$22.00$|,||,|HUDSON-JEANS-TWEEN-SKINNY-PANT-BLACK-KNIT|,|$URL$hudson-jeans-tween-skinny-pant-black-knit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hudson-jeans-tween-skinny-pant-in-black-knit-2.jpg||-||Hudson Jeans Yellow Shorts for Tweens|,|A bright summer piece, this new creation from Hudson Jeans is available in tween sizes. The yellow shorts boasts of a classic fit while three pockets are found on the front and two on the back. The waist is white to match the stripe found on the outer side of both legs. A zipper and button secure the fit. This yellow compliments the summer sunshine. Made with cotton blend. Machine wash cold, tumble dry medium. |,|$16.00$|,||,|HUDSON-JEANS-YELLOW-SHORTS-TWEENS|,|$URL$hudson-jeans-yellow-shorts-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/hudson-jeans-yellow-shorts-for-tweens-1.jpg||-||I Love Gorgeous Eliza Girls Dress in Grey and Turquoise|,|^|This girls dress comes across the pond from fabulous London designer I Love Gorgeous. The lace overlay in grey will capture her imagination. The bodice boasts of grey trim and a keyhole opening on the front with two buttons. The ruffled sleeves are fringed in lace. Elastic at the waist is finished with the same grey trim as the neckline. A fringed lace ruffle trims out the hemline. A sassy lace pocket sits on each side of the skirt. The lining is of turquoise and peaks through the lace overlay. Made from nylon/cotton. Hand wash cold, lay flat to dry. SIZE 4/5 ONLY LEFT. ^||,|$69.00$|,||,|I-LOVE-GORGEOUS-ELIZA-GIRLS-DRESS-GREY-TURQUOISE|,|$URL$i-love-gorgeous-eliza-girls-dress-grey-turquoise.html|,|http://ep.yimg.com/ay/yhst-17102259411242/i-love-gorgeous-eliza-girls-dress-in-grey-and-turquoise-15.jpg||-||Isaac Mizrahi Tween Skinnies in Fuchsia Knit|,|^|Designed for your darling daughter, these new pink pants from Isaac Mizrahi will spark hint of confidence in her step. The knit pants stretch for a comfort, fitted look that compliments her trendy tops. The bright fuchsia adds a punch of color that stands out in the fall while a button and zipper closes up the front. Belt loops are also found on the waist. Made with a polyester blend. Machine wash cold, tumble dry low. (1) 16 LEFT. ^||,|$19.00$|,||,|ISAAC-MIZRAHI-TWEEN-SKINNIES-FUCHSIA-KNIT|,|$URL$isaac-mizrahi-tween-skinnies-fuchsia-knit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isaac-mizrahi-tween-skinnies-in-fuchsia-knit-3.jpg||-||Isaac Mizrahi Wild Leopard Tween Skinny Jeans|,|^|A spicy style from Isaac Mizrahi sure to transform any top into a fabulous tween outfit. The skinny jean style pairs perfectly with her favorite shoes while the cut is fitted and classic. A zipper and button close up the front while the light tan is spotted with a fun leopard print. Made with a polyester blend. Machine wash cold, tumble dry low. SIZE 7 AND 12 ONLY LEFT.  ^||,|$19.00$|,||,|ISAAC-MIZRAHI-WILD-LEOPARD-TWEEN-SKINNY-JEANS|,|$URL$isaac-mizrahi-wild-leopard-tween-skinny-jeans.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isaac-mizrahi-wild-leopard-tween-skinny-jeans-2.jpg||-||Isobella & Chloe Black and White Ruffled Capri Set|,|Positively adorable, this new Isobella and Chloe girls outfit is prepared for anything that might be planned this spring and summer. The white bodice of the top has a wide boat neckline that is trimmed with black striped ruffle cap sleeves. A layered bow is found on the right side of her waistline with an accented center. White, stripes, and tulle are layered in ruffles to finish off the top. The fitted black leggings that are found beneath are finished at a capri length with a single ruffle hemline. |,|$29.00$|,||,|ISOBELLA-CHLOE-BLACK-WHITE-RUFFLED-CAPRI-SET|,|$URL$isobella-chloe-black-white-ruffled-capri-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-chloe-black-and-white-ruffled-capri-set-1.jpg||-||Isobella & Chloe Bon Voyage Girls Tulle Dress|,|^|Matching a younger style from the ""Bon Voyage"" collection, this new girls dress is filled with style from Isobella and Chloe. The dress begins with a row of flowers that are layered in tulle and line the neck while the straps are a coordinating light shade. The dress features three groupings of ruffled tiers that blend several shades of pink and purple to create a dreamy effect. The overlay allows the lining to peek through. She is sure to be enchanted by this lovely design! ^||,|$39.00$|,||,|ISOBELLA-CHLOE-BON-VOYAGE-GIRLS-TULLE-DRESS|,|$URL$isobella-chloe-bon-voyage-girls-tulle-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-chloe-bon-voyage-girls-tulle-dress-1.jpg||-||Isobella & Chloe Caribbean Current One Piece Swim Suit|,|^|A mod print, this new girls swimsuit from Isobella and Chloe mimics the free spirit of the waves. The V neckline is complimented with quaint ruffles and an adjustable halter strap. The fabric flower has a darker center. The swirling print draws together blues, lime and yellow. A faux skirt ruffles around the bottom, introduced by twin flowers. Be sure to check out all of the new swimwear by designer Isobella and Chloe, she will love every piece! 4 AND 6X ONLY LEFT. ^||,|$36.00$|,||,|ISOBELLA-CHLOE-CARIBBEAN-CURRENT-ONE-PIECE-SWIM-SUIT|,|$URL$isobella-chloe-caribbean-current-one-piece-swim-suit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-chloe-caribbean-current-one-piece-swim-suit-1.jpg||-||Isobella & Chloe Coral Tankini for Girls|,|^|A bright touch of coral is sure to lighten up her summer! This new girls swimsuit comes from Isobella and Chloe in their ""Sun kissed"" collection. A sheer overlay covers the cute coral fabric with its fresh flower design. The tankini top has two draw strings tie into a bow on the front and a single large flower near the neckline. The ruffled skirt sways with cheer as she swims about. Solid coral bottoms accompany the top and are paired beneath. ^||,|$36.00$|,||,|ISOBELLA-CHLOE-CORAL-TANKINI-GIRLS|,|$URL$isobella-chloe-coral-tankini-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-chloe-coral-tankini-for-girls-11.jpg||-||Isobella & Chloe Cute as a Button Girls Dress|,|Filled with a gorgeous blend of color, this new designer casual dress comes from the one and only Isobella and Chloe. The empire bodice offers her a sleeveless neckline trimmed in stone grey. The center of the bodice is dressed with the same grey ruffled in tiers. The side of the dress introduces a pop of pink in a bright candy and a sweet pale shade. These colors continue into the skirt that opens in fit. The hemline is cut for an uneven look that is partially inspired by the trendy handkerchief design. |,|$34.00$|,||,|ISOBELLA-CHLOE-CUTE-BUTTON-GIRLS-DRESS|,|$URL$isobella-chloe-cute-button-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-chloe-cute-as-a-button-girls-dress-1.jpg||-||Isobella & Chloe Flower Girls Dress in White Ruffles|,|This new white summer dress from designer Isobella and Chloe is perfect for the flower girl has she spreads her petals down the aisle. The neckline is darling and closed in the back. The entire relaxed fit dress is covered with tiny ruffles tiered to the hemline. The ruffles add volume to the dress that cannot be beat! |,|$29.00$|,||,|ISOBELLA-CHLOE-FLOWER-GIRLS-DRESS-WHITE-RUFFLES|,|$URL$isobella-chloe-flower-girls-dress-white-ruffles.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-chloe-flower-girls-dress-in-white-ruffles-1.jpg||-||Isobella & Chloe Girls Polka Dot One Piece Swimsuit|,|^|Refreshing and crisp in color, this cool new one piece swimsuit from Isobella and Chloe is a part of their ""Starfruit"" collection. Small yellow dots cover the rich watermelon pink fabric while a cinched keyhole on the front gives shape to the neckline. The lime bow tied in the center matches the thin straps. The four layers of ruffles alternate in fun colors while two yellow flowers are found just above. ^||,|$36.00$|,||,|ISOBELLA-CHLOE-GIRLS-POLKA-DOT-BIKINI|,|$URL$isobella-chloe-girls-polka-dot-bikini.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-chloe-girls-polka-dot-one-piece-swimsuit-1.jpg||-||Isobella & Chloe Pink Girls Summer Oufit with Lace|,|^|A creation from the ""Macaron"" collection by designer Isobella and Chloe, this new little girls outfit is ready for summer. The tunic offers her a straight, sleeveless neckline. The empire waist is defined by the tiers of ruffles that are layered with subtle lace. A single flower found near the hem matches the trio that sits just beneath her right shoulder. Matching pants are worn beneath. The fabric is soft and comfortable, allowing slight stretch. The hem of both legs is dressed with the same sugary sweet ruffles. 12 MOS AND 24 MOS ONLY REMAINING. ^||,|$29.00$|,||,|ISOBELLA-CHLOE-PINK-GIRLS-SUMMER-OUFIT-LACE|,|$URL$isobella-chloe-pink-girls-summer-oufit-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-chloe-pink-girls-summer-oufit-with-lace-1.jpg||-||Isobella & Chloe Sea Breeze One Piece Swimsuit|,|^|A perfect blend of light colors, this new Isobella and Chloe one piece swimsuit is from Isobella and Chloe. The halter neckline is a ""V"" shape that is complimented beautifully by the angle of the layered ruffles. Petal flowers are placed in the center while a halter strap ties in a knot around her neck. The light tiffany blue shade welcomes the punch of lime green. White draw string bows are found on the hips. ^||,|$36.00$|,||,|ISOBELLA-CHLOE-SEA-BREEZE-ONE-PIECE-SWIMSUIT|,|$URL$isobella-chloe-sea-breeze-one-piece-swimsuit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-chloe-sea-breeze-one-piece-swimsuit-1.jpg||-||Isobella & Chloe Sweet Caroline Girls Raspberry Capri Set|,|In a cool raspberry tie dye, this new girls set comes from the fabulous designer Isobella and Chloe. The empire bodice on the top features wide, smocked straps, and a straight neckline. The flower pattern is a gorgeous addition of texture and complimented by the trio of rosettes that sit off to the left side. The skirt of the top is covered with layers of ruffles that wrap around the sides down the tiered ruffle hemline. Matching pink tie dye pants are worn beneath and finished in the same fun ruffles. Be sure to look for the wonderful matching pieces that are available in older sizes. |,|$29.00$|,||,|ISOBELLA-CHLOE-SWEET-CAROLE-GIRLS-RASPBERRY-CAPRI-SET|,|$URL$isobella-chloe-sweet-carole-girls-raspberry-capri-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-chloe-sweet-caroline-girls-raspberry-capri-set-1.jpg||-||Isobella & Chloe Tidal Wave Girls One Piece Swimsuit|,|^|Matching her younger sister's suit almost to a tee, this ""Tidal Wave"" one piece swimsuit is from Isobella and Chloe. The solid black bottoms are mostly hidden beneath the skirt of cute ruffles that are alternated between black and blue. A flower is found off to the right hip and matches perfectly to the one found near the neck. Gathering in the center of the bodice gives the neckline a slight shape while thin straps keep the suit in place. SIZE 5 ONLY REMAINING.  ^||,|$36.00$|,||,|ISOBELLA-CHLOE-TIDAL-WAVE-GIRLS-ONE-PIECE-SWIMSUIT|,|$URL$isobella-chloe-tidal-wave-girls-one-piece-swimsuit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-chloe-tidal-wave-girls-one-piece-swimsuit-1.jpg||-||Isobella & Chloe Violet Dress Darlene|,|A vibrant violet shade, this new designer girls dress comes from designer Isobella and Chloe. The purple dress is started with a boat neckline that is secured in the back. The sheer ruffles are layered, gaining volume as they reach the hemline. This gorgeous dress is sure to gain many compliments this Easter and summer season! |,|$29.00$|,||,|ISOBELLA-CHLOE-VIOLET-DRESS-DARLENE|,|$URL$isobella-chloe-violet-dress-darlene.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-chloe-violet-dress-darlene-1.jpg||-||Isobella and Chloe Black & White Girls Star Flower Headband|,|From designer Isobella and Chloe, this girls headband will finish off many outfits perfectly! The thin headband is covered with a black knit while the two tone flowers boast of small beaded accents. |,|$9.00$|,||,|ISOBELLA-CHLOE-BLACK-WHITE-GIRLS-STAR-FLOWER-HEADBAND|,|$URL$isobella-chloe-black-white-girls-star-flower-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-black-white-girls-star-flower-headband-12.jpg||-||Isobella and Chloe Black Bolero Girls Shrug in Velour|,|Designed to match with their fabulous dresses, this Isobella and Chloe shrug is available in a wide size range. The soft black velour is filled with winter cheer while long sleeves add warmth. The bolero cut is stylish and will not detract from her gorgeous dress layered underneath. The front is dressed with ruffles and a long tie that closes the front shut.. Made with a polyester blend. Hand wash cold, line dry. |,|$14.00$|,||,|ISOBELLA-CHLOE-BLACK-BOLERO-GIRLS-SHRUG-VELOUR|,|$URL$isobella-chloe-black-bolero-girls-shrug-velour.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-black-bolero-girls-shrug-in-velour-2.jpg||-||Isobella and Chloe Black Sleeveless Neverland Dress for Girls|,|^|Whether she is celebrating a holiday with the family or showing her talent at a recital, this darling new dress from Isobella and Chloe will shine bright. The empire waist bodice features a wide neckline in a square shape and two sheer flowers accenting her right shoulder. The tiers of sheer ruffles in black recieve a subtle touch of color with a midnight blue gradient effect. The A line skirt is made with the same sheer fabric, boasting of sparkles that catch the light as she moves. Match with her younger sister's ""Neverland"" dress for a cute pair! Made with 100% polyester, hand wash this dress and line dry. (1) 6X AND (1) 7 LEFT.  ^||,|$29.00$|,||,|ISOBELLA-CHLOE-BLACK-SLEEVELESS-NEVERLAND-DRESS-GIRLS|,|$URL$isobella-chloe-black-sleeveless-neverland-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-black-sleeveless-neverland-dress-for-girls-3.jpg||-||Isobella and Chloe Blue Moon Girls Ruffle Headband|,|New from Isobella and Chloe, this girls headband is too cute. Covered in brown and blue ruffles, this soft headband stretches around her head and is adorned with a matching circle flower. |,|$7.00$|,||,|ISOBELLA-CHLOE-BLUE-MOON-GIRLS-RUFFLE-HEADBAND|,|$URL$isobella-chloe-blue-moon-girls-ruffle-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-blue-moon-girls-ruffle-headband-11.jpg||-||Isobella and Chloe Brown Mocha Special Occasion Dress for Girls|,|^|In a delicious shade of mocha brown, this new girls dress comes from the fabulous designer Isobella and Chloe. The silky fabric of the bodice slightly catches the light. Cap sleeves frame the neckline while a hidden zipper closes up the back. The drop waist is adorned by a large flower that is accented by two falling ruffled spirals. The skirt is created with two ruffle layers with a clean, straight hem. 100% polyester. Dry clean only. SIZE 2T AND 3T ONLY REMAINING.  ^||,|$24.00$|,||,|ISOBELLA-CHLOE-TAUPE-SPECIAL-OCCASION-DRESS-GIRLS|,|$URL$isobella-chloe-taupe-special-occasion-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-brown-mocha-special-occasion-dress-for-girls-2.jpg||-||Isobella and Chloe Casual Girls Tunic and Legging in Gray|,|Designed by Isobella and Chloe, this adorable girls top and legging set is one she can wear any day! The empire waistline is accented with a large striped bow that is set off to one side. The neckline is layered with the same thin stripes. The tunic opens in shape after the waist with a skirt that twirls about as she walks and finishes in an asymmetrical hem. The black leggings that are paired beneath offer a comfortable stretch fit and a trendy look. |,|$29.00$|,||,|ISOBELLA-CHLOE-CASUAL-GIRLS-TUNIC-LEGGING-GRAY|,|$URL$isobella-chloe-casual-girls-tunic-legging-gray.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-casual-girls-tunic-and-legging-in-gray-17.jpg||-||Isobella and Chloe Cherry Dots Little Girls Tunic and Pant|,|Filled with infectious fun, this new little girls outfit from Isobella and Chloe will be envied by all. The bodice is covered with sweet black and white stripes. The wide cuffs on her long sleeves are trimmed with red. A single ruffle finds its way around her empire waist completed by a red fabric flower. The dark grey skirt is covered with large red polka dots and finished with a matching hem. The solid red pants boast of their multiple tiers of black trimmed ruffles. Hand wash in cold water and hang to dry.Top is made with a poly and rayon blend, pant is made with a cotton blend. |,|$24.00$|,||,|ISOBELLA-CHLOE-CHERRY-DOTS-LITTLE-GIRLS-TUNIC-PANT|,|$URL$isobella-chloe-cherry-dots-little-girls-tunic-pant.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-cherry-dots-little-girls-tunic-and-pant-2.jpg||-||Isobella and Chloe Couture Outfit for Girls in Lavender|,|^|From Isobella & Chloe, this new girls tunic and pant set is a cute outfit she will love. The outfit features an empire waist bodice, a keyhole back, and long sleeves. The skirt of the tunic is introduced with a flower and is covered with textured fabrics. The cuffs are finished with a double ruffle to match the hem of the accompanying leggings. This tunic matches the ""Isobella and Chloe Girls Long Sleeve Dress in Lavender"" perfectly for a sweet sister pair. Cotton/Nylon/Spandex Blend. Hand Wash in Cold Water. Line Dry. ^||,|$49.00$|,||,|ISOBELLA-AND-CHLOE-COUTURE-OUTFIT-GIRLS-LAVENDER|,|$URL$isobella-and-chloe-couture-outfit-girls-lavender.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-couture-outfit-for-girls-in-lavender-1.jpg||-||Isobella and Chloe Creme Brulee Girls Ruffled Dress|,|^|A sweet new design, this fancy girls dress comes from designer Isobella and Chloe from their rich ""Creme Brulee"" collection. The bodice is gathered with pleats and fitted at the empire waistline. The straps create a square neckline while the small accents found on both are adorable small touches. The skirt falls in elegant ruffles that are layered with a sheer polka dot tulle. Be sure to find the older style that matches perfectly! ^||,|$36.00$|,||,|ISOBELLA-CHLOE-CREME-BRULEE-GIRLS-RUFFLED-DRESS|,|$URL$isobella-chloe-creme-brulee-girls-ruffled-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-creme-brulee-girls-ruffled-dress-1.jpg||-||Isobella and Chloe Enya Teal Waves Little Girls Dress|,|A dress you are sure to love, this rich seaside teal is perfect for any occasion and comes from a well loved brand, Isobella and Chloe. The cap sleeve bodice is covered with pleats that wave across the front and are dressed with sequins. The waist is adorned with beading and the neckline is closed by a zipper that runs up the back. The skirt gains its shape from the pleats that fall from the waist. This taffeta fabric is classy and gorgeous! Polyester blend, hand wash this dress and line dry |,|$29.00$|,||,|ISOBELLA-CHLOE-ENYA-TEAL-WAVES-LITTLE-GIRLS-DRESS|,|$URL$isobella-chloe-enya-teal-waves-little-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-enya-teal-waves-little-girls-dress-2.jpg||-||Isobella and Chloe Evergreen Girls Spring Dress|,|A vibrant summer dress, this adorable creation comes from Isobella and Chloe. The bright green mimics the new life that was ushered in by spring time. The drop waist bodice is solid and fully lined. The back has a single keyhole that fastens at the top while a large sheer flower sits on her waistline. The skirt is draped with quaint ruffles in lime and ivory. This Isobella and Chloe dress is a one of a kind piece! |,|$49.00$|,||,|ISOBELLA-CHLOE-EVERGREEN-GIRLS-SPRING-DRESS|,|$URL$isobella-chloe-evergreen-girls-spring-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-evergreen-girls-spring-dress-1.jpg||-||Isobella and Chloe Fancy Little Girls Oufit|,|Bright and fun, this new girls outfit from Isobella and Chloe is unlike anything else that she owns in her summer closet. The designer girls dress offers her an empire waist and a single button keyhole back. The sleeveless neckline is accented with the unique rainbow shape stripes that are created with subtle tonal differences in the coral peach. The ivory and peach flower is layered and set to the left of the waist, finished with a decorated center. The skirt of the top finishes with a double layer of ruffles that sweep around the dress with grace and ease. The matching pants have an all day comfort that cannot be beat. The hem of both legs gains the same elegant touch of sheer fabric ruffles. |,|$29.00$|,||,|ISOBELLA-CHLOE-FANCY-LITTLE-GIRLS-OUFIT|,|$URL$isobella-chloe-fancy-little-girls-oufit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-fancy-little-girls-oufit-1.jpg||-||Isobella and Chloe Frilly Pant Set For Girls in Melody|,|^|Created by Isobella & Chloe, this new girls tunic is part of their ""Melody"" collection. The taupe is a perfect fall shade while the touches of coral are a great pop of color. The empire waistline is finished with a ruffle and dressed with a bow. The skirt is covered with ruffles in various sizes and fabrics. The leggings paired beneath are a solid taupe and offer slight stretch in fit. Cotton/Spandex Blend. Hand Wash in Cold Water. Hang to Dry. ^||,|$49.00$|,||,|ISOBELLA-AND-CHLOE-FRILLY-PANT-SET-GIRLS-MELODY|,|$URL$isobella-and-chloe-frilly-pant-set-girls-melody.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-frilly-pant-set-for-girls-in-melody-1.jpg||-||Isobella and Chloe Girls Bathing Suit in Yellow|,|^|An addition of the new ""Lemon Drop"" collection by Isobella and Chloe's Swimwear line, this new girls swimsuit is available in sizes from 2T to 6X. The yellow swimsuit is a ray of bright light while the neckline is shape by a touch of cinching. A matching flower is found near the right thin shoulder strap and finds its coordinating blooms upon the skirt. Waving tiers wrap around the swimsuit in sweet ruffles. The solid yellow shade compliments her sun kissed skin tone. Made with nylon blend. Hand wash cold, line dry. SIZE 4T AND 4 ONLY LEFT. ^||,|$36.00$|,||,|ISOBELLA-CHLOE-GIRLS-BATHING-SUIT-YELLOW|,|$URL$isobella-chloe-girls-bathing-suit-yellow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-bathing-suit-in-yellow-12.jpg||-||Isobella and Chloe Girls Designer Dress in Whirlwind Stripes|,|Created by designer Isobella and Chloe, this new girls dress is such a gem. The bodice of the dress is textured upon the front and fitted with a hidden zipper in the back. The long sleeves are finished with a sweet ruffle. Her empire waist is defined with a small touch of fabric and a cute flower. The skirt turns the thin stripes for a unique look while the hem is finished with three ruffles. Polyester/Rayon/Spandex Blend. Hand Wash in Cold Water. Hang to Dry. |,|$49.00$|,||,|ISOBELLA-AND-CHLOE-GIRLS-DESIGNER-DRESS-WHIRLWIND-STRIPES|,|$URL$isobella-and-chloe-girls-designer-dress-whirlwind-stripes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-designer-dress-in-whirlwind-stripes-1.jpg||-||Isobella and Chloe Girls Dress in Champagne|,|^|A champagne creme shade, this darling new dress was created by designer Isobella and Chloe as part of their ""Tea Time"" collection for spring and summer. The drop waist bodice boasts of a wide neckline that is decorated with a touch or pearly beads. The cap sleeves are sweet an innocent while the hidden zipper closes up the back. The waistline is wrapped with a chiffon bow that is off centered and finished with a pearl center. The skirt is ruffled in three layers of the same chiffon. A textured overlay covers the bodice and contrasts beautifully to the sheer fabric. SIZE 3T ONLY LEFT.  ^||,|$39.00$|,||,|ISOBELLA-CHLOE-GIRLS-DRESS-CHAMPAGNE|,|$URL$isobella-chloe-girls-dress-champagne.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-dress-in-champagne-1.jpg||-||Isobella and Chloe Girls Dress in Red with Flower Waist|,|Beloved designer Isobella and Chloe creates fabulous looks like this red holiday dress for girls! The velvet bodice is a timeless look and boasts of ruffled, princess cap sleeves framing the wide neckline. A cute ruffle runs around the waist and becomes the bed for a sweet flower. The skirt opens to a full circle shape and is finished with several ruffles. Polyester/Spandex Blend. Dry Clean Only. |,|$56.00$|,||,|ISOBELLA-AND-CHLOE-GIRLS-DRESS-RED-FLOWER-WAIST|,|$URL$isobella-and-chloe-girls-dress-red-flower-waist.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-dress-in-red-with-flower-waist-1.jpg||-||Isobella and Chloe Girls Dress with Polka Dots in Caspian Sea|,|A sweet arrival, this design from Isobella and Chloe is perfect for any plans she may have that day. The bodice is a cool sea blue and features a subtle dot print. The empire waist is adorned with a smocked ruffle and two fabric blooms. The skirt opens in shape and drapes beautifully around her legs with every step. Two polka dot ruffles finish this dress off on the perfect note. Polyester Blend. Hand Wash in Cold Water. Hang to Dry. |,|$49.00$|,||,|ISOBELLA-AND-CHLOE-GIRLS-DRESS-POLKA-DOTS-CASPIAN-SEA|,|$URL$isobella-and-chloe-girls-dress-polka-dots-caspian-sea.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-dress-with-polka-dots-in-caspian-sea-1.jpg||-||Isobella and Chloe Girls Drop Waist Dress in Silver|,|^|A trendy holiday dress for your darling daughter, this new gown comes from Isobella and Chloe. The drop waist bodice offers a sleeveless neckline and a hidden zipper that runs up the back. A large bow sits off centered on her waist as the silver skirt bubbles out in shape. For a truly classic look, pair with tights and fancy shoes for the perfect look! 100% polyester. Dry clean only. (1) 6 ONLY LEFT.  ^||,|$34.00$|,||,|ISOBELLA-CHLOE-GIRLS-DROP-WAIST-DRESS-SILVER|,|$URL$isobella-chloe-girls-drop-waist-dress-silver.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-drop-waist-dress-in-silver-3.jpg||-||Isobella and Chloe Girls Empire Waist Dress for Holiday|,|A gorgeous look for the holiday season, this new designer girls dress from Isobella and Chloe is a timeless look for your family holiday photos. The empire bodice has a fitted cut and features a cap sleeve. The rose texture catches the light in a unique, beautiful way. The waistline has a thin line of sparkle to help accent shape. The skirt is created with layers of sheer tulle draping down into three tiers from the waist. 100% Polyester. Dry Clean Only. |,|$54.00$|,||,|ISOBELLA-AND-CHLOE-GIRLS-EMPIRE-WAIST-DRESS-HOLIDAY|,|$URL$isobella-and-chloe-girls-empire-waist-dress-holiday.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-empire-waist-dress-for-holiday-1.jpg||-||Isobella and Chloe Girls Fancy Outfit in Raspberry|,|^|A gorgeous shade of raspberry pink, this fabulous girls birthday dress comes from designer Isobella and Chloe. The top is cut with a wide, straight neckline that is sleeveless and featuring pleats covering the empire bodice. A ruffle wraps around the top and accented with a ruffle flower. The skirt is draped in layers of sheer tulle that falls into the volume-filled hem wrapped in ruffles. Matching pink leggings are worn beneath and have a stretch waistband that is comfortable. The hemline of both legs are finished with two rows of ruffles. Be sure to find the matching ""Raspberry Limeade"" dress for her older sister! ^||,|$29.00$|,||,|ISOBELLA-CHLOE-GIRLS-FANCY-OUTFIT-RASPBERRY|,|$URL$isobella-chloe-girls-fancy-outfit-raspberry.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-fancy-outfit-in-raspberry-1.jpg||-||Isobella and Chloe Girls Holiday Dress in Chocolate Monet|,|^|In rich chocolate brown, this new designer dress comes from Isobella and Chloe for the holiday season. The dress is a perfect match to the ""Girls Special Occasion Dress in Monet"" that is available in her younger sister's sizes. The drop waist bodice is a soft velvet with a wide neckline framed by puffy sleeves. The full circle skirt is dressed with ruffles at the hem and waist. A single flower accent is found on the front of the waist as well. Polyester/Spandex Blend. Dry Clean Only. ^||,|$56.00$|,||,|ISOBELLA-AND-CHLOE-GIRLS-HOLIDAY-DRESS-CHOCOLATE-MONET|,|$URL$isobella-and-chloe-girls-holiday-dress-chocolate-monet.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-holiday-dress-in-chocolate-monet-1.jpg||-||Isobella and Chloe Girls Holiday Dress in Dark Gray|,|^|Positively stunning, this holiday dress from designer Isobella and Chloe will make a subtle statement of chic this holiday season. The sleeveless dress boasts of glittering straps and a matching bow that sits on her left shoulder. The dark gray chiffon fabric drapes beautifully in a continuous silhouette from her shoulders to the hem. Gathers on the scoop neckline open up the shape and fit. 100% polyester. Hand wash cold, line dry. SIZE 7 AND 8 REMAINING. ^||,|$29.00$|,||,|ISOBELLA-CHLOE-GIRLS-HOLIDAY-DRESS-NAVY|,|$URL$isobella-chloe-girls-holiday-dress-navy.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-holiday-dress-in-dark-gray-2.jpg||-||Isobella and Chloe Girls Holiday Dress in Enya Waves|,|Matching her younger sister, this girls holiday gown from Isobella and Chloe will make you family photos stand out amongst the rest. The skirt gains shape as the pleats that fall from the waist open, allowing the dress to dance around her feet and make it fun to twirl. A zipper runs up the back and the sleeveless neckline is in the classic jewel shape. Waves of pleats splash upon the bodice, sprinkled with sequins. Polyester blend, hand wash this dress and line dry |,|$29.00$|,||,|ISOBELLA-CHLOE-GIRLS-HOLIDAY-DRESS-ENYA-WAVES|,|$URL$isobella-chloe-girls-holiday-dress-enya-waves.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-holiday-dress-in-enya-waves-2.jpg||-||Isobella and Chloe Girls Ivory Dress|,|^|Tiers of ruffles in ivory cotton make this dress from Isobella and Chloe the perfect choice for her spring and summer events. Ruffled straps adorn the square bodice, along with two ivory flowers. Tiers of ruffles define the skirt. Ties and a full zipper are features of the back. Fully line with polyester for comfort. 100% cotton, exclusive of lining. Hand wash cold, line dry. SIZE 10 ONLY REMAINING. ^||,|$29.00$|,||,|ISOBELLA-CHLOE-GIRLS-IVORY-DRESS|,|$URL$isobella-chloe-girls-ivory-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-ivory-dress-15.jpg||-||Isobella and Chloe Girls Lace Holiday Dress in Audrey|,|With short sleeve and a timeless style, this new holiday dress from Isobella and Chloe really takes the cake. The fitted bodice is covered by a graceful black tulle overlay covered with a textured chiffon lace and features cap sleeves and a zipper closing the back. The skirt is tiered with black chiffon ruffles, sheer and fluffy like frosting. She will never want to take this dress off! Wear it to family weddings, holiday celebrations, or recitals! Matches with a younger style for sister pairs. Polyester blend, dry clean recommended. |,|$29.00$|,||,|ISOBELLA-CHLOE-GIRLS-LACE-HOLIDAY-DRESS-AUDREY|,|$URL$isobella-chloe-girls-lace-holiday-dress-audrey.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-lace-holiday-dress-in-audrey-3.jpg||-||Isobella and Chloe Girls Laura Empire Waist Dress|,|A beautiful choice for your beautiful girl, this girls empire waist dress is from designer Isobella and Chloe. The strappy bodice places host to swirls of black and white with a diagonal panel of black on the right side. The shoulder straps have a braid of black and white over a solid white strap. The skirt flows from an empire waist and is done in panels of white. Black stitching in a vertical pattern breaks up each panel of white. A full zipper is located on the back along with string ties that finish off in a bow. The dress is fully lined. Made from cotton/polyester. Hand wash cold, line dry. |,|$29.00$|,||,|ISOBELLA-CHLOE-GIRLS-LAURA-EMPIRE-WAIST-DRESS|,|$URL$isobella-chloe-girls-laura-empire-waist-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-laura-empire-waist-dress-16.jpg||-||Isobella and Chloe Girls Ruffle Bikini|,|^|A sweet fruity design, this ""Starfruit"" collection by Isobella and Chloe is filled with trendy colors that are sure to fill the season. The bikini top has a classic triangle shape that is trimmed in lime green. The halter and back strap are both adjustable to allow for a personalized fit. The front is covered with watermelon pink and yellow ruffles. The bottoms paired beneath match perfectly. A skirt of ruffles runs around her legs in stripes of bold, bright, and beautiful colors. Two fabric flowers are also found upon the skirt. ^||,|$36.00$|,||,|ISOBELLA-CHLOE-GIRLS-RUFFLE-BIKINI|,|$URL$isobella-chloe-girls-ruffle-bikini.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-ruffle-bikini-1.jpg||-||Isobella and Chloe Girls Ruffle Dress in Karen Brown|,|Boasting of its unique textured fabric, this ruffle dress from Isobella and Chloe fits the fall and winter holidays perfectly. With a classy and timeless sheen, the cap sleeve bodice is made with a taffeta like fabric that gathers slightly at the waist which is adorned by a cute bow. The tiered skirt has dark brown layers overlayed with a tweed like fabric that adds character and style. A matching drop waist dress is available in older sizes. Dry clean recommended to keep this dress looking its best. 100% polyester. |,|$29.00$|,||,|ISOBELLA-CHLOE-GIRLS-RUFFLE-DRESS-KAREN-BROWN|,|$URL$isobella-chloe-girls-ruffle-dress-karen-brown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-ruffle-dress-in-karen-brown-2.jpg||-||Isobella and Chloe Girls Ruffled Swimsuit Tank|,|^|Colorful and bright, this one piece from designer Isobella and Chloe is part of their ""Hanna Cabana"" collection. The blue swimsuit features a cinched keyhole that is tied with a bow and helps create the shape of the neckline. A trio of pink, yellow, and lime flowers are attached off centered near her right shoulder. The triple layer ruffle uses the same vibrant colors to ruffle around. Made with nylon blend. Hand wash cold, line dry. ^||,|$34.00$|,||,|ISOBELLA-CHLOE-GIRLS-RUFFLED-SWIMSUIT-TANKINI|,|$URL$isobella-chloe-girls-ruffled-swimsuit-tankini.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-ruffled-swimsuit-1.jpg||-||Isobella and Chloe Girls Special Occasion Dress in Monet|,|Matching her older sisters dress, this new arrival from Isobella and Chloe is absolutely gorgeous. Cap sleeves frame the neckline while a zipper closes the back. The empire waist is adorned with a waving ruffle and a single flower. The soft velvet fabric coordinates perfectly with the more structured skirt. A final ruffle wraps around the hemline to complete the look. Polyester/Spandex Blend. Dry Clean Only. |,|$49.00$|,||,|ISOBELLA-AND-CHLOE-GIRLS-SPECIAL-OCCASION-DRESS-MONET|,|$URL$isobella-and-chloe-girls-special-occasion-dress-monet.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-special-occasion-dress-in-monet-1.jpg||-||Isobella and Chloe Girls Tankini Starfruit|,|Fun and adorable, this little girls swimsuit is a real star from designer Isobella and Chloe. The watermelon pink covers the top and is decorated with light polka dots. The lime green straps match the bow that ties to cinch the keyhole found in the front. Further decoration includes a trio of ruffles and small yellow flowers. The yellow bottoms worn beneath boast of a pink ruffle. |,|$34.00$|,||,|ISOBELLA-CHLOE-GIRLS-TANKINI-STARFRUIT|,|$URL$isobella-chloe-girls-tankini-starfruit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-tankini-starfruit-1.jpg||-||Isobella and Chloe Girls Tunic Dress Pant Set in Red|,|In a true red, this new designer outfit from Isobella & Chloe is a comfortable design she will love to wear! The tunic features fabric flowers decorating the neckline and a button keyhole on the back. The skirt opens in shape and is dressed with ruffles from waist to the fun hem. A solid pair of leggings is worn beneath this tunic to add warmth. Cotton/Spandex Blend. Hand Wash in Cold Water. Hang to Dry. |,|$42.00$|,||,|ISOBELLA-AND-CHLOE-GIRLS-TUNIC-DRESS-PANT-SET-RED|,|$URL$isobella-and-chloe-girls-tunic-dress-pant-set-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-tunic-dress-pant-set-in-red-1.jpg||-||Isobella and Chloe Girls Tutu Dress Red Polka Dot|,|Matching several other new arrivals from Isobella and Chloe, this new little girls dress is too cute! The black and white striped bodice has a diagonal stripe that changes direction. The long sleeve top boasts of a single button keyhole back and a fitted shape. This skirt of this dress features sheer grey ruffles that ruffle around her legs in three tiers. Large cherry red polka dots cover the tulle and add a splash of color. Polyester blend, hand wash this dress and line dry. |,|$24.00$|,||,|ISOBELLA-CHLOE-GIRLS-TUTU-DRESS-RED-POLKA-DOT|,|$URL$isobella-chloe-girls-tutu-dress-red-polka-dot.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-tutu-dress-red-polka-dot-2.jpg||-||Isobella and Chloe Girls Twirl Dress in Bella Bow|,|Suited for a fairy princess, this new designer little girls dress from Isobella and Chloe is a beautiful creation that will be adored at first sight! The empire bodice features cap sleeves and a sweet sequin decoration that accents the front. A hidden zipper runs up the back while three fabric flowers sit on the waist. The skirt is created with layers of sheer fabric in various colors. The fairy hemline is a magical design. 100% Polyester. Dry Clean Only. |,|$49.00$|,||,|ISOBELLA-AND-CHLOE-GIRLS-TWIRL-DRESS-BELLA-BOW|,|$URL$isobella-and-chloe-girls-twirl-dress-bella-bow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-twirl-dress-in-bella-bow-1.jpg||-||Isobella and Chloe Girls Two Piece Swimsuit|,|^|From Isobella and Chloe, this designer bikini for girls is sure to be a favorite choice whether she is at the beach or pool. Dark blue covers this suit while the bandeaux top is cinched in the center and covered with waving ruffles. A matching flower sits upon the top while its twin is found on the coordinating bottoms. The same whimsical waves skirt around the bottoms. Be sure to find the other adorable suits available from their ""Tidal Wave"" collection. (1) SIZE 14 ONLY REMAINING.  ^||,|$34.00$|,||,|ISOBELLA-CHLOE-GIRLS-TWO-PIECE-SWIMSUIT|,|$URL$isobella-chloe-girls-two-piece-swimsuit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-girls-two-piece-swimsuit-1.jpg||-||Isobella and Chloe Hannah Cabana Bikini for Girls|,|^|Bringing out her fun-filled spirit, this new Isobella and Chloe bikini is sure to bring a bright smile to her face. The bikini top has an adjustable halter and back strap that is fastened for a custom fit. The shape is accented with colorful ruffles and a single flower. The vibrant bottoms have a ruffled skirt overlay with yellow, lime, and pink. Beneath the ruffles is a solid blue that is mostly hidden. Two flowers are also found on the skirt, matching the style of the one found on the top. Made with nylon blend. Hand wash cold, line dry. Only Size 2T and 3T Remaining ^||,|$34.00$|,||,|ISOBELLA-CHLOE-HANA-CABANA-BIKINI-GIRLS|,|$URL$isobella-chloe-hana-cabana-bikini-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-hana-cabana-bikini-for-girls-1.jpg||-||Isobella and Chloe Harmony Tunic and Pant for Little Girls|,|Too sweet to pass up, the Harmony outfits from Isobella and Chloe's fall 2013 collection are sure to go fast. This little girls tunic with pant is available from infant sizes to 4T. The bodice is voered with a brown and candy pink leopard print that is unique and trendy. The long sleves are striped with the same pink and bost of wide ruffle cuffs. Two rosettes sit on her pink wayst while the greay skirt is styled in an A line shape and finished with a double ruffle hem. Matching striped pants pair beneath iwth a comfortable fabric and wide ruffle hem. Matches perfectly to the two older styles available for her sisters, making the perfect family photo! Polyester blend, hand wash this dress and line dry. |,|$24.00$|,||,|ISOBELLA-CHLOE-HARMONY-TUNIC-PANT-LITTLE-GIRLS|,|$URL$isobella-chloe-harmony-tunic-pant-little-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-harmony-tunic-and-pant-for-little-girls-2.jpg||-||Isobella and Chloe Hawaiian Punch Girls Bikini|,|^|A rich kick of color, this new designer girls swimsuit comes from Isobella and Chloe in their ""Hawaiian Punch"" collection. The top has thin straps that begin on the front in the center. The top is ruffled alternating between diagonal stripes and a light yellow. The matching bottoms are covered in the same pink, purple, and yellow stripes. Both hips have a single draw string bow that cinches the side while a pink and yellow flower is found off centered to the left. ^||,|$38.00$|,||,|ISOBELLA-CHLOE-HAWAIIAN-PUNCH-GIRLS-BIKINI|,|$URL$isobella-chloe-hawaiian-punch-girls-bikini.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-hawaiian-punch-girls-bikini-1.jpg||-||Isobella and Chloe Holiday Dress for Girls in Silver|,|A holiday dress for little girls, this fabulous designer creation is from Isobella and Chloe. The bodice is covered with a rose pattern and features cap sleeves. The neckline is cut for a wider style while a hidden zipper runs up the back. The waistline has a small sparkling accent. The skirt is divided into three tiers of sheer layers. This beautiful dress is also available in younger sizes and in a red and black color while supplies last. 100% Polyester. Dry Clean Only. |,|$53.00$|,||,|ISOBELLA-AND-CHLOE-HOLIDAY-DRESS-GIRLS-SILVER|,|$URL$isobella-and-chloe-holiday-dress-girls-silver.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-holiday-dress-for-girls-in-silver-1.jpg||-||Isobella and Chloe Holiday Dress for Infants in Silver|,|^|Isobella and Chloe has created this darling infant dress to match her older sister's gown ""Isobella and Chloe Holiday Dress for Girls in Silver."" The dress features a ribbon flower texture that covers the bodice. Her neckline is framed by the adorable cap sleeves and a hidden zipper runs up the back. Two tulle flowers sit upon the waist and are decorated with beaded centers. A tulle tie creates a bow on her back. The skirt is layered with grey and black tulle finished in angled hems. This dress is identical to the older style except for smaller embellishments that are not safe for the younger girls! The dress is created in 100% polyester and is fully lined. Dry clean this dress for best results! ^||,|$49.00$|,||,|ISOBELLA-AND-CHLOE-HOLIDAY-DRESS-INFANTS-SILVER|,|$URL$isobella-and-chloe-holiday-dress-infants-silver.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-holiday-dress-for-infant-in-silver-7.jpg||-||Isobella and Chloe Iceland Grey Faux Fur Jacket for Girls|,|^|Soft and cozy, this new girls jacket comes from Isobella and Chloe. The grey faux fur covering the outside waves in texture while a grey satin accents a high waist. Two clear buttons close the front while a large chiffon and satin rosette sits on her right side. Made with polyester, not meant to be a winter coat. Dry clean only. (1) 2T ONLY LEFT. ^||,|$28.80$|,||,|ISOBELLA-CHLOE-ICELAND-GREY-FAUX-FUR-JACKET-GIRLS|,|$URL$isobella-chloe-iceland-grey-faux-fur-jacket-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-iceland-grey-faux-fur-jacket-for-girls-16.jpg||-||Isobella and Chloe Jazz Cat Girls Rosette Headband|,|^|Matching her new Jazz Cat dress or outfit, this girls headband is adorable! The trio of rosettes are made with grey and brown satin and a cream chiffon while the headband is wrapped with a charcoal knit. The flowers measure roughly 4"" in length. ^||,|$4.00$|,||,|ISOBELLA-CHLOE-JAZZ-CAT-GIRLS-ROSETTE-HEADBAND|,|$URL$isobella-chloe-jazz-cat-girls-rosette-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-jazz-cat-girls-rosette-headband-12.jpg||-||Isobella and Chloe Jazz Cat Girls Turtle Neck Dress with Ruffles|,|^|A unique creation perfect for fall and winter, this new girls dress comes from Isobella and Chloe. The long sleeve bodice features a unique white and taupe print, a turtle neck, and a chiffon rosette applique complete with a silver satin bow. The skirt is layered with a chocolate brown satin ruffle complimented with the chiffon and silver. The body is fully lined while the sleeves are left sheer. Dry clean only, look for the matching headband to complete the look. SIZE 14 LEFT. ^||,|$24.00$|,||,|ISOBELLA-CHLOE-JAZZ-CAT-GIRLS-TURTLE-NECK-DRESS-RUFFLES|,|$URL$isobella-chloe-jazz-cat-girls-turtle-neck-dress-ruffles.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-jazz-cat-girls-turtle-neck-dress-with-ruffles-15.jpg||-||Isobella and Chloe Jersey Girl Tunic and Capri in Magenta|,|Vibrant and young, this fabulous girls outfit from Isobella and Chloe fits her to a tee. The sleeveless tunic offers her a racer back cut and a draping fit. The neckline scoops in the front while pleats fall down and open the shape. A large pocket is found on both dyes, covered with the same pink and grey stripes and accented with a single bow. Solid, bright pink leggings are paired with the dress to complete this amazing summer look. |,|$29.00$|,||,|ISOBELLA-CHLOE-JERSEY-GIRL-TUNIC-CAPRI-MAGENTA|,|$URL$isobella-chloe-jersey-girl-tunic-capri-magenta.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-jersey-girl-tunic-and-capri-in-magenta-1.jpg||-||Isobella and Chloe Kendra Charcoal Tween Dress|,|^|Sophisticated in style, this tween dress from Isobella and Chloe has such a timeless style. The long sleeve bodice is decorated by a V neckline that is adorned by sweet tulle. The skirt is in a charcoal grey rich in texture. Dress is lined for her comfort. Created with cotton blend for the bodice and an acrylic blend in the skirt. Hand wash and line dry. SIZE 10 ONLY REMAINING.  ^||,|$29.00$|,||,|ISOBELLA-CHLOE-KENDRA-CHARCOAL-TWEEN-DRESS|,|$URL$isobella-chloe-kendra-charcoal-tween-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-kendra-charcoal-tween-dress-2.jpg||-||Isobella and Chloe Knit Girls Dress in Magenta|,|^|A perfect match to the younger ""Jersey Girl"" outfit that has just arrived, this casual girls dress comes from Isobella and Chloe. The fabric is soft and comfortable while covered with light grey and a bright pink. The racer back cut falls in a scoop neckline on the front. The dress falls to a shark bite hemline that has a relaxed fit thanks to the pleating at the neckline. The sides of the dress have long pockets with bows at the top. The vibrant colors are sure to stand out in the bright summer sun. ^||,|$36.00$|,||,|ISOBELLA-CHLOE-KNIT-GIRLS-DRESS-MAGENTA|,|$URL$isobella-chloe-knit-girls-dress-magenta.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-knit-girls-dress-in-magenta-1.jpg||-||Isobella and Chloe Lime and Black Bikini for Girls|,|^|Filled with irresistible fun, this fabulous girls bikini comes from designer Isobella and Chloe. The top has a bandeaux shape with the gathers in the center. The texture is created with waves of lime and black. A coordinating flower is found at the base of her left shoulder strap and features a rosette center. The matching bottoms have an attached skirt covered with the same gorgeous waves. (1) SIZE 3T ONLY LEFT. ^||,|$34.00$|,||,|ISOBELLA-CHLOE-LIME-BLACK-BIKINI-GIRLS|,|$URL$isobella-chloe-lime-black-bikini-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-lime-and-black-bikini-for-girls-1.jpg||-||Isobella and Chloe Little Girls Chiffon Dress|,|^|From the ""Tea Time"" collection by designer Isobella and Chloe, this new designer girls dress is one that cannot be replaced! The short sleeve bodice has an empire waistline accented with a single bow accented with a pearly center. The texture overlay has a vintage elegance while the back is closed with a hidden zipper. The skirt is created in two layers of the same sweet creme chiffon fabric. Two older styles are also found in this collection for her sisters. Any spring or summer wedding is sure to be a perfect fit for this little girls special occasion dress! (1) SIZE 6 MOS ONLY AVAILABLE.  ^||,|$39.00$|,||,|ISOBELLA-CHLOE-LITTLE-GIRLS-CHIFFON-DRESS|,|$URL$isobella-chloe-little-girls-chiffon-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-little-girls-chiffon-dress-1.jpg||-||Isobella and Chloe Little Girls Dress Harmony Stripes|,|^|Matching her sweet sister's outfit, this new dress from Isobella and Chloe is part of the ""Harmony"" patterns. The zipper that runs up the back of the dress gives an easy and sure fit while her long sleeves finish with wide cuffs. Trendy fuchsia leopard spots pounce on the bodice while two rosettes sit off centered at the waist. Her A line skirt alternates between brown and fuchsia stripe ruffles. Polyester blend, hand wash this dress and line dry. SIZE 2T AND 3T LEFT.  ^||,|$32.40$|,||,|ISOBELLA-CHLOE-LITTLE-GIRLS-DRESS-HARMONY-STRIPES|,|$URL$isobella-chloe-little-girls-dress-harmony-stripes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-little-girls-dress-harmony-stripes-3.jpg||-||Isobella and Chloe Little Girls Hawaiian Dress in Plumeria|,|Matching the Plumeria pant set, this new Isobella and Chloe dress is one she will certainly adore. The dress is styled to hit just near her knee and is created with comfortable fabric, complete with lining. The empire waist bodice has pleating falling from her neckline and a hidden zipper running up the back. A darling flower sits upon the waist and introduces the draping effect of the skirt. This style is defined perfectly with layers of pretty ruffles. The skirt offers an A line fit. Cotton/Spandex Blend. Hand Wash in Cold Water. Hang to Dry. |,|$46.00$|,||,|ISOBELLA-AND-CHLOE-LITTLE-GIRLS-HAWAIIAN-DRESS-PLUMERIA|,|$URL$isobella-and-chloe-little-girls-hawaiian-dress-plumeria.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-little-girls-hawaiian-dress-in-plumeria-1.jpg||-||Isobella and Chloe Little Girls Holiday Dress Audrey Lace|,|^|Elegant and simply gorgeous this new creation comes from Isobella and Chloe and is ready to blow the holiday season away! The empire waist dress is covered with a black lace overlay and features lacey three quarter sleeves. The chiffon skirt drapes in beauty and grace while a matching bow is adorned at the waist. Pair with the older style for a sister match made in heaven! Polyester blend, dry clean recommended. SIZE 6 ONLY LEFT. ^||,|$29.00$|,||,|ISOBELLA-CHLOE-LITTLE-GIRLS-HOLIDAY-DRESS-AUDREY-LACE|,|$URL$isobella-chloe-little-girls-holiday-dress-audrey-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-little-girls-holiday-dress-audrey-lace-2.jpg||-||Isobella and Chloe Little Girls Pink Party Dress Heaven Sent|,|^|A part of the new ""Heaven Sent"" collection by fabulous Isobella and Chloe, this little girls dress is perfect for her next birthday party! The bodice is a classic shade of white while featuring cap sleeves that frame a side, straight neckline that is fit for any princess. The back is fastened closed with a hidden zipper while three stripes of pink run down the front and center. The small duo of flowers found on the right of her neck are matched by the trio off set on her waistline. The dreamy skirt is tiered in ruffles. The diamond print in pink gains texture as small touches of tulle peak out from underneath. (1) 3 MOS AND (1) 18 MOS ONLY LEFT.  ^||,|$34.00$|,||,|ISOBELLA-CHLOE-LITTLE-GIRLS-PINK-PARTY-DRESS-HEAVEN-SENT|,|$URL$isobella-chloe-little-girls-pink-party-dress-heaven-sent.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-little-girls-pink-party-dress-heaven-sent-1.jpg||-||Isobella and Chloe Little Girls Pink Sleeveless Pant Set|,|^|Pink rosettes grace the bodice of this beautiful set from Isobella and Chloe. Rows of ruffles adorn the waist at the front and back. Tiers of ruffle flow down from the waistline to create a beautiful look. A keyhole opening and a tie are features of the back. The pants are in matching pink. Cotton blend. Hand wash, line dry. SIZE 12MOS ONLY REMAINING. ^||,|$23.00$|,||,|ISOBELLA-CHLOE-LITTLE-GIRLS-PINK-SLEEVELESS-PANT-SET|,|$URL$isobella-chloe-little-girls-pink-sleeveless-pant-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-little-girls-pink-sleeveless-pant-set-15.jpg||-||Isobella and Chloe Little Girls Red Pant Set with Flower|,|^|Isobella & Chloe has created this new ""Dallas Doll"" tunic and pant set for your little girl's fall and winter closet. The true red is a great color for the season while the long sleeves keep her arms safe from the chilly air. A whimsical flower is found upon the front of the top with a stem that goes to the waistline and finishes with a bow. The tunic is finished with alternating layers of sheer ruffles in white and red. Matching solid leggings are found beneath. Cotton/Spandex Blend. Hand Wash in Cold Water. Hang to Dry. ^||,|$46.00$|,||,|ISOBELLA-AND-CHLOE-LITTLE-GIRLS-RED-PANT-SET-FLOWER|,|$URL$isobella-and-chloe-little-girls-red-pant-set-flower.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-little-girls-red-pant-set-with-flower-1.jpg||-||Isobella and Chloe Long Sleeve Girls Dress Holland Gray Dots|,|Sure to be her favorite school day dress, this new grey dress comes from designer Isobella and Chloe. The empire bodice boasts of a faux layered look as a zipper runs up the back. The shape opens in the skirt offering plenty of extra fabric to twirl and sway with her movement. The hemline is layered with multiple fabrics in ruffled tiers while lacey ivory flowers sit just above. The small dot print comes from the mesh overlay that covers the majority of the dress. Made with cotton blend. Line dry and hand wash. |,|$39.00$|,||,|ISOBELLA-CHLOE-LONG-SLEEVE-GIRLS-DRESS-HOLLAND-GRAY-DOTS|,|$URL$isobella-chloe-long-sleeve-girls-dress-holland-gray-dots.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-long-sleeve-girls-dress-holland-gray-dots-2.jpg||-||Isobella and Chloe Long Sleeve Girls Dress in Sammy|,|^|New from Isobella and Chloe, this casual dress matches her sister's new outfit. The fitted bodice is in a heather grey and offers long sleeves for warmth. The wide neckline is decorated by cute rosettes. The layered skirt is ruffled in diagonal stripes. Dress: 100% rayon. Ruffle: 50/50 viscose/acrylic. Hand wash cold, line dry. SIZE 2T AND 5 REMAINING. ^||,|$24.00$|,||,|ISOBELLA-CHLOE-LONG-SLEEVE-GIRLS-DRESS-SAMMY|,|$URL$isobella-chloe-long-sleeve-girls-dress-sammy.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-long-sleeve-girls-dress-in-sammy-2.jpg||-||Isobella and Chloe Misty Heather Girls Dress|,|^|A new arrival from the fabulous Isobella and Chloe, this new girls dress is sure to fill her summer days with fun. The bodice of the dress boasts of an oversized fabric bow that is skewed and off set to one side. The sleeveless neckline is layered with the stripes. The skirt falls in a handkerchief hemline that is sure to delight your darling daughter. The extra fabric of the skirt encourages her playful twirls and hops as the fabric sways gracefully around her energetic legs. SIZE 4 AND 5 ONLY REMAINING.  ^||,|$36.00$|,||,|ISOBELLA-CHLOE-MISTY-HEATHER-GIRLS-DRESS|,|$URL$isobella-chloe-misty-heather-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-misty-heather-girls-dress-1.jpg||-||Isobella and Chloe Neverland Cap Sleeve Ruffle Dress in Black|,|A fancy new design from loved Isobella and Chloe, this little girls dress is sure to welcome many compliments this coming holiday season. The empire bodice offers a wide square neckline and cute ruffled cap sleeves. Two quaint flowers are found on her waist while gradient shades of tulle tier down the skirt. Touches of sparkles and matching flowers fall down the ruffled waves. Pairs perfectly with her sisters Black Sleeveless Neverland Dress for Girls for unforgetable family photos and celebrations. Made with 100% polyester, hand wash this dress and line dry. |,|$24.00$|,||,|ISOBELLA-CHLOE-NEVERLAND-CAP-SLEEVE-RUFFLE-DRESS-BLACK|,|$URL$isobella-chloe-neverland-cap-sleeve-ruffle-dress-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-neverland-cap-sleeve-ruffle-dress-in-black-2.jpg||-||Isobella and Chloe One Piece Girls Swimsuit|,|^|Matching her sister's suit, this fabulous one piece comes from Isobella and Chloe. The top offers her a halter neckline with a ""v"" shape. A touch of gathered ruffles compliment the shape of the neck and add a special small touch. A skirt wraps around the bottom and boasts of its quaint rows of ruffles. Two flowers are layered with tulle and finished with a beaded center. Made with nylon blend. Hand wash cold, line dry. SIZE 2T ONLY AVAILABLE.  ^||,|$36.00$|,||,|ISOBELLA-CHLOE-ONE-PIECE-GIRLS-SWIMSUIT|,|$URL$isobella-chloe-one-piece-girls-swimsuit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-one-piece-girls-swimsuit-1.jpg||-||Isobella and Chloe One Piece Girls Swimsuit Frilly Fun|,|^|From the ""Frilly Fun"" collection by designer Isobella and Chloe, this new one piece swimsuit has arrived just in time for the warm, sunny day fun. The suit is created with a light shade that is airy and free spirited. The straight neckline is accented with a row of matching sheer flowers that are layered in different shades and finished with a gem center. The swimsuit boasts of a faux skirt that fades from light to dark pink in a true ombre fashion. Made with nylon blend. Hand wash cold, line dry. ^||,|$36.00$|,||,|ISOBELLA-CHLOE-ONE-PIECE-GIRLS-SWIMSUIT-FRILLY-FUN|,|$URL$isobella-chloe-one-piece-girls-swimsuit-frilly-fun.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-one-piece-girls-swimsuit-frilly-fun-1.jpg||-||Isobella and Chloe Pant Set for Girls in Hawaiian Plumeria|,|A beautiful design, this new girls tunic set is from Isobella and Chloe. The tunic features long sleeves and an empire waist. Slight pleating falls from the neckline and a button closes the keyhole on the back. The skirt falls in fun tiers in rich magenta. Alternating fabric ruffles accent the draping style. Matching pants are worn beneath with the same ruffles on the hem. Cotton/Spandex Blend. Hand Wash in Cold Water. Hang to Dry. |,|$42.00$|,||,|ISOBELLA-AND-CHLOE-PANT-SET-GIRLS-HAWAIIAN-PLUMERIA|,|$URL$isobella-and-chloe-pant-set-girls-hawaiian-plumeria.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-pant-set-for-girls-in-hawaiian-plumeria-1.jpg||-||Isobella and Chloe Peach and Cream Soft Headband|,|^|Created to match the ""Isobella and Chloe Fancy Little Girls Outfit"", this new designer accessory from Isobella and Chloe completes the darling look. The stretch headband is made with the same coral peach shade that is sure to take the summer by storm while it stretches to comfortably fit her head. The decoration is a flower made with several layers in ivory and coral peach tulle. A trio of gems is found at the center. ^||,|$9.00$|,||,|ISOBELLA-CHLOE-PEACH-CREAM-SOFT-HEADBAND|,|$URL$isobella-chloe-peach-cream-soft-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-peach-and-cream-soft-headband-1.jpg||-||Isobella and Chloe Pearl Faux Fur Vest for Girls|,|^|A fancy vest for her designer style, Isobella and Chloe has made this an irresistible look. The sleeveless vest offers a ribbon that ties the front closed and a cute V neckline. The soft textured fabric is a classic ivory. To finish off this look, a wide ruffle hem falls beneath the waist. 100% polyester. Hand wash cold, line dry. SIZE 4 ONLY REMAINING. ^||,|$29.00$|,||,|ISOBELLA-CHLOE-PEARL-FAUX-FUR-SHRUG-GIRLS|,|$URL$isobella-chloe-pearl-faux-fur-shrug-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-pearl-faux-fur-vest-for-girls-2.jpg||-||Isobella and Chloe Pink Princess Pant Set with Rose|,|For your girly girl, this new pink tunic and pant is from Isobella and Chloe. The pale pink top offers long sleeves, a wide neckline, and pleating that falls from the neck. A keyhole is also found on the back while an oversized sheer flower sits on the front. The tutu inspired skirt with two different types of ruffled layers that create a dreamy effect! Solid candy pink leggings are worn beneath to finish the look. Cotton/Spandex Blend. Hand Wash in Cold Water. Hang to Dry. |,|$42.00$|,||,|ISOBELLA-AND-CHLOE-PINK-PRICESS-PANT-SET-ROSE|,|$URL$isobella-and-chloe-pink-pricess-pant-set-rose.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-pink-pricess-pant-set-with-rose-1.jpg||-||Isobella and Chloe Plum Passion Bikini in Lilac|,|^|Darling as can be, this new bikini from Isobella and Chloe is part of the ""Plum Passion"" collection for spring and summer. The lilac top has a straight shape and a faux flower layered with tulle off centered. A ruffled effect is made with gathers that are framed with a touch of tulle. The bottoms that accompany in this set are skirted and adorned with the same bloom. the different shades of tulle blend together in the small ruffles. Made with nylon blend. Hand wash cold, line dry. 12 MOS ONLY LEFT.  ^||,|$34.00$|,||,|ISOBELLA-CHLOE-PLUM-PASSION-BIKINI-LILAC|,|$URL$isobella-chloe-plum-passion-bikini-lilac.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-plum-passion-bikini-in-lilac-1.jpg||-||Isobella and Chloe Polka Dot Ruffle Pant Set|,|An eye-catching design perfect for the start of school, this new little girls tunic and pant is from designer Isobella and Chloe. A scoop neckline styles the bodice along with a keyhole on the back. Long sleeves offer a touch of warmth while a ruffle sits upon the waistline. A Flower accent is also found on her waist with a round center. The hanky style of the skirt is finished with a ruffle while matching pants are worn beneath. Polyester Blend. Hand Wash in Cold Water. Hang to Dry. |,|$46.00$|,||,|ISOBELLA-AND-CHLOE-POLKA-DOT-RUFFLE-PANT-SET|,|$URL$isobella-and-chloe-polka-dot-ruffle-pant-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-polka-dot-ruffle-pant-set-1.jpg||-||Isobella and Chloe Princess Pink Girls Birthday Dress|,|^|Created straight from her dreams, this new birthday dress from Isobella and Chloe cannot be forgotten. The beautiful dress offers a sparkling pink bodice with cap sleeves, a hidden zipper, and a sweet bow on the waist. The skirt falls down from her empire waistline and opens up for a wide shape. In a true princess shade, she will surely love this gown! Made with a polyester blend. Dry clean only. SIZE 12 MONTH AND 2T AVAILABLE. ^||,|$19.00$|,||,|ISOBELLA-CHLOE-PRINCESS-PINK-GIRLS-BIRTHDAY-DRESS|,|$URL$isobella-chloe-princess-pink-girls-birthday-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-princess-pink-girls-birthday-dress-20.jpg||-||Isobella and Chloe Purple Opal Cap Sleeve Dress for Girls|,|^|No matter what the event, this darling new girls dress comes from designer Isobella and Chloe. The cap sleeve bodice shimmers in purple and boasts of cap sleeves and a hidden zipper. An empire waistline is adorned by a sweet flower. The skirt is layered with coordinating tones of purple that create a brilliant look. This dress will make a great unique look for birthday or holiday celebrations! 100% polyester. Dry clean only. SIZE 12 MOS ONLY LEFT.  ^||,|$24.00$|,||,|ISOBELLA-CHLOE-PURPLE-OPAL-CAP-SLEEVE-DRESS-GIRLS|,|$URL$isobella-chloe-purple-opal-cap-sleeve-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-purple-opal-cap-sleeve-dress-for-girls-2.jpg||-||Isobella and Chloe Raspberry Girls Summer Dress|,|^|This new girls dress from designer Isobella and Chloe is a part of their ""Sweet Caroline"" collection. The piece offers her a sleeveless neckline that is trimmed with quaint ribbons of ruffled fabric while three flowers sit upon a sheer bed under the right shoulder. The tie dye pattern is a rosy pink. The skirt is started with the sheer flower lace ruffled around and followed with several tiers. The pink and white tulle blend together beautifully and finished in a volume hemline that sways around her legs elegantly. ^||,|$29.00$|,||,|ISOBELLA-CHLOE-RASPBERRY-GIRLS-SUMMER-DRESS|,|$URL$isobella-chloe-raspberry-girls-summer-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-raspberry-girls-summer-dress-1.jpg||-||Isobella and Chloe Red and White Girls Dress|,|A beautiful summer dress, this new Isobella and Chloe creation is sure to welcome as many sunrays as can shine! The bodice of the dress is cut for a fitted look on top and is made in white. Three red stripes run down the front to the drop waistline. The unique shoulder straps are also made in red while three rosettes fall from the left. The skirt opens to a full circle shape and features two gathered pockets decorated each with a single bow. The hemline of the dress is created with fun red ruffles. |,|$34.00$|,||,|ISOBELLA-CHLOE-RED-WHITE-GIRLS-DRESS|,|$URL$isobella-chloe-red-white-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-red-and-white-girls-dress-1.jpg||-||Isobella and Chloe Red Christmas Dress for Girls|,|A baby girls dress that is gorgeous, this new design from Isobella and Chloe is a classical style that is loved by all. The dress features a hidden zipper and a ruffle wave accenting the waist. Puffy cap sleeves frame the neckline and a flower sits off centered. The skirt has an elegant, structured shape that is perfect for Christmas photos and celebrations! Polyester/Spandex Blend. Dry Clean Only. |,|$49.00$|,||,|ISOBELLA-AND-CHLOE-RED-CHRISTMAS-DRESS-GIRLS|,|$URL$isobella-and-chloe-red-christmas-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-red-christmas-dress-for-girls-1.jpg||-||Isobella and Chloe Red Star Flower Headband|,|A fun creation that suits her summer style, this red star flower headband is from Isobella and Chloe. The headband itself is covered with classic red fabric. The flowers are in red and white with rounded centers. Beads of black and white give the flowers a star quality. |,|$8.00$|,||,|ISOBELLA-CHLOE-RED-STAR-FLOWER-HEADBAND|,|$URL$isobella-chloe-red-star-flower-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-red-star-flower-headband-11.jpg||-||Isobella and Chloe Rosette Headband in Black|,|^|Created as the perfect match to ""Isobella & Chloe Little Girls Dress"" in black gingham, this sweet headband is a must have! The wrapped headband is thin and dainty as it sits easily upon her head. The oversized black gingham rosette sits off center while a few touches of tulle add the perfect level of texture. ^||,|$9.00$|,||,|ISOBELLA-CHLOE-ROSETTE-HEADBAND-BLACK|,|$URL$isobella-chloe-rosette-headband-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-rosette-headband-in-black-1.jpg||-||Isobella and Chloe Ruffled Top and Legging in Aspen Leopard|,|^|A wild design that shows off her personality and style, this tunic set comes from Isobella and Chloe. The white snow leopard print covers the entire piece and the long sleeves are finished with black cuffs. A cute flower sits just above the hem. Layers of uneven ruffles and contrasting textures wrap around the bottom of this tunic. Stretch fit solid black leggings are paired beneath. Made with a polyester blend. Hand wash cold, line dry. (1) 6 MONTH ONLY REMAIING. ^||,|$24.00$|,||,|ISOBELLA-CHLOE-RUFFLED-TOP-LEGGING-ASPEN-LEOPARD|,|$URL$isobella-chloe-ruffled-top-legging-aspen-leopard.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-ruffled-top-and-legging-in-aspen-leopard-2.jpg||-||Isobella and Chloe Sammy Stripe Little Girls Tunic and Legging|,|A sweet design from Isobella and Chloe, this new piece fits her every day style. The long sleeve tunic boasts of a rosette adorned neckline and cozy long sleeves. A single button keyhole back closes the neckline while ruffle layers finish the hemline. The solid grey leggings are worn beneath and have a classic stretch to their fitted look. The pleats hidden at the neck open up the fit of the top. Top: 50/50 viscose/acrylic. Pant: 100% rayon. Hand wash cold, line dry. |,|$24.00$|,||,|ISOBELLA-CHLOE-SAMMY-STRIPE-LITTLE-GIRLS-TUNIC-LEGGING|,|$URL$isobella-chloe-sammy-stripe-little-girls-tunic-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-sammy-stripe-little-girls-tunic-and-legging-2.jpg||-||Isobella and Chloe Silver Holiday Dress for Girls in Hope|,|^|This holiday dress by Isobella and Chloe will be the perfect party dress for all of your holiday functions this season! Your little girl will look like a princess in this adorable silver gown. The cap sleeve bodice is covered with a floral texture as a hidden zipper closes the back. The solid silver ribbon empire waist band with a bow separates the bodice from the elegantly layered ruffle skirt. With a wide variety of sizes available, two sisters can share this adorable look for the holidays! Dry clean only. SIZE 9 MONTH, 6 AND 6X REMAINING. ^||,|$29.00$|,||,|ISOBELLA-CHLOE-SILVER-HOLIDAY-DRESS-GIRLS-HOPE|,|$URL$isobella-chloe-silver-holiday-dress-girls-hope.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-silver-holiday-dress-for-girls-in-hope-2.jpg||-||Isobella and Chloe Sleeveless Drop Waist Dress for Girls|,|^|New from designer Isobella and Chloe, this fabulous girls dress is a part of their fall and winter 2013 collection. ""Karen"" is made from both rich color and rich fabric, making this a fall must have! The drop waist bodice is structured for a great fitted style and boasts of its textured tweed-like fabric. A bow sits upon the waist while the skirt flairs out a bit with its dark brown taffeta. A dress is fully lined and closed by a zipper that runs up the back. Dry clean recommended to keep this dress looking its best. 100% polyester. ^||,|$32.00$|,||,|ISOBELLA-CHLOE-SLEEVELESS-DROPWAIST-DRESS-GIRLS|,|$URL$isobella-chloe-sleeveless-dropwaist-dress-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-sleeveless-drop-waist-dress-for-girls-3.jpg||-||Isobella and Chloe Special Occasion Girls Dress|,|A colorful creation, this new little girls dress comes from the creative Isobella and Chloe brand. The drop waist bodice is cut for a fitted look. The back is fastened with a single button keyhole while three stripes run across in pink, blue, and green. The large, oversized flower is layered in pinks with a sparkling blue center. The tutu inspired skirt fills this dress with so much fun. The tulle ruffles have a great volume and are layered to fade from a pink, to mint, to blue. |,|$29.00$|,||,|ISOBELLA-CHLOE-SPECIAL-OCCASION-GIRLS-DRESS|,|$URL$isobella-chloe-special-occasion-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-special-occasion-girls-dress-1.jpg||-||Isobella and Chloe Sunday Picnic Black and White Dress|,|^|Created in a unique style, this designer girls dress is newly available from Isobella and Chloe. The sweet dress is perfect for just about any celebration that she might have this summer. The bodice has an empire waist and is wrapped with ruffles. The V shaped neckline is created with a double ruffle and finds a small privacy panel in the front. The back is closed with a hidden zipper while a bow is tied for her own fit. The skirt opens in shape and is covered with the sheer overlay textured with dots. The white hemline accents the grey and is ruffled to match the bodice. SIZE 4 AND 6X ONLY LEFT.  ^||,|$39.00$|,||,|ISOBELLA-CHLOE-SUNDAY-PICNIC-BLACK-WHITE-DRESS|,|$URL$isobella-chloe-sunday-picnic-black-white-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-sunday-picnic-black-and-white-dress-1.jpg||-||Isobella and Chloe Surfin Safari One Piece Swimsuit|,|^|Matching several new pieces in the ""Surfin' Safari"" collection, this one piece swimsuit is sure to be a best seller. The bodice features a V neckline covered with small, quaint ruffles. The halter strap is tied in a knot behind her neck while a large pink flower sits upon the front. The bold animal print covers the rest of the swimsuit while finished with a draw string bow on both hips. This bow allows her to slightly cinch the style if desired. Made with nylon blend. Hand wash cold, line dry. ^||,|$36.00$|,||,|ISOBELLA-CHLOE-SURFIN-SAFARI-ONE-PIECE-SWIMSUIT|,|$URL$isobella-chloe-surfin-safari-one-piece-swimsuit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-surfin-safari-one-piece-swimsuit-1.jpg||-||Isobella and Chloe Tammy Pink Bow Headband|,|Sweet in pink, this girls hair bow comes from Isobella and Chloe. The hard headband is then and covered with matching fabric. The looped bow is made with a center of white that compliments the light rose pink. This hair accessory matches Isobella and Chloe's Pink Tammy dress. |,|$7.00$|,||,|ISOBELLA-CHLOE-TAMMY-PINK-BOW-HEADBAND|,|$URL$isobella-chloe-tammy-pink-bow-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-tammy-pink-bow-headband-3.jpg||-||Isobella and Chloe Tulle Soft Band in Magenta|,|^|A soft fabulous headband, this Isobella and Chloe accessory matches the ""Bon Voyage"" collection. The band stretches to fit around her head while the magenta tulle flowers are lined up and finished with sparkling centers. Set the flowers off center by a touch to make a polished look for any event or photos! ^||,|$9.00$|,||,|ISOBELLA-CHLOE-TULLE-SOFT-BAND-MAGENTA|,|$URL$isobella-chloe-tulle-soft-band-magenta.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-tulle-soft-band-in-magenta-1.jpg||-||Isobella and Chloe Tutti Frutti Girls Party Dress|,|^|This gorgeous new girls dress comes from Isobella and Chloe as a part of their ""Tutti Frutti"" collection. The bodice is fastened with a hidden zipper in the back and styled with a sleeveless neckline. A small touch of color is found in the trio of stripes that run horizontal. The tulle skirt is a sweet dream like confectioner's sugar as it falls down in lovely tiers. The skirt is introduce with an oversized flower that is layered in pink. The same pink is found on the top layer of the skirt while blending to mint green and a cool blue. ^||,|$29.00$|,||,|ISOBELLA-CHLOE-TUTTI-FRUTTI-GIRLS-PARTY-DRESS|,|$URL$isobella-chloe-tutti-frutti-girls-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-tutti-frutti-girls-party-dress-1.jpg||-||Isobella and Chloe Tutti Frutti Headband|,|^|Matching the new fabulous dresses from the ""Tutti Frutti"" collection, this designer girls headband is created by Isobella and Chloe. The thin headband is wrapped in pink and placed easily on her head. A single decoration sits off to one side colored in pink tulle. The large size of the flower adds to its cuteness while a touch of sparkle is found in the blue gem center. ^||,|$9.00$|,||,|ISOBELLA-CHLOE-TUTTI-FRUTTI-HEADBAND|,|$URL$isobella-chloe-tutti-frutti-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-tutti-frutti-headband-1.jpg||-||Isobella and Chloe Tutu Capri Outfit|,|^|A fun magenta blend, this new designer girls outfit from Isobella and Chloe is a set that is easy to fall in love with. The dreamy light straps frame the neckline that is accented with a group of layered flowers that sit on the front. The top is covered with a tulle overlay that allows the lining beneath to peak through. Countless tiers of ruffles frost the hemline gracefully. The matching pants are paired beneath and finished with ruffles to match! This little girls set is from the ""Bon Voyage"" collection. ^||,|$29.00$|,||,|ISOBELLA-CHLOE-TUTU-CAPRI-OUTFIT|,|$URL$isobella-chloe-tutu-capri-outfit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-tutu-capri-outfit-1.jpg||-||Isobella and Chloe Two Piece Swimsuit for Girls|,|^|A new creation from designer Isobella and Chloe, this little girls tankini is sure to make a splash! The fitted top features a straight, strappy neckline accented with a color block of black and white. The tulle flower is perched off to the right side while a pair of matching blooms are found just above the ruffled hemline. A solid pair of black bottoms are worn beneath the top. If you are looking for matching pieces, check out the other classic black and white pieces from the ""Sparkling Tide"" collection. SIZE 4 ONLY LEFT.  ^||,|$36.00$|,||,|ISOBELLA-CHLOE-TWO-PIECE-SWIMSUIT-GIRLS|,|$URL$isobella-chloe-two-piece-swimsuit-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-two-piece-swimsuit-for-girls-1.jpg||-||Isobella and Chloe Two Piece Swimsuit Girls Tankini|,|A darling new swimsuit, this girls tankini comes from Isobella and Chloe. The top features a trio of flowers at the neckline with a touch of sparkle at the center. The tiers of sheer ruffles create an ombre effect, fading from light to dark. Solid light colored bottoms are worn beneath as the perfect match. The great thing about Isobella and Chloe swimwear is that you can be certain to find great quality and style in every piece! Made with nylon blend. Hand wash cold, line dry. |,|$34.00$|,||,|ISOBELLA-CHLOE-TWO-PIECE-SWIMSUIT-GIRLS-TANKINI|,|$URL$isobella-chloe-two-piece-swimsuit-girls-tankini.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-two-piece-swimsuit-girls-tankini-12.jpg||-||Isobella and Chloe Velour Girls Fancy Coat in Black|,|A design that is sure to add a chic style to her beautiful dresses, this fancy girls coat comes from Isobella and Chloe. The black velour look is warm and soft and is dressed up with a ruffled collar. The ruffles fall down the front and wrap around the hem. Sparkling buttons close up the front and two pockets sit just above the hem. Made with a polyester blend. Hand wash cold, line dry. |,|$24.00$|,||,|ISOBELLA-CHLOE-VELOUR-GIRLS-FANCY-COAT-BLACK|,|$URL$isobella-chloe-velour-girls-fancy-coat-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-velour-girls-fancy-coat-in-black-39.jpg||-||Isobella and Chloe White Chiffon Girls Headband|,|The glorious chiffon rosette sits on the thin girls headband with a jeweled center for alittle shine. The headband pairs well with the Isobella and Chloe Flowers Girls Dress in White Ruffles. Perfect for a summer beach photo too. |,|$9.00$|,||,|ISOBELLA-AND-CHLOE-WHITE-CHIFFON-GIRLS-HEADBAND|,|$URL$isobella-and-chloe-white-chiffon-girls-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-white-chiffon-girls-headband-1.jpg||-||Isobella and Chloe White Dress with Sequins Enchanted|,|A truly enchanted design, this girls summer dress is from the well loved brand Isobella and Chloe. The empire bodice is covered with a sheer overlay that is dressed in dazzling sequins. A layered flower is placed at her waistline while a thin tie becomes a bow on her back. The tiered skirt blends the solid white and the glittering sheer ruffles brilliantly! This designer girls dress is perfect for weddings, recitals, birthdays, and summer parties! |,|$29.00$|,||,|ISOBELLA-CHLOE-WHITE-DRESS-SEQUINS-ENCHANTED|,|$URL$isobella-chloe-white-dress-sequins-enchanted.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-white-dress-with-sequins-enchanted-1.jpg||-||Isobella and Chloe Wild Snow Leopard Girls Dress|,|Adding sassy spice to her fall and winter wardrobe, this new designer girls dress comes from Isobella and Chloe. Made with quality fabric, this drop waist dress boasts of its wild Aspen leopard spots, which cover the entire bodice. The long sleeves help to fend off the cold while a zipper runs up the back to secure her fit. The bodice is fully lined in black. The skirt is made by fanciful tiers that receive a splash of the animal print, black tulle, and white tulle. A large ruffle flower is off centered at the waist. Polyester blend, hand wash this dress and line dry. |,|$29.00$|,||,|ISOBELLA-CHLOE-WILD-SNOW-LEOPARD-GIRLS-DRESS|,|$URL$isobella-chloe-wild-snow-leopard-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-wild-snow-leopard-girls-dress-3.jpg||-||Isobella and Chloe Winter Ruffle Coat for Girls in Gray and Pink|,|A sugary sweet design, this Isobella & Chloe winter coat for girls will become her favorite coat for the season. The soft grey is covered in a pink print that accents the faux fur found on the cuffs and collar. The pink faux fur features subtle spots. Three ruffles dance around the hemline while the large buttons close the front. 100% Polyester. Hand Wash in Cold Water. Hang to Dry. |,|$58.00$|,||,|ISOBELLA-CHLOE-WINTER-RUFFLE-COAT-GIRLS-GRAY-PINK|,|$URL$isobella-chloe-winter-ruffle-coat-girls-gray-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-winter-ruffle-coat-for-girls-in-gray-and-pink-1.jpg||-||Isobella and Chloe Yellow Two Piece Swimsuit for Girls|,|^|A sweet touch of sunshine, the new ""Lemon Drop"" collection by designer Isobella and Chloe is perfect for this coming spring and summer. The yellow swimsuit features thin straps and a large fabric flower found adorning the base of her right shoulder. The top is finished with sugary sweet ruffles in a wave. Two more flowers are on the hemline. Hidden beneath are solid bottoms in the same light yellow. Made with nylon blend. Hand wash cold, line dry. SIZE 6MOS, 6 AND 6X REMAINING. ^||,|$34.00$|,||,|ISOBELLA-CHLOE-YELLOW-TWO-PIECE-SWIMSUIT-GIRLS|,|$URL$isobella-chloe-yellow-two-piece-swimsuit-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/isobella-and-chloe-yellow-two-piece-swimsuit-for-girls-12.jpg||-||Jak & Peppar Fray For You Tween Button Down Top PREORDER|,|^|Designed by Jak & Peppar, this button down top is created for layering with her new free spirited outfits. The olive green that covers this top is an earthy tone that compliments nearly every new piece in their debut collection. The front is dressed with a touch of red stripes that are thin to resemble the railroad inspiration. A collar and a touch of frayed edges on her shoulders complete this look. A row of buttons sits upon the front while the back is opened with a touch of pleating. Please note that this Jak and Peppar item is a PreOrder and is NOT currently in stock. This item is expected to arrive between August 13, 2014 and September 15, 2014. For more information on our PreOrder policies, please visit our PreOrder page. ^||,|$49.00$|,||,|JAK-PEPPAR-FRAY-YOU-TWEEN-BUTTON-DOWN-TOP|,|$URL$jak-peppar-fray-you-tween-button-down-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-peppar-fray-for-you-tween-button-down-top-preorder-1.jpg||-||Jak & Peppar Gertrude Head Wrap for Tweens in Vanilla PREORDER|,|^|An accessory designed to go with many of the new arrivals, this fabulous creation from designer Jak and Peppar will finish her outfit off on the right note. The ivory headband features a flower print with a touch of yellow. A small twist styles the front. The headband stretches with a touch of elastic that is found at the back. Please note that this Jak and Peppar item is a PreOrder and is NOT currently in stock. This item is expected to arrive between August 13, 2014 and September 15, 2014. For more information on our PreOrder policies, please visit our PreOrder page. SEE INSET IMAGE FOR CORRECT HEADBAND COLOR. THE HEADBAND HAS AN IVORY BASE COLOR NOT THE OLIVE AS MODELED ^||,|$24.00$|,||,|JAK-PEPPAR-GERTRUDE-HEAD-WRAP-TWEENS-VANILLA|,|$URL$jak-peppar-gertrude-head-wrap-tweens-vanilla.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-peppar-gertrude-head-wrap-for-tweens-in-vanilla-preorder-1.jpg||-||Jak & Peppar Girls Infinity Scarf in Burnt Red PREORDER|,|^|An accessory she will love, this new infinity scarf for tweens is from Jak and Peppar. The scarf boasts of its rich red and ivory colors that is produced by the tie dye effect. The fabric is comfortable and has a fun texture. This red compliments most any new arrival from the Jak and Peppar fall collection. Please note that this Jak and Peppar item is a PreOrder and is NOT currently in stock. This item is expected to arrive between August 13, 2014 and September 15, 2014. For more information on our PreOrder policies, please visit our PreOrder page. ^||,|$38.00$|,||,|JAK-PEPPAR-GIRLS-INFINITY-SCARF-BURNT-RED|,|$URL$jak-peppar-girls-infinity-scarf-burnt-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-peppar-girls-infinity-scarf-in-burnt-red-preorder-1.jpg||-||Jak & Peppar Head Wrap for Tweens in Ivory PREORDER|,|^|A gorgeous accessory, this new headband from Jak and Peppar matches perfectly to many of the new arrivals in their debut collection. The headband is a waving shape and boasts of the bead and sequin accents that run across the front. The back of the headband stretches for a custom and comfortable fit. Please note that this Jak and Peppar item is a PreOrder and is NOT currently in stock. This item is expected to arrive between August 13, 2014 and September 15, 2014. For more information on our PreOrder policies, please visit our PreOrder page. ^||,|$26.00$|,||,|JAK-PEPPAR-HEAD-WRAP-TWEENS-IVORY|,|$URL$jak-peppar-head-wrap-tweens-ivory.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-peppar-head-wrap-for-tweens-in-ivory-preorder-1.jpg||-||Jak & Peppar Hi Low Tunic for Girls Joplin Red PREORDER|,|^|An inspired design, this new tween trendy top comes from Jak and Peppar, a new brand just released for Fall 2014 from the creators of Mustard Pie. The top has a rich texture from the raw fiber fabric. The vanilla color is a cool blend with the rustic colors that dress the unique pattern on the front. This sleeveless top is perfect to layer with any of the new jackets from Jak & Peppar. Please note that this Jak and Peppar item is a PreOrder and is NOT currently in stock. This item is expected to arrive between August 13, 2014 and September 15, 2014. For more information on our PreOrder policies, please visit our PreOrder page. ^||,|$49.00$|,||,|JAK-PEPPAR-HI-LOW-TUNIC-GIRLS-JOPLIN-RED|,|$URL$jak-peppar-hi-low-tunic-girls-joplin-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-peppar-hi-low-tunic-for-girls-joplin-red-preorder-1.jpg||-||Jak & Peppar Red Hudson Tween Dress PREORDER|,|^|A lovely creation for tween girls, this new dress comes from Jak & Peppar. The Dress features a blouson bodice created by the stretch waist. Long sleeves offer warmth while the red fabric is dressed with a flower pattern. The skirt is finished with a straight hem. Please note that this Jak and Peppar item is a PreOrder and is NOT currently in stock. This item is expected to arrive between August 13, 2014 and September 15, 2014. For more information on our PreOrder policies, please visit our PreOrder page. ^||,|$58.00$|,||,|JAK-PEPPAR-RED-HUDSON-TWEEN-DRESS|,|$URL$jak-peppar-red-hudson-tween-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-peppar-red-hudson-tween-dress-preorder-1.jpg||-||Jak & Peppar Tween Dress Field of My Dreams PREORDER|,|^|For your free spirited tween, this new Jak and Peppar dress is a gorgeous arrival. This brand is filled with styles that blend a trendy, earthy tone with a truly feminine look. The black dress offers her a casual fit bodice with long sleeves. Touches of mustard, red, and olive create the embroidered pattern that we find running down her long sleeves and down the center of the bodice. The straight skirt is easy to pair with leggings if desired. Please note that this Jak and Peppar item is a PreOrder and is NOT currently in stock. This item is expected to arrive between August 13, 2014 and September 15, 2014. For more information on our PreOrder policies, please visit our PreOrder page. ^||,|$69.00$|,||,|JAK-PEPPAR-TWEEN-DRESS-FIELD-OF-MY-DREAMS|,|$URL$jak-peppar-tween-dress-field-of-my-dreams.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-peppar-tween-dress-field-of-my-dreams-preorder-1.jpg||-||Jak & Peppar Tween Fur Vest with Plaid Lining PREORDER|,|^|From Jak and Peppar, this new tween vest is a fabulous layer to add to her new tunics and dresses from their debut fall collection. The vest is covered with a rustic faux fur. The cropped shape is complimentary and looks beautiful with many different styles. A touch of faux fur is the perfect way to complete an outfit during the fall and winter season and this vest is sure to be a hit! The vest is lined in plaid. Please note that this Jak and Peppar item is a PreOrder and is NOT currently in stock. This item is expected to arrive between August 13, 2014 and September 15, 2014. For more information on our PreOrder policies, please visit our PreOrder page. ^||,|$49.00$|,||,|JAK-PEPPAR-TWEEN-FUR-VEST-PLAID-LINING|,|$URL$jak-peppar-tween-fur-vest-plaid-lining.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-peppar-tween-fur-vest-with-plaid-lining-preorder-1.jpg||-||Jak & Peppar Tween Girl Leggings in Olive PREORDER|,|^|Layering beneath the new dresses and tunics, these Jak and Peppar leggings are a must have item for the fall and winter season! The soft olive green is a unique shade that matches many of the fabrics found within the collection. A touch of stitching creates X's down the outer side of both legs. The stretch fit is comfortable and easy to pair with boots! Please note that this Jak and Peppar item is a PreOrder and is NOT currently in stock. This item is expected to arrive between August 13, 2014 and September 15, 2014. For more information on our PreOrder policies, please visit our PreOrder page. ^||,|$38.00$|,||,|JAK-PEPPAR-TWEEN-GIRL-LEGGINGS-OLIVE|,|$URL$jak-peppar-tween-girl-leggings-olive.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-peppar-tween-girl-leggings-in-olive-preorder-1.jpg||-||Jak & Peppar Tween Gyspy Tunic in Red PREORDER|,|^|From Jak & Peppar, this new tween top is sure to be one of her favorites to wear this season. The top features a fun floral print on the top and an empire waist created with a touch of lace. A small frame of pleats is found next to the buttons that run down the center of the shirt. The long sleeves are a thin red stripe. Roll up the sleeves and secure them with strip of fabric and a button. Please note that this Jak and Peppar item is a PreOrder and is NOT currently in stock. This item is expected to arrive between August 13, 2014 and September 15, 2014. For more information on our PreOrder policies, please visit our PreOrder page. ^||,|$38.00$|,||,|JAK-PEPPAR-TWEEN-GYSPY-TUNIC-RED|,|$URL$jak-peppar-tween-gyspy-tunic-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-peppar-tween-gyspy-tunic-in-red-preorder-1.jpg||-||Jak & Peppar Tween Jean Vest Dark Wash PREORDER|,|^|The Rock N Shop Vest from designer Jak and Peppar is a style that she will love to pair over all of the tunics and dresses from their fall collection. The wash of this tween jean jacket is a medium shade, offering a classic look. The front of the vest is closed with metal snaps. A cute collar is framed with the raw edges of the sleeveless cut off. A touch of ivory lace is found on the front pockets. A pleated ruffle accents the back hemline with shape. Please note that this Jak and Peppar item is a PreOrder and is NOT currently in stock. This item is expected to arrive between August 13, 2014 and September 15, 2014. For more information on our PreOrder policies, please visit our PreOrder page. ^||,|$66.00$|,||,|JAK-PEPPAR-TWEEN-JEAN-VEST-DARK-WASH|,|$URL$jak-peppar-tween-jean-vest-dark-wash.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-peppar-tween-jean-vest-dark-wash-preorder-1.jpg||-||Jak & Peppar Tween Skinny Jeans Dark Wash PREORDER|,|^|Jak and Peppar is a new brand just released this fall of 2014! These dark wash skinny jeans are a staple item that every tween wardrobe should old! The jeans are brilliant quality and are styled in the trendy skinny leg. Slight stretch is allowed by the fabric while there are two pockets on the front and the back. Belt loops wrap around her waist while a zipper and button secure the fit. These jeans will look great with any new top and are perfect for showing off her boots! Please note that this Jak and Peppar item is a PreOrder and is NOT currently in stock. This item is expected to arrive between August 13, 2014 and September 15, 2014. For more information on our PreOrder policies, please visit our PreOrder page. ^||,|$69.00$|,||,|JAK-PEPPAR-TWEEN-SKINNY-JEANS-DARK-WASH|,|$URL$jak-peppar-tween-skinny-jeans-dark-wash.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-peppar-tween-skinny-jeans-dark-wash-preorder-1.jpg||-||Jak & Peppar Tween Skinny Pants in Mustard Corduroy PREORDER|,|^|A new design that she will instantly adore, these fabulous mustard pants for tweens was created by Jak & Peppar, a new brand from the creators of Mustard Pie. The pants feature a trendy skinny leg and a bold shade of yellow that is sure to fill the season. Traditional back pockets are offered on these skinnies while the corduroy fabric is a warm texture that compliments the free spirit that fills their collection. Pair these skinnies with boots and any of the new tops for a one of a kind outfit. Please note that this Jak and Peppar item is a PreOrder and is NOT currently in stock. This item is expected to arrive between August 13, 2014 and September 15, 2014. For more information on our PreOrder policies, please visit our PreOrder page. ^||,|$66.00$|,||,|JAK-PEPPAR-TWEEN-SKINNY-PANTS-MUSTARD-CORDUROY|,|$URL$jak-peppar-tween-skinny-pants-mustard-corduroy.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-peppar-tween-skinny-pants-in-mustard-corduroy-preorder-1.jpg||-||Jak & Peppar Tween Tunic in Red Jezabel PREORDER|,|^|Looking fabulous with her new leggings or favorite jeans, this tunic for tween girls is a creation by the newly released Jak and Peppar line by the creators of Mustard Pie. The top is created in a layered look. The bottom layer offers her striped long sleeves and a comfortable, easy to wear fabric. A large applique sits upon the front and has false beaded straps that reach up to her shoulders. The tie dye fabric that falls beneath the flower is a blend of reds and earthy tones. Please note that this Jak and Peppar item is a PreOrder and is NOT currently in stock. This item is expected to arrive between August 13, 2014 and September 15, 2014. For more information on our PreOrder policies, please visit our PreOrder page. ^||,|$64.00$|,||,|JAK-PEPPAR-TWEEN-TUNIC-RED-JEZABEL|,|$URL$jak-peppar-tween-tunic-red-jezabel.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-peppar-tween-tunic-in-red-jezabel-preorder-1.jpg||-||Jak & Peppar Yellow Leggings for Girls PREORDER|,|^|In bold mustard yellow, these Jak and Peppar leggings are sure to pull out that rich tone from many of the new arrivals in their debut collection. The fabric has slight stretch and is textured with touches of stitching the is found on the outer side of both legs. Pair these leggings beneath her dresses and tunics and for a complete outfit, don't forget her fall boots! Please note that this Jak and Peppar item is a PreOrder and is NOT currently in stock. This item is expected to arrive between August 13, 2014 and September 15, 2014. For more information on our PreOrder policies, please visit our PreOrder page. ^||,|$38.00$|,||,|JAK-PEPPAR-YELLOW-LEGGINGS-GIRLS|,|$URL$jak-peppar-yellow-leggings-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-peppar-yellow-leggings-for-girls-preorder-1.jpg||-||Jak and Peppar Chloe Girls Peasant Top Black PREORDER|,|^|An honored part of their debut collection, this new Jak and Peppar top is a classic style. The black fabric is covered with a hippie inspired flower print that introduces small hints of colors found throughout the collection. The slit neckline is closed with two red ties. The peasant style offers a relaxed fit and long sleeves finished with a touch of elastic. Please note that this Jak and Peppar item is a PreOrder and is NOT currently in stock. This item is expected to arrive between August 13, 2014 and September 15, 2014. For more information on our PreOrder policies, please visit our PreOrder page. ^||,|$49.00$|,||,|JAK-PEPPAR-CHLOE-GIRLS-PEASANT-TOP-BLACK|,|$URL$jak-peppar-chloe-girls-peasant-top-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-chloe-girls-peasant-top-black-preorder-1.jpg||-||Jak and Peppar Farrah Peasant Blouse for Tweens PREORDER|,|^|A sweet new design, this tween top from Jak and Peppar is a lovely look for the fall season. The deep red fabric is a rich shade, perfect for the season, while the light weight fabric is comfortable to wear. The bodice of the top is covered with pleats and styled with touches of ivory. Three buttons sit on the front of the top while the fit opens from the empire waist. A ruffle finishes the hemline and long sleeves have a quaint ruffle cuff. Please note that this Jak and Peppar item is a PreOrder and is NOT currently in stock. This item is expected to arrive between August 13, 2014 and September 15, 2014. For more information on our PreOrder policies, please visit our PreOrder page. ^||,|$49.00$|,||,|JAK-PEPPAR-FARRAH-PEASANT-BLOUSE-TWEENS|,|$URL$jak-peppar-farrah-peasant-blouse-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-farrah-peasant-blouse-for-tweens-preorder-1.jpg||-||Jak and Peppar Girls Hi Low Top in Dazed Red PREORDER|,|^|Jak & Peppar has created this new designer top to go with the fabulous new creations in the debut collection this fall. The top is covered with a tie dye pattern. The deep red is the perfect fall color while the front boasts of a single scoop pocket. The shirt is finished with a hi-low hemline. Please note that this Jak and Peppar item is a PreOrder and is NOT currently in stock. This item is expected to arrive between August 13, 2014 and September 15, 2014. For more information on our PreOrder policies, please visit our PreOrder page. ^||,|$44.00$|,||,|JAK-PEPPAR-GIRLS-HI-LOW-TOP-DAZED-RED|,|$URL$jak-peppar-girls-hi-low-top-dazed-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-girls-hi-low-top-in-dazed-red-preorder-1.jpg||-||Jak and Peppar Girls Skinnies in Olive with Patch PREORDER|,|^|A popular new arrival that looks fabulous beneath the tunics and dresses, these skinnies from Jak and Peppar are in high demand! The olive tone is found throughout the introductory collection by Jak & Peppar. Darling patches accent these prep school skinnies and add other earthy shades to match all of the fabulous pieces. A large benefit of the comfortable fit is the ease in which they layer with her fabulous fall boots or beloved flats! Due to the high popularity of this new brand, quantities are limited so be sure to purchase her size before it disappears! Please note that this Jak and Peppar item is a PreOrder and is NOT currently in stock. This item is expected to arrive between August 13, 2014 and September 15, 2014. For more information on our PreOrder policies, please visit our PreOrder page. ^||,|$69.00$|,||,|JAK-PEPPAR-GIRLS-SKINNIES-OLIVE-PATCH|,|$URL$jak-peppar-girls-skinnies-olive-patch.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-girls-skinnies-in-olive-with-patch-preorder-1.jpg||-||Jak and Peppar Girls Skinny Corduroys in Red PREORDER|,|^|A must have creation, these new tween skinny pants are from the trendy new designer Jak and Peppar. The pants boast of their rich red shade that compliments almost every new top from their fall collection. The corduroy fabric is a popular choice for the season while the skinny leg pairs beautifully with her boots! The skinnies offer her back pockets and a traditional zipper and button to fasten the waistline. Please note that this Jak and Peppar item is a PreOrder and is NOT currently in stock. This item is expected to arrive between August 13, 2014 and September 15, 2014. For more information on our PreOrder policies, please visit our PreOrder page. ^||,|$66.00$|,||,|JAK-PEPPAR-GIRLS-SKINNY-CORDUROYS-RED|,|$URL$jak-peppar-girls-skinny-corduroys-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-girls-skinny-corduroys-in-red-preorder-1.jpg||-||Jak and Peppar Hickman Girls Denim Jacket PREORDER|,|^|From the brand new designer Jak & Peppar, this tween jean jacket is a must have fall fashion! The Hickman Jacket is a darling design with the free spirit that fills the rest of the collection. The medium wash has slight touches of fading found on the back along with a dream catcher screen print. At the center of the back hemline there is a touch of elastic that gives a flattering shape. The ivory long sleeves are speckled with raw fibers and match perfectly to the cozy hood. The draw strings belonging to the hood are long and dressed with beads at the end. There are two pockets on the front and a row of snaps that close. Please note that this Jak and Peppar item is a PreOrder and is NOT currently in stock. This item is expected to arrive between August 13, 2014 and September 15, 2014. For more information on our PreOrder policies, please visit our PreOrder page. ^||,|$86.00$|,||,|JAK-PEPPAR-HICKMAN-GIRLS-DENIM-JACKET|,|$URL$jak-peppar-hickman-girls-denim-jacket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-hickman-girls-denim-jacket-preorder-1.jpg||-||Jak and Peppar Ivory Dress for Tweens with Flowers PREORDER|,|^|A casual tween dress, this new creation is from the Jak and Peppar brand, a new release from the makers of Mustard Pie. The ivory dress is covered with a fun flower print in rustic shades. The bodice is long sleeve and has a blouson fit. The skirt is cut for a classic shape finished in a straight hem. To complete the look pair the dress with a jean vest and cute boots! Please note that this Jak and Peppar item is a PreOrder and is NOT currently in stock. This item is expected to arrive between August 13, 2014 and September 15, 2014. For more information on our PreOrder policies, please visit our PreOrder page. ^||,|$58.00$|,||,|JAK-PEPPAR-IVORY-DRESS-TWEENS-FLOWERS|,|$URL$jak-peppar-ivory-dress-tweens-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-ivory-dress-for-tweens-with-flowers-preorder-1.jpg||-||Jak and Peppar Ivory Girls Tunic Gypsy Flowers PREORDER|,|^|In light ivory, this new creation for tween girls is from Jak and Peppar. The top is closed with a row of buttons found in the front that create a V slit neckline. A touch of lace is found at the waistline. The bottom of the top and the long sleeves are a solid fabric while the top is dressed with a flower print. The long sleeves are rolled up and fastened with a button. Please note that this Jak and Peppar item is a PreOrder and is NOT currently in stock. This item is expected to arrive between August 13, 2014 and September 15, 2014. For more information on our PreOrder policies, please visit our PreOrder page. ^||,|$38.00$|,||,|JAK-PEPPAR-IVORY-GIRLS-TUNIC-GYPSY-FLOWERS|,|$URL$jak-peppar-ivory-girls-tunic-gypsy-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-ivory-girls-tunic-gypsy-flowers-preorder-1.jpg||-||Jak and Peppar Ivory Ophelia Blouse for Tweens PREORDER|,|^|Jak & Peppar is a new line from the creators of Mustard Pie. This new tween top comes from their debut collection. The top boasts of an illusion neckline in a sheer dot print and a layer of crochet lace with long sleeves beneath. The casual fit of this top is comfortable for all day wear. Another accent of lace is found dancing at the hemline. Please note that this Jak and Peppar item is a PreOrder and is NOT currently in stock. This item is expected to arrive between August 13, 2014 and September 15, 2014. For more information on our PreOrder policies, please visit our PreOrder page. ^||,|$49.00$|,||,|JAK-PEPPAR-IVORY-OPHELIA-BLOUSE-TWEENS|,|$URL$jak-peppar-ivory-ophelia-blouse-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-ivory-ophelia-blouse-for-tweens-1.jpg||-||Jak and Peppar Joan of Arc Peplum in Charcoal PREORDER|,|^|Certainly a beautiful look, this new tween tunic from Jak and Peppar is created in earthy hues and is the perfect every day look. The body of the tunic is a thin charcoal stripe that is alternated with ivory and finished with a raw edge. Soft ivory crochet lace creates comfortable sheer sleeves to match the darling peplum skirt. Please note that this Jak and Peppar item is a PreOrder and is NOT currently in stock. This item is expected to arrive between August 13, 2014 and September 15, 2014. For more information on our PreOrder policies, please visit our PreOrder page. ^||,|$49.00$|,||,|JAK-PEPPAR-JOAN-OF-ARC-PEPLUM-CHARCOAL|,|$URL$jak-peppar-joan-of-arc-peplum-charcoal.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-joan-of-arc-peplum-in-charcoal-preorder-1.jpg||-||Jak and Peppar Peasant Top for Girls in Vanilla PREORDER|,|^|Part of their debut collection this fall, this new Jak & Peppar top for tweens is a piece she will surely love all fall and winter long. The vanilla fabric boasts of its relaxed fit, light weight, and crepe texture. The neckline is dressed with a embroidered pattern that is also found on the skirt of this tunic. The long sleeves have a peasant bell shape. The cut of this style is perfectly complimented by her skinny pants. Please note that this Jak and Peppar item is a PreOrder and is NOT currently in stock. This item is expected to arrive between August 13, 2014 and September 15, 2014. For more information on our PreOrder policies, please visit our PreOrder page. ^||,|$49.00$|,||,|JAK-PEPPAR-PEASANT-TOP-GIRLS-VANILLA|,|$URL$jak-peppar-peasant-top-girls-vanilla.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-peasant-top-for-girls-in-vanilla-preorder-1.jpg||-||Jak and Peppar Red Headband for Tweens Gertrude PREORDER|,|^|Matching all of the new arrivals in their debut collection, this tween hair accessory comes from Jak & Peppar. The headband is a red tie dye coloring. A small twisted loop is found at the front of the headband for an understated style that compliments her outfit without stealing the show. A touch of elastic on the back is used to provide the stretch fit! Please note that this Jak and Peppar item is a PreOrder and is NOT currently in stock. This item is expected to arrive between August 13, 2014 and September 15, 2014. For more information on our PreOrder policies, please visit our PreOrder page. ^||,|$24.00$|,||,|JAK-PEPPAR-RED-HEADBAND-TWEENS-GERTRUDE|,|$URL$jak-peppar-red-headband-tweens-gertrude.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-red-headband-for-tweens-gertrude-preorder-1.jpg||-||Jak and Peppar Tie Dye Tween Leggings Red PREORDER|,|^|Pairing beautifully with their new dresses and skirts, these tween leggings come from designer Jak and Peppar. The leggings have a great stretch fit with an elastic waistline. The fabric is covered with a red and blue tie dye print that embodies the spirit held with these earthy designs. Leggings are the perfect way to show off her favorite boots this fall and winter! Please note that this Jak and Peppar item is a PreOrder and is NOT currently in stock. This item is expected to arrive between August 13, 2014 and September 15, 2014. For more information on our PreOrder policies, please visit our PreOrder page. ^||,|$38.00$|,||,|JAK-PEPPAR-TIE-DYE-TWEEN-LEGGINGS-RED|,|$URL$jak-peppar-tie-dye-tween-leggings-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-tie-dye-tween-leggings-red-preorder-1.jpg||-||Jak and Peppar Tween Dress Long Sleeve Tie Dye PREORDER|,|^|A look she will love all season long, this new dress is from designer Jak and Peppar. The dress is created with a light weight fabric that boasts of its crepe pattern. The dress is covered with navy blue tie dye effect. Her waist has a smocked fit while long sleeves are perfect for the season. Pair adorable leggings or boots beneath this dress for a look her friends will envy. Please note that this Jak and Peppar item is a PreOrder and is NOT currently in stock. This item is expected to arrive between August 13, 2014 and September 15, 2014. For more information on our PreOrder policies, please visit our PreOrder page. ^||,|$58.00$|,||,|JAK-PEPPAR-TWEEN-DRESS-LONG-SLEEVE-TIE-DYE|,|$URL$jak-peppar-tween-dress-long-sleeve-tie-dye.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-tween-dress-long-sleeve-tie-dye-preorder-1.jpg||-||Jak and Peppar Tween Hair Accessory Gertrude Black PREORDER|,|^|Created with the same fabric found in other pieces of the collection, this new hair accessory is a part of the fall and winter collection from Jak and Peppar. The headband is styled with a looped twist found in the front while a touch of elastic offers easy stretch. The black fabric is covered with a floral print in natural tones. Please note that this Jak and Peppar item is a PreOrder and is NOT currently in stock. This item is expected to arrive between August 13, 2014 and September 15, 2014. For more information on our PreOrder policies, please visit our PreOrder page. ^||,|$24.00$|,||,|JAK-PEPPAR-TWEEN-HAIR-ACCESSORY-GERTRUDE-BLACK|,|$URL$jak-peppar-tween-hair-accessory-gertrude-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jak-and-peppar-tween-hair-accessory-gertrude-black-preorder-1.jpg||-||Jefferies Socks Girls Black Tights with Sparkling Gems|,|With a small touch of sparkle, these new black girls tights from Jefferies Socks will pair beautifully with any outfit. The pantyhose boasts of a stretch fit and small diamond like gems scattered about. Made with a stretch nylon blend, machine washable. |,|$9.00$|,||,|JEFFERIES-SOCKS-GIRLS-BLACK-TIGHTS-GEMS|,|$URL$jefferies-socks-girls-black-tights-gems.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jefferies-socks-girls-black-tights-with-sparkling-gems-13.jpg||-||Jefferies Socks Girls Ivory Tights with Sparkling Gems|,|Designer Jefferies Socks is now offering this creamy ivory tights for girls. The pantyhose boast of the traditional stretch fit while sparkling diamond like gems are sporadically placed about to add just a touch of shine. The perfect finish for her new dress! Stretch nylon blend; Machine wash gentle. |,|$9.00$|,||,|JEFFERIES-SOCKS-GIRLS-IVORY-TIGHTS-SPARKLING-GEMS|,|$URL$jefferies-socks-girls-ivory-tights-sparkling-gems.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jefferies-socks-girls-ivory-tights-with-sparkling-gems-12.jpg||-||Jefferies Socks Girls White Tights with Sparkling Gems|,|^|Delightful and gorgeous, these new girls tights from designer Jefferies Socks will cap off her new outfit beautifully! The tights boast of a classic stretch fit and are covered with small diamond like gems. Machine washable, stretch nylon blend. SIZE 8-10 ONLY LEFT.  ^||,|$9.00$|,||,|JEFFERIES-SOCKS-GIRLS-WHITE-TIGHTS-SPARKLING-GEMS|,|$URL$jefferies-socks-girls-white-tights-sparkling-gems.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jefferies-socks-girls-white-tights-with-sparkling-gems-13.jpg||-||Jefferies Socks Infant and Toddler White Tights|,|^|Made in the USA by Jefferies socks, these little girls tights come in infant and toddler sizes. The nylon and and spandex blend provide the classic fit and look. Traditionally paired with holiday and birthday dresses and adorable patent leather shoes. Machine washable. SIZE 6-18 MOS ONLY LEFT.  ^||,|$7.00$|,||,|JEFFERIES-SOCKS-INFANT-TODDLER-WHITE-TIGHTS|,|$URL$jefferies-socks-infant-toddler-white-tights.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jefferies-socks-infant-and-toddler-white-tights-11.jpg||-||Jefferies Socks Ivory Infant and Toddler Tights|,|New from Jefferies Socks, these ivory tights are the perfect small touch for any special occasion. Pairs beautifully with dress and patent leather shoes, these tights are made in the USA from nylon and lycra. Machine washable, tumble dry. |,|$7.00$|,||,|JEFFERIES-SOCKS-IVORY-INFANT-TODDLER-TIGHTS|,|$URL$jefferies-socks-ivory-infant-toddler-tights.html|,|http://ep.yimg.com/ay/yhst-17102259411242/jefferies-socks-ivory-infant-and-toddler-tights-13.jpg||-||Joyfolie Girls Loafer Flats Rosie in Sequins|,|A dressy take on the comfortable Rosie loafer, these little girl shoes come from Joyfolie. The shoes boast of a ribbed fabric lining the inner sole and also lines the top of the shoe. The loafer is covered with rose gold sequins. Set off to the side of both toes we find a pink chiffon flower complete with green felt leaves. Use these shoes to bring an elegant sparkle to her every day outfits! A peach hair flower comes with the pair making accessorizing a breeze! |,|$67.50$|,||,|JOYFOLIE-GIRLS-LOAFER-FLATS-ROSIE-SEQUINS|,|$URL$joyfolie-girls-loafer-flats-rosie-sequins.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-girls-loafer-flats-rosie-in-sequins-1.jpg||-||Joyfolie Glitter Flats for Girls in Pink Londyn|,|New from Joyfolie, these beautiful flats are sure to add that special touch to any of her spring and summer outfits! The cotton candy pink is covered with iridescent glitter that catches every bit of light that comes its way. The t-strap is attached to a velcro ankle strap for a secure fit. A beaded burst of gold is found placed upon the tow of the shoe. A matching pink glitter hair bow accompanies each pair. A subtle heel is found on the rubber sole. |,|$64.00$|,||,|JOYFOLIE-GLITTER-FLATS-GIRLS-PINK-LONDYN|,|$URL$joyfolie-glitter-flats-girls-pink-londyn.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-glitter-flats-for-girls-in-pink-londyn-1.jpg||-||Joyfolie Glitter Sandals for Girls in Naomi Black|,|A dressy shoe perfect for your daughter, this new arrival comes from Joyfolie. The sandal is finished with a peep toe while the dressed with a elegant double bow. A Velcro strap secures around her ankle and is accented with two studs. The t-strap runs along the top of her foot. The black shoe is covered with glitter and catches the light. |,|$60.00$|,||,|JOYFOLIE-GLITTER-SANDALS-GIRLS-NAOMI-BLACK|,|$URL$joyfolie-glitter-sandals-girls-naomi-black.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-glitter-sandals-for-girls-in-naomi-black-12.jpg||-||Joyfolie Gold Lilly Peep Toe Girls Flats|,|A shoe she will adore wearing, this new girls flat from Joyfolie is filled with an understated elegance. The faux leather is a rich shimmer champagne that has a gorgeous gleam. The peep toes are accented with a layered circle bloom and two felt leaves. The center of the flowers are accented with a trio of beads. These shoes are accompanied by a matching clip. They are the perfect choice to accent her every day wardrobe or match her special occasion dresses. |,|$60.00$|,||,|JOYFOLIE-GOLD-LILLY-PEEP-TOE-GIRLS-FLATS|,|$URL$joyfolie-gold-lilly-peep-toe-girls-flats.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-gold-lilly-peep-toe-girls-flats-1.jpg||-||Joyfolie Lilac Isabell Wedge|,|A sweet shade sure to be a gorgeous compliment to her spring and summer dresses, these new little girls shoes are from the famous Joyfolie brand. The light mauve lilac stands apart from other shoes while the light produces an elegant sheen. The toe of the shoe is dressed with a chiffon and tulle flower. A single thin strap wraps around her ankles secured by a classic buckle. The wedge heel is wrapped in bright silver glitter. The bottom sole is a lined rubber for grip while the inside sole is a comfortable neutral fabric. Each pair is accompanied by a sweet hair bow clip. |,|$68.00$|,||,|JOYFOLIE-LILAC-ISABELL-WEDGE|,|$URL$joyfolie-lilac-isabell-wedge.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-lilac-isabell-wedge-1.jpg||-||Joyfolie Little Girls Flats Isis Blue Shoes|,|Don't you step on her blue suede shoes! She is sure to treasure these new Joyfolie flats. The sky blue suede is soft and glamorous, perfect for your tiffany princess. A t-strap runs up the top of her foot to attach to the velcro ankle strap. The toe of the foot is decorated with a structured bow complete with two angled tails. The bow is covered in beautiful blue sequins. The rubber sole has a slight heel. These shoes are accompanied by a matching blue glitter hair bow. |,|$62.00$|,||,|JOYFOLIE-LITTLE-GIRLS-FLATS-ISIS-BLUE|,|$URL$joyfolie-little-girls-flats-isis-blue.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-little-girls-flats-isis-blue-shoes-1.jpg||-||Joyfolie Little Girls Holiday Shoes Red Revaline|,|A darling creation, this new dress shoe for girls comes from the fabulous Joyfolie. The holiday red covers the entire shoe while a single ankle strap is secured around her waist. The strap is accented with a buckle and fastened with easy to use Velcro. The shoe is finished with a peep to that is adorned by a large, hand turned rosette. The shoe is lined in gold and offers a rubber outer sole. |,|$60.00$|,||,|JOYFOLIE-LITLE-GIRLS-HOLIDAY-SHOES-RED-REVALINE|,|$URL$joyfolie-litle-girls-holiday-shoes-red-revaline.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-litle-girls-holiday-shoes-red-revaline-17.jpg||-||Joyfolie Little Girls Lime Lyric Shoe|,|^|Truly unique, this new pair of shoes from Joyfolie are sure to be sweet as a melody. The closed toe t-strap features a Velcro strap around her ankle and a vibrant orange flower that sits atop her foot. The lime printed canvas is coated for its protection and the bottom sole is made with rubber. (1) SIZE 10 AVAILABLE. ^||,|$39.00$|,||,|JOYFOLIE-LITTLE-GIRLS-LIME-LYRIC-SHOE|,|$URL$joyfolie-little-girls-lime-lyric-shoe.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-little-girls-lime-lyric-shoe-13.jpg||-||Joyfolie Loralie Yellow Bow Shoes for Little Girls|,|^|In a rich mustard yellow, these new Joyfolie mary janes are a hit! The vegan patent leather is wearable and looks great whether you pair it with jeans or a dress. The rounded toes of these flats are graced by a doubled bow. The velcro ankle strap is easy for her to use while keeping her feet secure. A faux buckle adds the perfect final touch. SIZE 6 AND 11 ONLY LEFT. ^||,|$62.00$|,||,|JOYFOLIE-LORALIE-YELLOW-BOW-SHOES-FOR-LITTLE-GIRLS|,|$URL$joyfolie-loralie-yellow-bow-shoes-for-little-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-loralie-yellow-bow-shoes-for-little-girls-34.jpg||-||Joyfolie Mika Wedge for Girls in Polka Dot Olive|,|An adorable new arrival from designer Joyfolie, these little girl wedges are the perfect choice to coordinate with her fun summer outfits. The olive shoe is covered in white polka dots and boasts of a spiral ankle strap that is secured with Velcro. The tow of both feet is dressed with a purple bloom complete with felt leaves. The wedge of the shoe is cork while the rubber outer sole grips with her steps. The shoes come with a matching hair accessory. |,|$68.00$|,||,|JOYFOLIE-MIKA-WEDGE-GIRLS-POLKA-DOT-OLIVE|,|$URL$joyfolie-mika-wedge-girls-polka-dot-olive.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-mika-wedge-for-girls-in-polka-dot-olive-17.jpg||-||Joyfolie Miriam Shoes in Glitter Fuchsia|,|Perfect for any young girl who loves pink and glitter, these new mary jane flats are a true prize from Joyfolie. The rich fuchsia glitter wraps completely around the shoe. The ankle strap is secured with a classic buckle. The inside is lined with a ribbed fabric in mint. The toe of the show is dressed with a double bow. A sweet chiffon flower clip accompanies the pair. |,|$60.00$|,||,|JOYFOLIE-MIRIAM-TODDLER-SHOES-GLITTER-FUCHSIA|,|$URL$joyfolie-miriam-toddler-shoes-glitter-fuchsia.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-miriam-toddler-shoes-in-glitter-fuchsia-1.jpg||-||Joyfolie Red Holiday Shoes for Girls in Naomi|,|In bold holiday red, these new Naomi girls shoes have arrived from designer Joyfolie. Joyfolie is an inspiring brand that fills their designs with love and dreams. This adorable shoe features a t-strap that velcros around her ankle and is adorned with two rounded studs. The peep toe is finished with a lux double bow. The glitter finish of the shoe compliments her new holiday dress with ease! |,|$60.00$|,||,|JOYFOLIE-RED-HOLIDAY-SHOES-GIRLS-NAOMI|,|$URL$joyfolie-red-holiday-shoes-girls-naomi.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-red-holiday-shoes-for-girls-in-naomi-1.jpg||-||Joyfolie Silver Naomi Girls Fancy Shoe|,|^|Glittering their way to the top, the fabulous ""Naomi"" style by Joyfolie is sure to be a big hit for the holiday season. These silver shoes are covered in glitter and feature a t strap that is secured by Velcro around her ankle. The toe of this sandal is covered with a double bow while styled in the peep toe look. This shoe is available in other colors while supplies last! ^||,|$60.00$|,||,|JOYFOLIE-SILVER-NAOMI-GIRLS-FANCY-SHOE|,|$URL$joyfolie-silver-naomi-girls-fancy-shoe.html|,|http://ep.yimg.com/ay/yhst-17102259411242/joyfolie-silver-naomi-girls-fancy-shoe-1.jpg||-||Kamara Black Leather Ballet Slippers with Flower|,|^|With a velvet and rhinestone flower on the toe, these girls handmade black ballet slippers are so elegant! Perfect for her holiday outfit, adjustable drawstring, elastic instep, ribbon to tie. Ballet slipper sizes range from infant size 4 to girls size 4. These shoes run small, please order up TWO sizes. ^||,|$38.00$|,||,|KAMARA-BLACK-BALLET-SLIPPERS|,|http://www.labellaflorachildrensboutique.com/kamara-black-ballet-slippers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kamara-black-leather-ballet-slippers-with-flower-13.jpg||-||Kamara Girls Gold Ballet Slippers with Rosette|,|^|Ivory Satin rosettes trimmed in gold adorn the toe of these handmade gold leather ballet slippers from Kamara. Adjustable drawstring, elastic instep and a matching satin ribbon to tie. How adorable! Ballet slipper sizes range from infant size 4 to girls size 4. These shoes run small, please order up TWO sizes. ^||,|$38.00$|,||,|KAMARA-GILS-GOLD-BALLET-SLIPPERS-ROSETTE|,|$URL$kamara-gils-gold-ballet-slippers-rosette.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kamara-girls-gold-ballet-slippers-with-rosette-13.jpg||-||Kamara Girls Silver Ballet Slippers|,|^|Large floral accents make these handmade leather girls ballet slippers sparkle. In silver leather, with an adjustable drawstring, ribbon tie, and elastic instep strap. Ballet slipper sizes range from infant size 4 to girls size 4. These shoes run small, please order up TWO sizes. ^||,|$38.00$|,||,|KAMARA-GIRLS-SILVER-BALLET-SLIPPERS|,|http://www.labellaflorachildrensboutique.com/kamara-girls-silver-ballet-slippers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kamara-girls-silver-ballet-slippers-13.jpg||-||Kamara Gold Girls Leather Ballet Slippers |,|^|Beaded butterflies adorn the toes on these handmade golden leather ballet slippers by Kamara. Adjustable drawstring, elastic instep, and ribbon to tie. So elegant! These shoes run small, please order up TWO sizes. (1) SIZE 6 AND SIZE 8 LEFT.  ^||,|$29.00$|,||,|KAMARA-GOLD-BALLET-SLIPPERS|,|http://www.labellaflorachildrensboutique.com/kamara-gold-ballet-slippers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kamara-gold-girls-leather-ballet-slippers-13.jpg||-||Kamara Leather Ivory Ballet Slippers|,|^|This ivory leather ballet slipper with ivory satin rosette coordinates beautifully with many of her special dresses. The finishing touch! Ballet slipper sizes range from infant size 4 to girls size 4. These shoes run small, please order up TWO sizes. ^||,|$38.00$|,||,|KAMARA-IVORY-LEATHER-BALLET-SLIPPERS|,|$URL$kamara-ivory-leather-ballet-slippers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kamara-leather-ivory-ballet-slippers-12.jpg||-||Kamara Pink Floral Accent Ballerina Slippers|,|^|Handmade of pretty pink leather, these girls ballet slippers by Kamara are so cute. Adjustable drawstring, ribbon tie, floral accent, elastic inset strap. Ballet slipper sizes range from infant size 4 to girls size 4. These shoes run small, please order up TWO sizes. ^||,|$38.00$|,||,|KAMARA-PINK-BALLET-SLIPPERS|,|http://www.labellaflorachildrensboutique.com/kamara-pink-ballet-slippers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kamara-pink-floral-accent-ballerina-slippers-13.jpg||-||Kamara Red Girls Leather Ballet Slippers|,|^|Handmade of leather, these girls ballet slippers have a ribbon rosette on the toe, and elastic strap on the instep and ribbon ties. Match her Christmas outfit with these red slippers. Cute! Ballet slipper sizes range from infant size 4 to girls size 4. These shoes run small, please order up TWO sizes. ^||,|$38.00$|,||,|KAMARA-RED-BALLET-SLIPPERS|,|http://www.labellaflorachildrensboutique.com/kamara-red-ballet-slippers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kamara-red-girls-leather-ballet-slippers-13.jpg||-||Kamara White Leather Ballet Slippers|,|^|A satiny ribbon rosette trims the toes of these girls white leather ballet slippers by Kamara. Elastic instep strap for fit, ribbon ties go around the ankle. Available in babys size 4 to big girls size 4. Wear with her summer favorites or to dance class! Ballet slipper sizes range from infant size 4 to girls size 4. These shoes run small, please order up TWO sizes. ^||,|$38.00$|,||,|KAMARA-WHITE-BALLET-SLIPPERS|,|$URL$kamara-white-ballet-slippers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kamara-white-leather-ballet-slippers-13.jpg||-||Kate Mack A Star is Born Girls Sweater and Sequin Skirt|,|^|Full of character that is sure to delight your favorite beautiful girl, this new outfit comes from Kate Mack. The black sweater top features a classic batwing sleeve and dolman fit with the fitted hem and hugging cuffs. Silver sequin stars dance across the front. The matching skirt is covered in the same metallic sequins and a light lining. Both pieces are polyester blends, hand wash with care. SIZE 4 AND 14 REMAINING. ^||,|$39.00$|,||,|KATE-MACK-STAR-BORN-GIRLS-SWEATER-SEQUIN-SKIRT|,|$URL$kate-mack-star-born-girls-sweater-sequin-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-a-star-is-born-girls-sweater-and-sequin-skirt-15.jpg||-||Kate Mack Aqua Girls Cirque De Soleil Tunic Set|,|Matching several of the new arrivals by Kate Mack, this girls tunic outfit is just darling. The long top offers her a racer back fit. The unique shape of the hemline is dress for success with fun tulle ruffles. A single rose is found near the neckline. Solid leggings are worn beneath and offer an easy elastic waist and gathered hemlines. |,|$49.00$|,||,|KATE-MACK-AQUA-GIRLS-CIRQUE-DE-SOLEIL-TUNIC-SET|,|$URL$kate-mack-aqua-girls-cirque-de-soleil-tunic-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-aqua-girls-cirque-de-soleil-tunic-set-1.jpg||-||Kate Mack Baby Girls Swimsuit Heavenly Roses|,|A one piece swimsuit that comes from Kate Mack, this piece is part of the Heavenly Roses collection. The infant bubble has a thin halter neckline. Sweet flowers texture the entire bathing suit. |,|$68.00$|,||,|KATE-MACK-BABY-GIRLS-SWIMSUIT-HEAVENLY-ROSES|,|$URL$kate-mack-baby-girls-swimsuit-heavenly-roses.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-baby-girls-swimsuit-heavenly-roses-3.jpg||-||Kate Mack Bikini Swan Lake|,|^|In a pretty pale pink, this girls bikini comes from Kate Mack. The halter top has a V neck and is dressed with large sequin polka dots. The matching bottom is positively gorgeous and a large bow sits at the waist. Layers of fun tiers create the perfect skirted look. (1) 8 ONLY LEFT.  ^||,|$58.00$|,||,|KATE-MACK-BIKINI-SWAN-LAKE|,|$URL$kate-mack-bikini-swan-lake.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-bikini-swan-lake-3.jpg||-||Kate Mack Blue Leopard Girls Faux Fur Vest|,|^|She will look like the perfect little snow leopard in this adorable faux fur vest by Kate Mack. The ice blue lining and gray faux fur match beautifully together to create a cool look but keep you warm! One single embellishment is placed on the left side with sparkling gems that shimmer in the light. Pair this adorable vest with a long sleeved top and skinny jeans! The faux fur is made with an acrylic and polyester blend. Hand wash only and drip dry. SIZE 5 AND 6 AVAILABLE.  ^||,|$37.20$|,||,|KATE-MACK-BLUE-LEOPARD-GIRLS-FAUX-FUR-VEST|,|$URL$kate-mack-blue-leopard-girls-faux-fur-vest.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-blue-leopard-girls-faux-fur-vest-3.jpg||-||Kate Mack Born Wild Silver Pleather Girls Skirt|,|^|Joining other top brands in the new fall trend, this pleather girls skirt will be the talk of all her friends. Kate Mack designed this skirt as a part of their ""Born to be Wild"" collection. The silver metallic pleather shimmers unlike any other and has a fitted shape. A short zipper and a button close the front and two pockets also are found on the front. A line of gems swoop in line with her left pocket. Pairs great with the Born Wild Dragonfly Batwing Top! Metallic pleather is made with polyblend. Hand wash only and drip dry. SIZE 8 ONLY AVAILABLE.  ^||,|$27.60$|,||,|KATE-MACK-BORN-WILD-SILVER-PLEATHER-GIRLS-SKIRT|,|$URL$kate-mack-born-wild-silver-pleather-girls-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-born-wild-silver-pleather-girls-skirt-3.jpg||-||Kate Mack Candy Carnival Infant Girls One Piece Swimsuit|,|^|A cute little bathing suit for your infant princess, this design comes from Kate Mack. The halter top boasts of the fun flowers that add texture. The light pink stripes with white and two sweet bows are found on her hips. The bubble shape looks darling on your baby girl and this color combo matches other pieces in the ""Candy Carnival"" collection for matching pieces for her sisters. ^||,|$52.00$|,||,|KATE-MACK-CANDY-CARNIVAL-INFANT-GIRLS-ONE-PIECE-SWIMSUIT|,|$URL$kate-mack-candy-carnival-infant-girls-one-piece-swimsuit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-candy-carnival-infant-girls-one-piece-swimsuit-2.jpg||-||Kate Mack Candy Carnival Swim Coverup|,|^|Made to keep her warm in between swims, this new piece comes from Kate Mack's ""Candy Carnival"" collection. The long sleeves and the hood make this coverup perfect, and it even matches her new Kate Mack swimsuit! The sharkbite hem falls on both sides and a kangaroo pocket is found on the front. SIZE 18 MOS AND 4 ONLY LEFT. ^||,|$46.00$|,||,|KATE-MACK-CANDY-CARNIVAL-SWIM-COVERUP|,|$URL$kate-mack-candy-carnival-swim-coverup.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-candy-carnival-swim-coverup-2.jpg||-||Kate Mack Candy Carnival Tankini|,|^|Arriving in our store just in time for your family vacation, this new girls tankini comes from Kate Mack. The long top is wrapped in thin pink and white stripes. The straight neckline is accented with flowers and secured by thin straps. The matching bottoms boast of a single bow on her waist. Be sure to find all the matching pieces from the ""Candy Carnival"" collection! ^||,|$54.00$|,||,|KATE-MACK-CANDY-CARNIVAL-TANKINI|,|$URL$kate-mack-candy-carnival-tankini.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-candy-carnival-tankini-15.jpg||-||Kate Mack Cirque De Soleil Aqua Bikini Infant and Toddler|,|^|A sweet creation by Kate Mack, this new bikini for girls comes from their ""Cirque De Soleil"" collection. The classic bandeaux top has thin straps while three flowers sit on the front, accented with sparkling centers. The matching bottom has a skirt that falls from the waist. The color blend makes a perfectly aqua shade. Cascading ruffles create the full volume that takes this look past extraordinary. ^||,|$49.00$|,||,|KATE-MACK-CIRQUE-DE-SOLEIL-AQUA-BIKINI|,|$URL$kate-mack-cirque-de-soleil-aqua-bikini.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-cirque-de-soleil-aqua-bikini-1.jpg||-||Kate Mack Cirque De Soleil Pink Bikini Infant and Toddler|,|^|Part of one of the hottest collections of the season, this new Kate Mack swimsuit will not last long on our shelves! The light pink suit features a ruffle skirt that cascades from the waist of the bottoms. The volume found on this skirt is truly fanciful. Matching flowers accented with a shimmer center is found on the top. The thin straps are comfortable for all day water play. 2T ONLY LEFT.  ^||,|$49.00$|,||,|KATE-MACK-CIRQUE-DE-SOLEIL-PINK-BIKINI|,|$URL$kate-mack-cirque-de-soleil-pink-bikini.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-cirque-de-soleil-pink-bikini-1.jpg||-||Kate Mack Cirque De Soleil Pink Sequin Girls Dress|,|^|This Kate Mack dress is a real gem and is filled with the circus fun that is inherent in the ""Cirque De Soleil"" collection. The sleeveless dress is covered with sequins that reflect every ray of light as she moves. A single flower is found near the neckline to add more texture. The fabric lining is striped and helps create the comfort of this casual, fabulous look. ^||,|$43.50$|,||,|KATE-MACK-CIRQUE-DE-SOLEIL-PINK-SEQUIN-GIRLS-DRESS|,|$URL$kate-mack-cirque-de-soleil-pink-sequin-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-cirque-de-soleil-pink-sequin-girls-dress-1.jpg||-||Kate Mack Cirque De Soleil Pink Tankini for Infant and Toddler|,|Also available in aqua, this new girls swimsuit comes from Kate Mack. Light princess pink fills this tankini. The long top has a trio of flowers that accent the straight neckline while billows of ruffles fall at the hem. Thin shoulder straps are prepared for her water fun. The solid pink bottoms are worn beneath. |,|$49.00$|,||,|KATE-MACK-CIRQUE-DE-SOLEIL-PINK-TANKINI-INFANT-TODDLER|,|$URL$kate-mack-cirque-de-soleil-pink-tankini-infant-toddler.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-cirque-de-soleil-pink-tankini-for-infant-and-toddler-1.jpg||-||Kate Mack Cirque De Soleil Pink Tunic and Capri|,|A cute little girls outfit created by designer Kate Mack, this wonderful infant and toddler set is a winner! The sweet pink stripes race the empire bodice, accenting the straight neckline and thin straps. A single flower is found on the top while the tiered skirt is created with fairy ruffles. Matching striped capris are paired beneath to complete this look. |,|$43.50$|,||,|KATE-MACK-CIRQUE-DE-SOLEIL-PINK-TUNIC-CAPRI|,|$URL$kate-mack-cirque-de-soleil-pink-tunic-capri.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-cirque-de-soleil-pink-tunic-and-capri-1.jpg||-||Kate Mack Cirque De Soleil Tankini for Infant and Toddler|,|Designed by Kate Mack, this girls swimsuit is flying high in fun. The tankini top has thin straps and a row of flowers at the neckline. The hem is draped with ruffles that are filled with volume. Solid light blue bottoms are worn with this top. The whimsical mix of blue and lime makes this collection a real winner. |,|$49.00$|,||,|KATE-MACK-CIRQUE-DE-SOLEIL-TANKINI-INFANT-TODDLER|,|$URL$kate-mack-cirque-de-soleil-tankini-infant-toddler.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-cirque-de-soleil-tankini-for-infant-and-toddler-1.jpg||-||Kate Mack Color Block Girls Dress What is Hip|,|^|The exact match to her new Kate Mack dress, this wonderful creation comes from their ""What is Hip"" collection. The straight pattern is cut for a fitted look. The mod circle print really makes the color block stand out from the rest and make this a truly trendy piece. A light pink and lime brings fun to the dress. ^||,|$36.00$|,||,|KATE-MACK-COLOR-BLOCK-GIRLS-DRESS-WHAT-HIP|,|$URL$kate-mack-color-block-girls-dress-what-hip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-color-block-girls-dress-what-is-hip-1.jpg||-||Kate Mack Designer Girls Holiday Dress Pink and Gray|,|A gorgeous designer girls dress, this new arrival is from Kate Mack. The grey bodice offers her a drop waist and long sleeves. A hidden zipper runs up the back while two pin tucks offer a more structured shape for the front. The flower duet found on the neckline is made from sweet tulle and a sparkling center. The matching skirt is layered in grey and pink tulle ruffles. The asymmetrical hemline is a unique finish! Cotton/Polyester/Spandex. Place inside mesh laundry bag and machine wash cold. Hang to dry. |,|$74.00$|,||,|KATE-MACK-DESIGNER-GIRLS-HOLIDAY-DRESS-PINK-GRAY|,|$URL$kate-mack-designer-girls-holiday-dress-pink-gray.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-designer-girls-holiday-dress-pink-and-gray-preorder-6.jpg||-||Kate Mack Designer Winter Vest for Girls Green|,|Designer Kate Mack is now offering this cute winter vest for girls as a part of their fall and winter collection. The vest is a bright lime green that stands out from the colors of the season. The puffy style is a classic look while a touch of ruffles is a unique twist. Her hands find their home in the front side pockets while a zipper closes the front. 100% Polyester. Machine wash cold. Tumble dry on low. |,|$66.00$|,||,|KATE-MACK-DESIGNER-WINTER-VEST-GIRLS-GREEN|,|$URL$kate-mack-designer-winter-vest-girls-green.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-designer-winter-vest-for-girls-green-1.jpg||-||Kate Mack Eau So French Girls Bikini|,|^|A classic color combination, this wonderful Kate Mack swimsuit will be her favorite of the season. The sweet bikini features pops of color on the top with the red straps and two bows. The halter straps are comfortable to wear and the small black and white stripes are too cute! The matching bottoms offers a bow on both hips. SIZE 7, 8 AND 14 REMAINING. ^||,|$42.00$|,||,|KATE-MACK-EAU-SO-FRENCH-GIRLS-BIKINI|,|$URL$kate-mack-eau-so-french-girls-bikini.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-eau-so-french-girls-bikini-3.jpg||-||Kate Mack Eau So French Girls Hooded Coverup|,|Comfy cute, this Kate Mack cover up is meant to match her beautiful new swim suit. The zip up hoody features long sleeves and two pockets topped with bows. The top two-thirds of the coverup is striped in red while the black stripes contrast perfectly. |,|$29.00$|,||,|KATE-MACK-EAU-SO-FRENCH-GIRLS-HOODED-COVERUP|,|$URL$kate-mack-eau-so-french-girls-hooded-coverup.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-eau-so-french-girls-hooded-coverup-3.jpg||-||Kate Mack Eau So French Girls One Piece Swimsuit|,|Truly fabulous, this new girls swimsuit comes from Kate Mack. The thin black and white stripes wrap around the entire suit while the red straps pop out in color. Three matching bows sit upon the neckline and two bows tie on her hips. The slight gathering on the sides makes the perfect shape. |,|$49.00$|,||,|KATE-MACK-EAU-SO-FRENCH-GIRLS-ONE-PIECE-SWIMSUIT|,|$URL$kate-mack-eau-so-french-girls-one-piece-swimsuit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-eau-so-french-girls-one-piece-swimsuit-4.jpg||-||Kate Mack Eau So French Girls Tutu Dress|,|Created by Kate Mack, this darling dress will make many lasting memories. The short sleeved bodice boasts of a darling large bow just beneath the neckline. Red and white stripes wrap from front to back. The white skirt has a layer of tulle on top. Two red stripes on the hem finish the look. |,|$46.50$|,||,|KATE-MACK-EAU-SO-FRENCH-GIRLS-TUTU-DRESS|,|$URL$kate-mack-eau-so-french-girls-tutu-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-eau-so-french-girls-tutu-dress-2.jpg||-||Kate Mack Eau So French Maxi Dress|,|Kate Mack is now offering this wonderful casual dress perfect for your next family vacation. The sleeveless dress has a large hole at the back of the neckline while the fun red and white stripes fall down through the long skirt. The maxi length is always a big hit and a touch of black at the bottom adds a unique finish. |,|$36.75$|,||,|KATE-MACK-EAU-SO-FRENCH-MAXI-DRESS|,|$URL$kate-mack-eau-so-french-maxi-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-eau-so-french-maxi-dress-3.jpg||-||Kate Mack Feeling Groovy Chiffon Swimsuit Coverup|,|^|The ""Feeling Groovy"" collection by Kate Mack is filled with a fun inspiration. The pink background is decorated with a floral pattern. The chiffon coverup is flowy and sweet, perfect for her days lounging by the pool or on the beach. Match the suits for cute sister pairs!! ^||,|$39.00$|,||,|KATE-MACK-FEELING-GROOVY-CHIFFON-SWIMSUIT-COVERUP|,|$URL$kate-mack-feeling-groovy-chiffon-swimsuit-coverup.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-feeling-groovy-chiffon-swimsuit-coverup-3.jpg||-||Kate Mack Feeling Groovy Girls Bikini|,|^|Designed to dazzle, this new girls swimsuit from Kate Mack is part of the ""Feeling Groovy"" collection. The floral print is large and fun while the bikini top has a halter strap around her neck. Fringe tassels are found on both hips of the matching bottoms. Matches other new arrivals from Kate Mack! SIZE 7 ONLY LEFT. ^||,|$44.00$|,||,|KATE-MACK-FEELING-GROOVY-GIRLS-BIKINI|,|$URL$kate-mack-feeling-groovy-girls-bikini.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-feeling-groovy-girls-bikini-3.jpg||-||Kate Mack Garden Stripe Girls Dress|,|^|Sweet and adorable, this new girls dress comes from the fabulous designer Kate Mack. The dress features a wide neckline and small cap sleeves. A trio of flowers is found just beneath the neckline to match the thin stripes that wrap across the piece. Pin tucks fall down the dress and wrap towards the left, this helps create the shape and fit. From the curve of these tucks, ruffles fall to make the fun hemline. The back is fastened closed for an easy fit. SIZE 6 ONLY LEFT.  ^||,|$44.25$|,||,|KATE-MACK-GARDEN-STRIPE-GIRLS-DRESS|,|$URL$kate-mack-garden-stripe-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-garden-stripe-girls-dress-1.jpg||-||Kate Mack Girls Bikini Cirque De Soleil |,|^|One of the many fabulous girls aqua swimsuits to fill our boutique for this season, this new arrival is from Kate Mack. The bikini top is covered in flowers and offers her adjustable straps and a halter neckline. The matching skirted bottom is simply beyond gorgeous! The full volume is created by layers of fun mesh ruffles. SIZE 4 AND 5 ONLY LEFT.  ^||,|$56.00$|,||,|KATE-MACK-GIRLS-BIKINI-CIRQUE-DE-SOLEIL|,|$URL$kate-mack-girls-bikini-cirque-de-soleil.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-girls-bikini-cirque-de-soleil-1.jpg||-||Kate Mack Girls Color Block Swimsuit What is Hip|,|^|New from designer Kate Mack, this girls swimsuit is available in tween sizes only. The one piece suit offers her thin straps and a trendy pattern. The color block features green, pink, and a black mod print. The frames are divided with black. This suit is easy to match with her beach accessories. SIZE 8 AND 10 ONLY LEFT.  ^||,|$49.00$|,||,|KATE-MACK-GIRLS-COLOR-BLOCK-SWIMSUIT-WHAT-HIP|,|$URL$kate-mack-girls-color-block-swimsuit-what-hip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-girls-color-block-swimsuit-what-is-hip-1.jpg||-||Kate Mack Girls Dress a Star is Born|,|^|Catching the light with her every movement, this new Kate Mack girls dress is perfect for any event this winter. The sleeveless dress is covered in small sequins and is fully lined for her comfort. Silver sequins create several falling stars down the front. Offering a slight stretch, this dress is meant to pull over her head. Polyester, hand wash with care and line dry. SIZE 4 LEFT. ^||,|$39.00$|,||,|KATE-MACK-GIRL-HOLIDAY-DRESS-STAR-BORN|,|$URL$kate-mack-girl-holiday-dress-star-born.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-girls-dress-a-star-is-born-16.jpg||-||Kate Mack Girls Dress in Flower Print|,|In a modern print and style, this new designer dress for girls comes from Kate Mack. The drop waist dress is covered in flowers with a small touch of pink found at the center. The long sleeves are striped in white and black while a pink belt is worn around the waist. The skirt has a scallop look in alternating black and white. The dress is fastened in the back and is made from a comfortable fabric she can wear all day long without a care. Cotton/Polyester/Spandex. Hand wash in cold water. Hang to dry. |,|$66.00$|,||,|KATE-MACK-GIRLS-DRESS-FLOWER-PRINT|,|$URL$kate-mack-girls-dress-flower-print.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-girls-dress-in-flower-print-preorder-10.jpg||-||Kate Mack Girls Faux Fur Vest in Snow Leopard Print|,|Created to compliment her new Kate Mack outfits, this fabulous faux fur vest for girls is a must have piece for winter! The snow leopard print is a cool grey and makes it easy to pair with several different styles. The vest is lined in a silver polyester that keeps her layers from bunching. Two silver ruffles wrap around the front while a large bow sits just beneath the neckline. The vest is closed with hidden fasteners. Faux Fur/Acrylic/Polyester. Dry clean only. |,|$64.00$|,||,|KATE-MACK-GIRLS-FAUX-FUR-VEST-SNOW-LEOPARD-PRINT|,|$URL$kate-mack-girls-faux-fur-vest-snow-leopard-print.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-girls-faux-fur-vest-in-snow-leopard-print-23.jpg||-||Kate Mack Girls Maxi Dress Cirque De Soleil|,|^|Kate Mack especially made this beautiful dress for her casual vacation days. The long piece falls with thin stripes in a delicate mix of shades. The high low hemline is wrapped with three ruffles to match the cap sleeves. A single flower is found near the wide neckline. A couple bands run across her back. This dress has a pull over fit and is as comfortable as can be! SIZE 4 AND 5 ONLY LEFT.  ^||,|$39.00$|,||,|KATE-MACK-GIRLS-MAXI-DRESS-CIRQUE-DE-SOLEIL|,|$URL$kate-mack-girls-maxi-dress-cirque-de-soleil.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-girls-maxi-dress-cirque-de-soleil-1.jpg||-||Kate Mack Girls Maxi Dress in Garden Stripe|,|^|Blending a popular trend with a new style, this fabulous girls dress comes from Kate Mack in their ""Garden Stripe"" collection. The dress features a soft fabric that has a slight stretch in it. The scoop neckline boasts of a racer back style that welcomes warm sun rays. Three cute flowers are found just below the neck to match the fun thin stripes. The hem is skewed to the right, standing apart from all other summer dresses. ^||,|$36.00$|,||,|KATE-MACK-GIRLS-MAXI-DRESS-GARDEN-STRIPE|,|$URL$kate-mack-girls-maxi-dress-garden-stripe.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-girls-maxi-dress-in-garden-stripe-1.jpg||-||Kate Mack Girls Pink Striped Swimsuit|,|^|Simply adorable, this new swimsuit from Kate Mack is unforgettable. A bow is tied on both hips and creates the gathered look on her sides. The top is textured with small flowers lined in stripes and a halter strap fastens behind her neck. Thin little stripes run down the suit. The pattern matches several other suits from the ""Candy Carnival"" collection for sister pairs. ^||,|$54.00$|,||,|KATE-MACK-GIRLS-PINK-STRIPED-SWIMSUIT|,|$URL$kate-mack-girls-pink-striped-swimsuit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-girls-pink-striped-swimsuit-3.jpg||-||Kate Mack Girls Puffer Vest in Pink|,|A casual piece of girls outerwear for the coming season, this new winter vest is from Kate Mack. The vests boasts of a bright lime lining and zipper that runs up the front. The collar and zipper line are accented with quaint ruffles. The puffer vest is a classic style and has two front pockets. This vest is designed for a more fitted look. 100% Polyester. Machine wash cold. Tumble dry on low. |,|$66.00$|,||,|KATE-MACK-DESIGNER-WINTER-VEST-GIRLS-PINK|,|$URL$kate-mack-designer-winter-vest-girls-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-girls-puffer-vest-in-pink-1.jpg||-||Kate Mack Girls Red Winter Hat with Flowers|,|^|A darling hat, this creation from Kate Mack is the perfect match to the new ""Kate Mack Red Holiday Coat for Girls."" The hat offers warm fabric and a comfortable fit. A few matching flower cut outs are attached near the brim. This hat is worn like a traditional beret style. 100% Polyester. Machine wash cold with like colors. Tumble dry on low.   ^||,|$29.00$|,||,|KATE-MACK-GIRLS-RED-WINTER-HAT-FLOWERS|,|$URL$kate-mack-girls-red-winter-hat-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-girls-red-winter-hat-with-flowers-preorder-7.jpg||-||Kate Mack Girls Sequin Top in Zebra Print PREORDER|,|^|This new top from designer Kate Mack is a fabulous piece that she will love to wear to school! The black top boasts of long sleeves and a comfortable fabric that allows slight stretch in fit. The front is covered with a zebra animal print created by black and silver sequins. This top matches the new pleather shorts and jeggings that are also available from Kate Mack's ""Wild Princess"" collection. Please note that this Kate Mack item is a PreOrder and is NOT currently in stock. This item is expected to arrive in stock between July 31, 2014 and September 5, 2014. ^||,|$46.00$|,||,|KATE-MACK-GIRLS-SEQUIN-TOP-ZEBRA-PRINT|,|$URL$kate-mack-girls-sequin-top-zebra-print.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-girls-sequin-top-in-zebra-print-preorder-1.jpg||-||Kate Mack Girls Striped Tee with Tulle Skirt|,|An outfit sure to receive many compliments, this girls top and skirt come from fabulous Kate Mack. The striped top features long sleeves with slight gathers near both cuffs and a trio of fabric flowers off centered near the neckline. The accompanying skirt is a deep navy blue and adds character with the tiers of blue tulle ruffles that wrap around the skirt from waist the hemline. matching flowers also embelish the skirt. Top is created with a cotton polyester blend, the skirt: cotton-polyblend with a 100% polyester ruffle. Machine wash and tumble dry on low. |,|$49.20$|,||,|KATE-MACK-GIRLS-STRIPED-TEE-TULLE-SKIRT|,|$URL$kate-mack-girls-striped-tee-tulle-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-girls-striped-tee-with-tulle-skirt-3.jpg||-||Kate Mack Girls Tank Swimsuit Garden Stripe|,|Kate Mack designed this fabulous swimsuit for the coming vacation season. Thin stripes run around the swimsuit in pink, yellow, and blue. Tied bows sit on the hips and the halter strap is adjustable. The front of the top is covered in colorful roses. The unique color blend brings with it a spirit of fun that is not easy to find. She is sure to love this suit whether she is at the beach or laying by the pool. |,|$56.00$|,||,|KATE-MACK-GIRLS-TANK-SWIMSUIT-GARDEN-STRIPE|,|$URL$kate-mack-girls-tank-swimsuit-garden-stripe.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-girls-tank-swimsuit-garden-stripe-1.jpg||-||Kate Mack Girls Tee and Long Skirt in Lilac Lace|,|Sure to make all of her friends envious, this beautiful new outfit comes from loved designer Kate mack. The long sleeve lilac top boasts of a delicate lace print while a touch of sparkle is added to the front with gems. Gathers add a splace of character to the cuffs of her long sleeves. Paired with a beautiful long skirt with a stretch fit waist and tiers of handkerchief tulle layers that fall from waist to hem. Top: Made with cotton blend. Machine wash cold, line dry. Skirt: Made with cotton blend. Machine wash cold, line dry. |,|$58.80$|,||,|KATE-MACK-GIRLS-TEE-LONG-SKIRT-LILAC-LACE|,|$URL$kate-mack-girls-tee-long-skirt-lilac-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-girls-tee-and-long-skirt-in-lilac-lace-2.jpg||-||Kate Mack Girls Tunic and Legging Puppy Love|,|A cute new outfit for your darling daughter, this tunic and legging set is filled with a Parisian feel from Kate Mack. The tunic features a sweet puppy screen print upon the front. The long sleeves are covered in thin stripes to match the accent on her neckline. This top is finished with two layers of sheer ruffles in polka dot and black. Matching leggings are worn beneath and compliment the top perfectly. Cotton/Polyester/Spandex. Place garment inside out in mesh a laundry bag and machine wash cold. Hang to dry. |,|$82.00$|,||,|KATE-MACK-GIRLS-TUNIC-LEGGING-PUPPY-LOVE|,|$URL$kate-mack-girls-tunic-legging-puppy-love.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-girls-tunic-and-legging-puppy-love-17.jpg||-||Kate Mack Girls Winter Coat Polar Perfection Gray|,|Designed by Kate Mack, this new girls winter coat is a fun piece she can wear to any event. The charcoal grey fabric is comfortable to wear and is sure to keep her warm. The collar is dressed with sweet felt flowers in cream, grey, black and red. The same colors adorn the hemline. The structured shape is created with two pin tucks. A matching hat is available while quantities last! 100% Polyester. Machine wash cold inside out. Tumble dry on low. |,|$88.00$|,||,|KATE-MACK-GIRLS-WINTER-COAT-POLAR-PERFECTION-GRAY|,|$URL$kate-mack-girls-winter-coat-polar-perfection-gray.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-girls-winter-coat-polar-perfection-gray-1.jpg||-||Kate Mack Go for Glitz Black Swimsuit|,|^|Standing out amongst the crowd of new arrivals, this tween swimsuit was designed by the beloved brand, Kate Mack. The solid black tank suit offers a double strap with a pop of light color and cute gathers that give a flattering shape. The center of the front is dressed with sequins that catch the light. SIZE 7 AND 10 ONLY LEFT. ^||,|$56.00$|,||,|KATE-MACK-GO-GLITZ-BLACK-SWIMSUIT|,|$URL$kate-mack-go-glitz-black-swimsuit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-go-for-glitz-black-swimsuit-1.jpg||-||Kate Mack Gray Boho Ballerina Little Girls Dress|,|^|A design she will never want to take off, this new Kate Mack infant and toddler dress comes from the adorable Boho Ballerina collection. The soft gray striped bodice boasts of its gathers at the shoulder, a pink tulle rosette, and a line of 4 buttons closing the back. A thin, gray tulle bow ties at the back of her waist while the soft tiers of tulle creating the skirt ends with a bright candy pink. Cotton blend and 100% polyester, machine wash with care. SIZE 3T LEFT. ^||,|$29.00$|,||,|KATE-MACK-GRAY-BOHO-BALLERINA-LITTLE-GIRLS-DRESS|,|$URL$kate-mack-gray-boho-ballerina-little-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-gray-boho-ballerina-little-girls-dress-21.jpg||-||Kate Mack Grey Pretty Kitty Ruffle Dress|,|^|From designer Kate Mack for the fall and winter season, this girls dress comes from their collection ""Pretty Kitty."" The long sleeve bodice is solid light grey and offers a hidden zipper that closes up the back. A subtle touch of color is added through the sparkling gems that dance just beneath the neckline. The fun, unique skirt is draped with sheer grey ruffles with a striped look. Made with a cotton blend and accented with 100% polyester ruffles. Machine wash and hang to dry. ^||,|$39.00$|,||,|KATE-MACK-GREY-PRETTY-KITTY-RUFFLE-DRESS|,|$URL$kate-mack-grey-pretty-kitty-ruffle-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-grey-pretty-kitty-ruffle-dress-2.jpg||-||Kate Mack Heavenly Roses Girls Bikini|,|^|A fresh design from popular Kate Mack, this suit was cut to impress. The classic bikini top has a halter strap and an adjustable strap that fastens on her back. Matching pink bottoms feature a waist that is lined with sweet flowers that match the top. SIZE 10 ONLY AVAILABLE. ^||,|$54.00$|,||,|KATE-MACK-HEAVENLY-ROSES-GIRLS-BIKINI|,|$URL$kate-mack-heavenly-roses-girls-bikini.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-heavenly-roses-girls-bikini-3.jpg||-||Kate Mack Heavenly Roses One Piece Swimsuit|,|Styled by Kate Mack, this girls swimsuit will create great memories. The light pink is accented with sweet flowers that dress the straight neckline graced with thin straps. The mesh skirt is covered with ruffles while matching flowers are off centered on the waist. |,|$52.00$|,||,|KATE-MACK-HEAVENLY-ROSES-ONE-PIECE-SWIMSUIT|,|$URL$kate-mack-heavenly-roses-one-piece-swimsuit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-heavenly-roses-one-piece-swimsuit-6.jpg||-||Kate Mack Heavenly Roses Tunic with Shorts|,|A truly fabulous casual look from Kate Mack, this little girls outfit is darling! The fitted bodice is covered with flowers while wide ruffle tiers fall from the empire waist. Matching pink shorts are worn beneath. |,|$49.00$|,||,|KATE-MACK-HEAVENLY-ROSES-TUNIC-LEGGING|,|$URL$kate-mack-heavenly-roses-tunic-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-heavenly-roses-tunic-with-shorts-2.jpg||-||Kate Mack Hooded Swimsuit Coverup Water Sprite|,|A soft Kate Mack coverup made to match her new swimsuit. The fabric keeps her warm and cozy after she gets out of the water. Two pockets help her hands find a home and the zipper runs up the front to the hood. Patches of light colors mix and match to make this a one of a kind piece. |,|$36.75$|,||,|KATE-MACK-HOODED-SWIMSUIT-COVERUP-WATER-SPRITE|,|$URL$kate-mack-hooded-swimsuit-coverup-water-sprite.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-hooded-swimsuit-coverup-water-sprite-3.jpg||-||Kate Mack Infant Bikini Seaside Petals|,|^|New from the ""Seaside Collection"" by well known and well loved designer Kate Mack, this baby bikini is made to match several other creations for your family vacations. The bikini top is covered with navy and white petals arranged in stripes and offers thin, white stripes. The matching navy bottoms boast only of the single row of petals adorning the front of her waist. 6 MOS ONLY LEFT.  ^||,|$19.00$|,||,|KATE-MACK-INFANT-TODDLER-BIKINI-SEASIDE-PETALS|,|$URL$kate-mack-infant-toddler-bikini-seaside-petals.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-infant-and-toddler-bikini-seaside-petals-13.jpg||-||Kate Mack Infant Candy Carnival Bikini|,|^|Made for fun, this Kate Mack bikini is sure to see many days of fun in the sun. The light pink is layered with white on the bandeaux top. Petal flowers are attached for the perfect texture. The bottoms match and are accented only by a row of flowers on her waist. (1) 6 MOS AND (1) 24 MOS LEFT.  ^||,|$48.00$|,||,|KATE-MACK-INFANT-TODDLER-CANDY-CARNIVAL-BIKINI|,|$URL$kate-mack-infant-toddler-candy-carnival-bikini.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-infant-candy-carnival-bikini-1.jpg||-||Kate Mack Infant Girls Swimsuit Garden Stripe|,|^|Beyond adorable, this infant swimsuit from Kate Mack is unforgettable. Sweet roses line the top while the thin straps are found on the shoulders. Blue, pink, yellow, and white stripe the bubble shaped suit. The ""Garden Stripe"" collection is filled with an innocent cuteness and swimsuits for her older sisters! ^||,|$54.00$|,||,|KATE-MACK-INFANT-GIRLS-SWIMSUIT-GARDEN-STRIPE|,|$URL$kate-mack-infant-girls-swimsuit-garden-stripe.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-infant-girls-swimsuit-garden-stripe-1.jpg||-||Kate Mack Jenny Annie Dots Girls Ballerina Swimsuit |,|^|Too adorable! This new infant and toddler swimsuit comes from Kate Mack. The white suit is covered in black polka dots while trimmed with pink. A large pink bow is found at the straight neckline while layers of matching tulle ruffles create a fun ballerina skirt. Matches many other new arrivals from the ""Jenny Annie Dots"" collection. ONE SIZE 3MOS ONLY LEFT.  ^||,|$19.00$|,||,|KATE-MACK-JENNY-ANNIE-DOTS-GIRLS-BALLERINA-SWIMSUIT|,|$URL$kate-mack-jenny-annie-dots-girls-ballerina-swimsuit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-jenny-annie-dots-girls-ballerina-swimsuit-13.jpg||-||Kate Mack Lace Confections Tunic with Legging|,|^|Part of Kate Mack's fall 2013 collection ""Lace Confections"" this new arrival is sweet as can be. The lilac tunic boasts of warm long sleeves, a cute flower embellishment on the bodice and a handkerchief hem created with layers of tulle ruffles draping in tiers. The bodice offers two structuring tucks to give a great shape. Matching leggings are paired beneath with a comfy elastic hemline. Both pieces are covered with an exquisite lace print. Made with cotton blend. Machine wash cold, line dry. (1) SIZE 4 REMAINING. ^||,|$43.20$|,||,|KATE-MACK-LACE-CONFECTIONS-TUNIC-LEGGING|,|$URL$kate-mack-lace-confections-tunic-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-lace-confections-tunic-with-legging-2.jpg||-||Kate Mack Lilac Girls Hat Lace Confections|,|^|New from Kate Mack, this hat is designed to finish off many of their new fall outfits with style. The solid color hat is a unique shade of purple found in Kate Mack's ""Lace Confections"" collection for fall 2013. The hat boasts only of the sweet tulle flowers found near the brim. Be sure to check out all of Kate Mack's new arrivals! Made with a cotton blend. Hand wash warm, lay flat to dry. ^||,|$17.40$|,||,|KATE-MACK-LILAC-GIRLS-HAT-LACE-CONFECTIONS|,|$URL$kate-mack-lilac-girls-hat-lace-confections.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-lilac-girls-hat-lace-confections-2.jpg||-||Kate Mack Lime Green Girls Hooded Coverup|,|^|Pairing perfectly with her new swimsuit, this girls coverup comes from Kate Mack. The lime coverup is lined in fun stripes and gives her a cozy hood. The shark bite hem and the kangaroo pocket add to her comfort level. The colors in this piece specifically match the ""Garden Stripe"" collection. ^||,|$36.00$|,||,|KATE-MACK-LIME-GREEN-GIRLS-HOODED-COVERUP|,|$URL$kate-mack-lime-green-girls-hooded-coverup.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-lime-green-girls-hooded-coverup-1.jpg||-||Kate Mack Lovebirds Baby Girls Swimsuit|,|Blending beautiful colors together, this new designer suit from Kate Mack is available for infants and toddlers. The wide straps grace her shoulders and a row of flowers are at the neckline. Cascading ruffles fall from the flowers down the suit, creating a truly dreamy look. The light blue and fairy purple are shades familiar to any young girls dreams. Look for the matching pieces to dress a pair of sisters! |,|$52.00$|,||,|KATE-MACK-LOVEBIRDS-BABY-GIRLS-SWIMSUIT|,|$URL$kate-mack-lovebirds-baby-girls-swimsuit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-lovebirds-baby-girls-swimsuit-1.jpg||-||Kate Mack Monte Carlo Girls Bikini|,|Ready for some water fun, this new girls bikini from Kate Mack will be the talk of the pool. The top features a thin halter strap and a beautiful navy and white polka dot print. The center is gathered for a bandeaux fit and a single flower accents. The matching bottoms are skirted with ruffling tiers and are also adorned with the same flowers off centered at the waist. Made with nylon blend. Hand wash cold, line dry. |,|$54.00$|,||,|KATE-MACK-MONTE-CARLO-GIRLS-BIKINI|,|$URL$kate-mack-monte-carlo-girls-bikini.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-monte-carlo-girls-bikini-14.jpg||-||Kate Mack Monte Carlo Infant and Toddler Bikini|,|A timeless pattern from Kate Mack, this infant and toddler girls bikini is a graceful choice. The straight top is framed with striped edging to match the thin straps while a single flower is found just beneath her right shoulder. The large white polka dots and navy background is also found on the bottoms along with the same fun flowers! Made with nylon blend. Hand wash cold, line dry. |,|$42.00$|,||,|KATE-MACK-MONTE-CARLO-INFANT-TODDLER-BIKINI|,|$URL$kate-mack-monte-carlo-infant-toddler-bikini.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-monte-carlo-infant-and-toddler-bikini-15.jpg||-||Kate Mack Monte Carlo Navy Blue Girls Dress|,|An effortless cruise look, this new girls dress comes from Kate Mack. The bodice features a thin stripe print and a relaxed racer back neckline. The skirt is covered with white ruffles trimmed in navy thread that fall beautifully from the waist to the hem. A single bow is found attached to the neck. Made with cotton blend. Machine wash cold, tumble dry low. |,|$49.00$|,||,|KATE-MACK-MONTE-CARLO-NAVY-BLUE-GIRLS-DRESS|,|$URL$kate-mack-monte-carlo-navy-blue-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-monte-carlo-navy-blue-girls-dress-1.jpg||-||Kate Mack Monte Carlo Skirt Set|,|^|One of the cutest outfits of the season, this new Kate Mack design is a fabulously casual look. A sleeveless top features an elegant lady and her dog accented with small pops of color. The navy stripes race up her back and on her shoulders. A sweet matching skirt boasts of fun ruffles that fall into an uneven hemline. Made with cotton blend. Machine wash cold, tumble dry low. SIZE 5 AND 6 ONLY REMAINING.  ^||,|$63.00$|,||,|KATE-MACK-MONTE-CARLO-SKIRT-SET|,|$URL$kate-mack-monte-carlo-skirt-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-monte-carlo-skirt-set-1.jpg||-||Kate Mack Monte Carlo Swimsuit Coverup|,|To match her favorite new swimsuit this season, this Kate Mack coverup is part of the Monte Carlo collection. The lining is a small polka dot print while thin stripes race around the outside. A kangaroo pocket is found on the front and a cozy hood adds comfort. The hem finishes in a shark bite hem. Made with cotton blend. Machine wash cold, tumble dry low. |,|$36.75$|,||,|KATE-MACK-MONTE-CARLO-SWIMSUIT-COVERUP|,|$URL$kate-mack-monte-carlo-swimsuit-coverup.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-monte-carlo-swimsuit-coverup-1.jpg||-||Kate Mack Navy Blue Girls Romper|,|A fun design from one of our top brands, Kate Mack, she is sure to love this romper. The thin straps tie in a bow on the top of her shoulders while the neckline is decorated with ruffles. A drawstring waist adds shape while comfy pockets are found just beneath. The navy and white stripes continue down to the hem of both legs. Made with cotton blend. Machine wash cold, tumble dry low. |,|$42.00$|,||,|KATE-MACK-NAVY-BLUE-GIRLS-ROMPER|,|$URL$kate-mack-navy-blue-girls-romper.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-navy-blue-girls-romper-1.jpg||-||Kate Mack Navy Blue Striped Girls Leggings|,|^|Easy to pair beneath her favorite skirts and dresses, Kate Mack is now offering the navy striped leggings to match pieces from the ""Poodle in Paris"" collection. The leggings are made with a fabric that allows stretch for the classic, fitted look. The navy blue is striped by white from the elastic waist to the hem of both legs. Legging is created with a cotton polyester blend. Machine wash and tumble dry on low. ^||,|$9.00$|,||,|KATE-MACK-NAVY-BLUE-STRIPED-GIRLS-LEGGINGS|,|$URL$kate-mack-navy-blue-striped-girls-leggings.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-navy-blue-striped-girls-leggings-2.jpg||-||Kate Mack Party Dress for Girls with Sequins Zebra PREORDER|,|^|For your fashionable daughter, this new girls party dress from Kate Mack is from their ""Wild Princess"" collection. The dress is cut for a fitted look with a straight hemline. The long sleeves are solid black, matching the back of the dress. The front is covered with a silver and black sequin design creating a zebra print. There are three buttons that fasten on her back. This dress boasts of an easy and comfortable fit that is filled with style and glitz! Please note that this Kate Mack item is a PreOrder and is NOT currently in stock. This item is expected to arrive in stock between July 31, 2014 and September 5, 2014. ^||,|$62.00$|,||,|KATE-MACK-PARTY-DRESS-GIRLS-SEQUINS-ZEBRA|,|$URL$kate-mack-party-dress-girls-sequins-zebra.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-party-dress-for-girls-with-sequins-zebra-preorder-5.jpg||-||Kate Mack Picnic in Provence Girls Halter Dress|,|From Kate Mack, this dress lends a carefree, fun spirit to all who wear it. The bodice wraps into a V-neckline while the pink gingham ties behind her neck. A matching sash ties around the waist while the skirt opens in shape and ends with a bubble hemline. Made with cotton blend. Machine wash cold, tumble dry low. |,|$55.50$|,||,|KATE-MACK-PICNIC-PROVENCE-GIRLS-HALTER-DRESS|,|$URL$kate-mack-picnic-provence-girls-halter-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-picnic-in-provence-girls-halter-dress-1.jpg||-||Kate Mack Picnic in Provence Short Set|,|A darling outfit, this new arrival from designer Kate Mack is decorated just in her favorite style! The solid white tank is dress in bows in pastel gingham. Matching shorts fasten with a button and feature belt loops and ruffled tiers at the hem. Made with cotton blend. Machine wash cold, tumble dry low. |,|$49.00$|,||,|KATE-MACK-PICNIC-PROVENCE-SHORT-SET|,|$URL$kate-mack-picnic-provence-short-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-picnic-in-provence-short-set-1.jpg||-||Kate Mack Pink Stripe Bikini Candy Carnival|,|^|Made with style and quality, this classic Kate Mack bikini will fill your little girl's eyes with delight. The bottoms are a solid pink and boast only of the row of flowers that sit on the front of her waist. The top matches, covered in petal flowers and finished with a halter strap. The straps are adjustable for her own personal fit. (1) 10 REMAINING.  ^||,|$52.00$|,||,|KATE-MACK-PINK-STRIPE-BIKINI-CANDY-CARNIVAL|,|$URL$kate-mack-pink-stripe-bikini-candy-carnival.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-pink-stripe-bikini-candy-carnival-7.jpg||-||Kate Mack Pinwheel Petals Baby Girls Bikini in Pink |,|^|With a contagious spirit, this new baby girls bikini comes from designer Kate mack. The pink bikini top boasts of thin straps, a straight shape, and a pinwheel flower made with petals in alternating colors. The matching bottoms are skirted with matching petals dangling from her waist. Matches perfectly to her older sisters one piece ""Pinwheel Petals"" swimsuit. 3 MOS ONLY REMAINING. ^||,|$19.00$|,||,|KATE-MACK-PINWHEEL-PETALS-BABY-GIRLS-BIKINI-PINK|,|$URL$kate-mack-pinwheel-petals-baby-girls-bikini-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-pinwheel-petals-baby-girls-bikini-in-pink-12.jpg||-||Kate Mack Pleather Shorts for Girls Black PREORDER|,|^|A trendy new arrival, this design by Kate Mack is a must have piece! These pleather shorts for girls are in solid, jet black which allows them to be paired with many different tops. The shorts are dressed with a shimmering button and a zipper to close the fit. Belt loops are found on the waist while the front pockets are trimmed in ruffles. Three pleather ruffles wrap around the hem of both legs and traditional back pockets are found on these shorts. Please note that this Kate Mack item is a PreOrder and is NOT currently in stock. This item is expected to arrive in stock between July 31, 2014 and September 5, 2014. ^||,|$46.00$|,||,|KATE-MACK-PLEATHER-SHORTS-GIRLS-BLACK-PLEATHER|,|$URL$kate-mack-pleather-shorts-girls-black-pleather.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-pleather-shorts-for-girls-black-preorder-1.jpg||-||Kate Mack Polar Perfection Grey Winter Hat for Girls|,|Kate Mack has created this new girls hat to match the Polar Perfect coat from their fall and winter collection. The hat is styled in a beret style and is in the same charcoal shade. A small collection of flowers are found off centered to one side. These flowers are made from felt and are gathered for a unique look. This hat is lined and has a comfortable fit. 100% Cotton. Machine wash cold. Tumble dry on low. |,|$29.00$|,||,|KATE-MACK-POLAR-PERFECTION-GREY-WINTER-HAT-GIRLS|,|$URL$kate-mack-polar-perfection-grey-winter-hat-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-polar-perfection-grey-winter-hat-for-girls-1.jpg||-||Kate Mack Polka Dot Girls Bikini|,|^|So much fun! This new girls bathing suit was designed by Kate Mack as a part of their ""Eau So French"" collection. Small red and black dots cover the white suit while a fun ruffling skirt wraps around the bottoms. The halter top is accented with a striped bottom strap and a cute little bow. The accents found on the bottoms match perfectly! SIZE 10 ONLY LEFT.  ^||,|$54.00$|,||,|KATE-MACK-POLKA-DOT-GIRLS-BIKINI|,|$URL$kate-mack-polka-dot-girls-bikini.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-polka-dot-girls-bikini-3.jpg||-||Kate Mack Pretty Kitty Little Girls Pink Dress|,|Perfect for any celebration this fall and winter, this new little girls dress comes from designer Kate Mack. The empire bodice claims long sleeves complete with a touch of gathers near the cuffs and buttons that close up the back. Just underneath the neckline sparkling gems dance to the light. The skirt is covered with cascade ruffles in a sheer pink fabric with a striped look. Made with a cotton blend and accented with 100% polyester ruffles. Machine wash and hang to dry. |,|$39.60$|,||,|KATE-MACK-PRETTY-KITTY-LITTLE-GIRLS-PINK-DRESS|,|$URL$kate-mack-pretty-kitty-little-girls-pink-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-pretty-kitty-little-girls-pink-dress-2.jpg||-||Kate Mack Rash Guard Girls Swimsuit Feeling Groovy|,|In a modest cut to satisfy any mom, this new Kate Mack swimsuit is adorable! The half sleeve top has a classic fitted cut. Her shape is accented with color blocking with a fun floral print down the center. Matching patterned bottoms are paired with the top and finished with a tassel on both hips. |,|$54.00$|,||,|KATE-MACK-RASH-GUARD-GIRLS-SWIMSUIT-FEELING-GROOVY|,|$URL$kate-mack-rash-guard-girls-swimsuit-feeling-groovy.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-rash-guard-girls-swimsuit-feeling-groovy-3.jpg||-||Kate Mack Red and White Tutu Set|,|Dazzling in red, this cute new outfit comes from Kate Mack. The thin stripes are a timeless look while the bodice features a racerback fit. A large bow is found just beneath the neckline. The fun skirt has a layer of matching tulle and a pop of red at the hemline. Matching striped leggings are paired beneath to finish this look! |,|$57.00$|,||,|KATE-MACK-RED-WHITE-TUTU-SET|,|$URL$kate-mack-red-white-tutu-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-red-and-white-tutu-set-3.jpg||-||Kate Mack Red Holiday Coat for Girls|,|In time for the coming winter season, this new girls winter coat is from designer Kate Mack. The coat is created in a rich red, a popular and fabulous color for coats! This coat adds a pop of color to the monotone scenery of winter. The collar and hemline are dressed with matching flower cut outs. Some sparkling accents are found at the center of these flowers. Hidden buttons close the front while two pin tucks create the shape. While quantities last, a matching hat can also be found in Kate Mack's fall and winter collection. 100% Polyester. Machine wash inside out in cold water. Tumble dry on low. |,|$88.00$|,||,|KATE-MACK-RED-HOLIDAY-COAT-GIRLS|,|$URL$kate-mack-red-holiday-coat-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-red-holiday-coat-for-girls-preorder-12.jpg||-||Kate Mack Red Infant Regatta Girls Bikini |,|^|Fitted with this unique sailor spirit, her water fun will be endless courtesy of designer Kate Mack. The thin strapped bodice features a unique large bow that covers the front with its pleated sides and wide white middle. The accompanying bottoms are made with a solid red and boast of the red and white striped skirting around the waist. SIZE 6 MONTH AND 9 MONTH AVAILABLE  ^||,|$19.00$|,||,|KATE-MACK-RED-REGATTA-INFANT-GIRLS-BIKINI|,|$URL$kate-mack-red-regatta-infant-girls-bikini.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-red-infant-regatta-girls-bikini-12.jpg||-||Kate Mack Ruffle Dress for Girls in Blue Stripes|,|From designer Kate Mack, this new girls dress is a beautiful creation that she is sure to love. The blue and white stripes are inspired by Paris while a sweet ruffle graces the wide neckline. A large bow is found just beneath the neck as well. The back of the dress is fastened with a row of buttons. The skirt is covered with matching ruffles that fall from the drop waistline down to her hem. Cotton/Spandex/Polyester. Machine wash cold inside out. Tumble dry on low. |,|$76.00$|,||,|KATE-MACK-RUFFLE-DRESS-GIRLS-BLACK-STRIPES|,|$URL$kate-mack-ruffle-dress-girls-black-stripes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-ruffle-dress-for-girls-in-black-stripes-preorder-11.jpg||-||Kate Mack Silver Pleather Jacket Born Wild|,|^|Trendy and unique, this girls jacket from designer Kate Mack is unmatched by all others. The metallic silver pleather has a crisp, icy look perfect for winter. Pockets are placed on the front and the right side wraps over to zip up the coat. The inside is lined in a leopard print while the faux fur collar matches. Metallic Pleather:polyblend, Faux Fur: acrylic and polyester. Hand wash only and drip dry. SIZE 2T ONLY LEFT.  ^||,|$39.00$|,||,|KATE-MACK-SILVER-PLEATHER-JACKET-BORN-WILD|,|$URL$kate-mack-silver-pleather-jacket-born-wild.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-silver-pleather-jacket-born-wild-2.jpg||-||Kate Mack Strike A Pose Girls Sequin Party Dress|,|From one of my personal favorite collections to arrive this year from Kate Mack, this girls party dress is stunning! The solid grey dress offers buttons to close the back and a sharkbite hem. This straight shape is great to pair with a fashion belt, and is flattering to her slender shape. The long sleeves are covered with sequins in peacock colors, adding glitz. Made with a polyester blend. Hand wash cold, line dry. |,|$39.00$|,||,|KATE-MACK-STRIKE-POSE-GIRLS-SEQUIN-PARTY-DRESS|,|$URL$kate-mack-strike-pose-girls-sequin-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-strike-a-pose-girls-sequin-party-dress-2.jpg||-||Kate Mack Sunkissed Girls Swim Tank|,|^|Fabulously carefree, this new Kate Mack swimsuit is one of a kind. The one piece swimsuit boasts of bows on both hips that gathers the side. Straps wrap around her shoulders and flowers create a small accent. Match this to the other options in the ""Sunkissed Roses"" collection. ^||,|$52.00$|,||,|KATE-MACK-SUNKISSED-GIRLS-SWIM-TANK|,|$URL$kate-mack-sunkissed-girls-swim-tank.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-sunkissed-girls-swim-tank-3.jpg||-||Kate Mack Sunkissed Roses Girls Bikini|,|A swimsuit unlike any other that she owns, this fabulous new arrival comes from Kate Mack. The small rose print covers the piece while the bottoms feature a bow on both hips. The halter top has a unique scoop line accenting her neck and two tiers of matching ruffles. A quaint garden of flowers finishes this piece off perfectly. |,|$48.00$|,||,|KATE-MACK-SUNKISSED-ROSES-GIRLS-BIKINI|,|$URL$kate-mack-sunkissed-roses-girls-bikini.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-sunkissed-roses-girls-bikini-3.jpg||-||Kate Mack Sunkissed Roses Infant and Toddler Bikini|,|Ready to enjoy days in the sun and water, this new bikini comes from Kate Mack. The white suit features a straight top with thin straps, sweet flowers, and rows of ruffles that wrap around. The matching bottoms offer a skirt that goes fully around the waist covered in the same ruffles. |,|$49.00$|,||,|KATE-MACK-SUNKISS-ROSES-INFANT-TODDLER-BIKINI|,|$URL$kate-mack-sunkiss-roses-infant-toddler-bikini.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-sunkissed-roses-infant-and-toddler-bikini-2.jpg||-||Kate Mack Swan Lake Baby Girl Swimsuit|,|A perfectly elegant swimsuit for your baby girl, this arrival comes from Kate Mack. The two piece features a fanciful skirt that becomes the plumes of the beautiful swan that sits on the front. The light pink is perfectly girly and sure to help make this piece stand out from the rest. |,|$66.00$|,||,|KATE-MACK-SWAN-LAKE-BABY-GIRL-SWIMSUIT|,|$URL$kate-mack-swan-lake-baby-girl-swimsuit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-swan-lake-baby-girl-swimsuit-13.jpg||-||Kate Mack Swan Lake Girls Dress|,|^|A sweet dress for a sweet girl, this new arrival is part of Kate Mack's ""Swan Lake"" collection. The drop waist bodice is pale pink and has a sleeveless neckline. The skirt is dressed with tiers of tulle plums introduced by large satin bow. Large sequins create the graceful swan that sits on the front. ^||,|$49.50$|,||,|KATE-MACK-SWAN-LAKE-GIRLS-DRESS|,|$URL$kate-mack-swan-lake-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-swan-lake-girls-dress-2.jpg||-||Kate Mack Swiss Mocha Velour Tunic and Legging|,|^|Soft and adorable, this new girls outfit comes just in time for fall from designer Kate Mack. The long sleeve tunic is a mocha brown velour and offers her a high neckline, ruffled cuffs, and an attached beaded necklace complete with cute bows. The skirt of the tunic is made with layered ruffles in dusty pink lace and the same velour. The leggings paired beneath are just a solid brown. Made with a cotton blend. Machine wash cold, line dry. (1) SIZE 4 LEFT.  ^||,|$44.40$|,||,|KATE-MACK-SWISS-MOCHA-VELOUR-TUNIC-LEGGING|,|$URL$kate-mack-swiss-mocha-velour-tunic-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-swiss-mocha-velour-tunic-and-legging-2.jpg||-||Kate Mack Tahitian Sunset Bikini for Girls|,|^|Matching the ""Tahitian Sunset"" collection new from Kate Mack this season, this new girls bikini is one that she will adore to love. Coral zebra stripes cover the top. Matching bottoms are accented only with a tassel on both hips. Sequins and a single flower dress up the top. ^||,|$44.00$|,||,|KATE-MACK-TAHITIAN-SUNSET-BIKINI-GIRLS|,|$URL$kate-mack-tahitian-sunset-bikini-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-tahitian-sunset-bikini-for-girls-1.jpg||-||Kate Mack Tahitian Sunset Dress with Sequin|,|Adorable in cut and color, this new Kate Mack dress matches several of the new arrivals. The sleeveless neckline offers a comfortable racer back. The coral and yellow blend beautifully within this collection and creates a unique animal print accented with sequins. The hem is finished with a skewed angle that sets it apart from all the rest! |,|$39.00$|,||,|KATE-MACK-TAHITIAN-SUNSET-DRESS-SEQUIN|,|$URL$kate-mack-tahitian-sunset-dress-sequin.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-tahitian-sunset-dress-with-sequin-1.jpg||-||Kate Mack Tahitian Sunset Infant and Toddler Swimsuit|,|^|Truly unlike any other swimsuit, this ""Tahitian Sunset"" swimsuit comes from the fabulous designer Kate Mack. The yellow top has an adjustable halter strap that is dressed with sequins. The high volume of mesh ruffles fall from the hem in several layers. Solid yellow bottoms are worn beneath. ^||,|$54.00$|,||,|KATE-MACK-TAHITIAN-SUNSET-INFANT-TODDLER-SWIMSUIT|,|$URL$kate-mack-tahitian-sunset-infant-toddler-swimsuit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-tahitian-sunset-infant-and-toddler-swimsuit-1.jpg||-||Kate Mack Tahitian Sunset One Piece Swimsuit|,|A wild ride, this cute one piece swimsuit is part of the new creations arriving from Kate Mack. The coral suit is covered with an animal print that is sure to become the hit of the season. The bandeaux neckline features a halter strap that begins in the center with a flower and wraps around her neck. Small sequins are sprinkled on the front and a tassel is found on both hips. |,|$46.00$|,||,|KATE-MACK-TAHITIAN-SUNSET-ONE-PIECE-SWIMSUIT|,|$URL$kate-mack-tahitian-sunset-one-piece-swimsuit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-tahitian-sunset-one-piece-swimsuit-1.jpg||-||Kate Mack Tahitian Sunset Swim Coverup Chiffon|,|^|Created by Kate Mack to match her new favorite swimsuits, this girls coverup is perfect for wearing on her way to the pool or beach. The coral zebra print covers the sheer chiffon. The structured neckline boasts of the small accent of sequins. The light weight fabric drapes beautifully and flows with her every move. SIZE 12 AND 14 ONLY LEFT.  ^||,|$39.00$|,||,|KATE-MACK-TAHITIAN-SUNSET-SWIM-COVERUP-CHIFFON|,|$URL$kate-mack-tahitian-sunset-swim-coverup-chiffon.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-tahitian-sunset-swim-coverup-chiffon-1.jpg||-||Kate Mack Toddler and Infant Bikini Heavenly Roses|,|In the popular bandeaux style, this new Kate Mack swimsuit is simply a doll. The top boasts of its darling flowers and thin straps. The matching bottoms feature the same flowers on the waist. This suit is great for the beach and for the pool! |,|$48.00$|,||,|KATE-MACK-TODDLER-INFANT-BIKINI-HEAVENLY-ROSES|,|$URL$kate-mack-toddler-infant-bikini-heavenly-roses.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-toddler-and-infant-bikini-heavenly-roses-3.jpg||-||Kate Mack Tulle Tunic and Legging for Little Girls|,|Created by Kate Mack, this new little girls tunic set is a cute outfit that all will compliment! The empire bodice offers long sleeves and is covered with a fun grey and pink polka dot print. Two tulle flowers sit on the neckline complete with shimmering centers. Three buttons fasten on her back for an easy and comfortable fit. The skirt of the tunic is created by layers and layers of sheer tulle in the same grey and pink shades. Striped leggings accompany the tunic to be worn beneath. Cotton/Polyester/Spandex. Place in mesh laundry bag and machine wash cold. Hang to dry. |,|$68.00$|,||,|KATE-MACK-TULLE-TUNIC-LEGGING-LITTLE-GIRLS|,|$URL$kate-mack-tulle-tunic-legging-little-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-tulle-tunic-and-legging-for-little-girls-preorder-11.jpg||-||Kate Mack Tutu Girls Tankini Lovebirds|,|^|From the ""Love Birds"" collection by designer Kate Mack, this fabulous tankini will be all the rage. The light blue top has thin straps while two flowers are found near the straight neckline. Sprinkled sequins sparkle on the blue. A fairy skirt of ruffles wraps around the hem. Solid bottoms are paired beneath. The whimsical purple shade is a beautiful addition to this swimsuit. 2T AND 4 ONLY LEFT.  ^||,|$54.00$|,||,|KATE-MACK-TUTU-GIRLS-TANKINI-LOVEBIRDS|,|$URL$kate-mack-tutu-girls-tankini-lovebirds.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-tutu-girls-tankini-lovebirds-1.jpg||-||Kate Mack Tween Fringe Bikini Feeling Groovy|,|^|She is sure to feel groovy in this classic throwback style from Kate Mack. This tween girls swimsuit features a bandeaux top, double straps, and a fun floral print. Long fringe falls from the hem, dancing with her movement. The matching bottoms have the same bold print and tassels of fringe on both hips. SIZE 8 ONLY LEFT. ^||,|$52.00$|,||,|KATE-MACK-TWEEN-FRINGE-BIKINI-FEELING-GROOVY|,|$URL$kate-mack-tween-fringe-bikini-feeling-groovy.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-tween-fringe-bikini-feeling-groovy-2.jpg||-||Kate Mack Water Sprite Flutter Girls Bikini|,|^|Cut in a style unlike any other, this new girls bikini is from Kate Mack's ""Water Sprite"" collection. The fun bodice features wide straps that criss-cross in the back. Two quaint flowers are found by the scoop neckline and a fun ruffle flutters at the hem. The matching flower print bottoms are accented only by a flower on her right hip. SIZE 6 AND 8 ONLY LEFT.  ^||,|$48.00$|,||,|KATE-MACK-WATER-SPRITE-FLUTTER-GIRLS-BIKINI|,|$URL$kate-mack-water-sprite-flutter-girls-bikini.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-water-sprite-flutter-girls-bikini-3.jpg||-||Kate Mack Water Sprite Tunic with Shorts|,|Light and cheery, this new girls outfit comes from designer Kate Mack. The cute top has a blue empire waist, thin straps, and a single flower on the bodice. The three tiers have cute little flowers in their darling pattern. Solid light blue shorts are worn beneath and a single pink flower is found on both legs. |,|$43.50$|,||,|KATE-MACK-WATER-SPRITE-TUNIC-CAPRI|,|$URL$kate-mack-water-sprite-tunic-capri.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-water-sprite-tunic-with-capri-2.jpg||-||Kate Mack Yellow Girls Bikini Tahitian Sunset|,|^|Filled with exotic inspiration, this new girls bikini comes from the ""Tahitian Sunset"" collection by Kate Mack. The top offers a wider halter strap that sits comfortable at the back of her neck. The front is dressed with a few sequins and a single flower found in the center. The tutu skirt wraps around the waist of the matching bottoms. This skirt is made with yellow and coral mesh layers fall down to fairy hemline. SIZE 6X ONLY LEFT.  ^||,|$56.00$|,||,|KATE-MACK-YELLOW-GIRLS-BIKINI-TAHITIAN-SUNSET|,|$URL$kate-mack-yellow-girls-bikini-tahitian-sunset.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kate-mack-yellow-girls-bikini-tahitian-sunset-1.jpg||-||Katie Rose Ashley Girls Bloomer Dress in White|,|Beautiful in white, this new infant girls bloomer dress from Katie Rose will elegantly clothe your baby during the warmer months. The bodice boasts of the Ashley lace design on the front adorned with light pink flowers, short sleeves edged with lace, and a white satin waist that ties in a bow on her back. The bloomers boast only of their flower accents on each leg and a scalloped embroidered lace overlay skirt. Accompanied by a matching cap. Made from 100% cotton; Hand wash; Dry flat. |,|$79.00$|,||,|KATIE-ROSE-ASHLEY-GIRLS-BLOOMER-DRESS-WHITE|,|$URL$katie-rose-ashley-girls-bloomer-dress-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-ashley-girls-bloomer-dress-in-white-25.jpg||-||Katie Rose Baby Flower Girls Dress in Ivory|,|Designed by Katie Rose, this new baby girls gown is absolutely stunning! The empire bodice features 100% cotton and a sweet ivory shade. The waist is adorned with a satin belt that ties into a bow on her back and is covered with small floral blooms on the front. The full circle skirt is inspired by the dreamy tutu style and is created with two layers of matching ivory tulle. The top layer is decorated with an ivory satin hemline. This dress is wonderful for weddings, photographs, Easter, and so much more! 100% cotton. Hand wash and dry flat. |,|$39.00$|,||,|KATIE-ROSE-BABY-FLOWER-GIRL-DRESS-IVORY|,|$URL$katie-rose-baby-flower-girl-dress-ivory.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-baby-flower-girls-dress-in-ivory-1.jpg||-||Katie Rose Baby Girl Ivory Lace Gown with Bonnet|,|So sweet and gorgeous, this new infant girls take home gown from designer Katie Rose is a perfect choice for her first day home. The empire waist bodice features its soft cotton knit, arms edged in lace, and a wide ribbon adorned with lace that wraps around the front and ties in the back. The skirt ends with an elastic hem to keep her cute feet cuddled up and an embroidered mesh overlay with a floral design. Accompanied with a matching mesh bonnet boasting of the same wide ribbon bow to tie in the back. Made with 100% cotton, hand wash. |,|$119.00$|,||,|KATIE-ROSE-GIRLS-TAKE-HOME-SET|,|$URL$katie-rose-girls-take-home-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-baby-girl-ivory-lace-gown-with-bonnet-12.jpg||-||Katie Rose Baby Girl Party Dress in Ivory|,|The perfect ivory dress for any special occasion you might have this summer, this new onesie gown from Katie Rose is a sweet dream. The empire bodice is accented with short, ruffled sleeves and an ivory ribbon that ties in a cute bow at the back of her waist. The classic onesie snaps make this an easy and comfortable fit. Matching ivory tulle creates a skirt and is trimmed with the same satin ribbon. The accompanying lace headband is accented with a darling ivory flower, twin to the bloom that adorns the ribbon tied around her waist. Made with 100% cotton excluding the tulle and accents. Suggested hand wash and air dry. |,|$67.00$|,||,|KATIE-ROSE-BABY-GIRL-PARTY-DRESS-IVORY-GAYLE|,|$URL$katie-rose-baby-girl-party-dress-ivory-gayle.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-baby-girl-party-dress-in-ivory-11.jpg||-||Katie Rose Baby Girls Bloomer Dress and Hat Ivory Sara|,|^|New from infant designer Katie Rose, this Sara gown is beautiful. In a soft ivory, the knit bodice features an empire waist adorned with an embroidered flower embellishment that catches light just right and is framed with satin bows. The long sleeves are finished in a sweet lace while a satin tie creates a bow in the back. The bloomer legs finish in an elastic ruffle adorned with bows and a line of changing snaps while the mesh overlay is covered in satin ribbon that falls in lines from the waist down to the scalloped lace hem. A matching hat accompanies the gown, made with 100% cotton. Hand wash. SIZE 6 MONTH AND 9 MONTH REMAINING. ^||,|$86.00$|,||,|KATIE-ROSE-BABY-GIRLS-BLOOMER-DRESS-HAT-IVORY-SARA|,|$URL$katie-rose-baby-girls-bloomer-dress-hat-ivory-sara.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-baby-girls-bloomer-dress-and-hat-ivory-sara-14.jpg||-||Katie Rose Baby Girls Gown in Ivory Joli|,|Truly unforgettable, this new baby take home gown designed by Katie Rose is created to celebrate a very special event! The charming gown features an empire bodice with short puffy sleeves. The waist is accented with embroidery and bows on the front and a sweet satin bow that ties in the back. The long skirt drapes in beautiful ivory cotton while matching lace elegantly drapes over top. The lace features scallop edges and a floral embroidery. Made in the USA. 100% cotton. Hand wash with care and lay flat to dry. |,|$141.00$|,||,|KATIE-ROSE-BABY-GIRLS-GOWN-IVORY-JOLI|,|$URL$katie-rose-baby-girls-gown-ivory-joli.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-baby-girls-gown-in-ivory-joli-1.jpg||-||Katie Rose Baby Girls Gown in Ivory Sara|,|^|In a beautiful and elegant soft ivory, this new baby girls gown comes from designer Katie Rose. The empire bodice boasts of an embroidered flower design at the waist, soft cotton knit, and long sleeves finished with sweet scalloped lace. The long skirt features a mesh overlay with waves of ribbons and rosettes falling to the hemline. Accompanied by a matching bonnet. Hand wash with care and lay flat to dry. NEWBORN AVAILABLE ONLY. ^||,|$101.00$|,||,|KATIE-ROSE-BABY-GIRLS-GOWN-IVORY-SARA|,|$URL$katie-rose-baby-girls-gown-ivory-sara.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-baby-girls-gown-in-ivory-sara-14.jpg||-||Katie Rose Baby Pink Bloomer Dress Bree|,|From the fabulous Katie Rose comes this stunning baby girls bloomer dress. This would be perfect for a take home gown or for any of baby's dressy occasions. The soft pink cotton bodice has short gathered sleeves. The sleeves have a lace embellishment. A pink tulle skirt flows from a lovely ribbon of leaves and flowers on the empire waist. The tiny flowers have white beaded centers. This embellishment is repeated at the hemline. A satin pink bow rests on her left shoulder and on the leg openings. Pink satin ties are found on the back. Snaps are found at the bottom for ease of diapering. The matching pink hat has a pink satin ribbon on the front. Made from cotton. Hand wash cold, dry flat. |,|$79.00$|,||,|KATIE-ROSE-BABY-BREE-BLOOMER-DRESS|,|$URL$katie-rose-baby-bree-bloomer-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-baby-pink-bloomer-dress-bree-17.jpg||-||Katie Rose Baby Romper Ivory Ashley with Cap|,|Soft ivory cotton and lacey touches make up this new infant romper and cap set from designer Katie Rose. The bodice features shorter sleeves with elastic gathering and ivory lace edges. The waist is adorned by a wide satin ribbon that ties in the back and offers small floral and lace designs on the front. Full snaps and quaint satin bows finish off this adorable piece. Accompanied by a matching cap. 100% cotton, hand wash and lay flat to dry. |,|$72.00$|,||,|KATIE-ROSE-BABY-ROMPER-IVORY-ASHLEY-CAP|,|$URL$katie-rose-baby-romper-ivory-ashley-cap.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-baby-romper-ivory-ashley-with-cap-15.jpg||-||Katie Rose Cream Infant Romper with Hat|,|^|Just precious, this baby girls romper is made by design Katie Rose. The bodice is dressed by large lace appliques on the empire waist and offers long sleeves for the cooler months. Sweet bow appliques are accented with faux pearls. A ribbon ties in a bow in back. The legs offer changing snaps that line the inseam and ruffled hem complimented with matching lace and a rosette bow. Matching hat included has another sweet bow. 100% cotton, hand wash with care. Lay flat to dry. NEWBORN AND 6 MOS ONLY LEFT. ^||,|$78.00$|,||,|KATIE-ROSE-PAYTON-CREAM-ROMPER-HAT|,|$URL$katie-rose-payton-cream-romper-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-cream-infant-romper-with-hat-12.jpg||-||Katie Rose Faith Ivory Infant Girls Bloomer Dress and Hat|,|A new arrival from designer Katie Rose, this Faith gown is elegant and soft. The ivory knit bodice offers long sleeves and a ribbon wiast adorned with small flowers on their stem and a satin tie in the back. A cinched ivory satin flower and bow sit just below her left shoulder and match the accents found on both legs of the bloomers. The line of snaps make changing easier while the tulle overlay skirt is embroidered with a darling design and finished with a scalloped hem to match the lace on her cuffs. Comes with matching hat. 100% cotton, hand wash only. |,|$82.00$|,||,|KATIE-ROSE-FAITH-IVORY-INFANT-GIRLS-BLOOMER-DRESS-HAT|,|$URL$katie-rose-faith-ivory-infant-girls-bloomer-dress-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-faith-ivory-infant-girls-bloomer-dress-and-hat-14.jpg||-||Katie Rose Fancy Baby Gown in White Lace|,|Prepared to add gorgeous charm to her memorable first moments, this fabulous baby girls gown comes from Katie Rose. The cotton bodice features a high waistline with a satin tie back bow. Short sleeves are puffy and finished with scalloped lace and cute bows. Fancy embroidery decorates the front. The long skirt falls down elegantly while lacey mesh falls in an overlay. 100% cotton. Hand wash with care and dry flat. |,|$141.00$|,||,|KATIE-ROSE-FANCY-BABY-GOWN-WHITE-LACE|,|$URL$katie-rose-fancy-baby-gown-white-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-fancy-baby-gown-in-white-lace-1.jpg||-||Katie Rose Fancy Layette Gown in White with Hat|,|Take her home in this beautiful new design from Katie Rose. The white bodice is adorned with a pink satin sash with intricate white crochet work over the top with a rosette off to one side. Cotton gown has an elastic hemline . Long sleeves and mesh overlay are embellished with delicate lace. Satin ribbon ties gown at the back. Comes with a matching hat with flower. 100% cotton. Hand wash cold, dry flat. |,|$87.00$|,||,|KATIE-ROSE-FANCY-LAYETTE-GOWN-HAT|,|$URL$katie-rose-fancy-layette-gown-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-fancy-layette-gown-in-white-with-hat-17.jpg||-||Katie Rose Infant Bloomer Dress Ashley Cream|,|Beautiful and charming, this new arrival from Katie Rose is sure to be a hit at any baby shower. The creamy ivory bodice features short sleeves accented by scalloped lace while the wide satin ribbon ties in a bow around the waist and is adorned by lace and light pink flowers on the front. The bloomer skirt snaps for easy diaper changes and is finished by a matching satin bow on both legs. An embroidered mesh boasting of a floral designer overlays her legs while a matching hat caps off the look. 100% cotton, hand wash suggested. |,|$79.00$|,||,|KATIE-ROSE-INFANT-BLOOMER-DRESS-CREAM|,|$URL$katie-rose-infant-bloomer-dress-cream.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-infant-bloomer-dress-ashley-cream-13.jpg||-||Katie Rose Infant Bloomer Dress Ashley Pink|,|^|Another sweet creation from designer Katie Rose, this Infant Bloomer Dress is a perfect take home outfit or baby shower gift! The soft 100% cotton bodice features short sleeves adorned with scalloped lace and an ivory satin waistband that is trimmed with lace and pink flowers and ties in a bow in the back. The bloomer styled skirt has a matching satin bow on both legs and a gorgeous embroidered overlay. Accompanied by a matching 100% cotton hat, hand wash suggested. SIZE 6 MOS ONLY LEFT.  ^||,|$79.00$|,||,|KATIE-ROSE-INFANT-BLOOMER-DRESS-PINK|,|$URL$katie-rose-infant-bloomer-dress-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-infant-bloomer-dress-ashley-pink-25.jpg||-||Katie Rose Infant Girls Dress with Flower|,|^|She will look as sweet as can be in this pretty infant girls dress by Katie Rose. A super soft cotton bodice will keep her comfortable all day long. Ric rac and satin ribbon adorn the cotton overlay bloomer style dress. The rear satin tie shines with a large pink fabric flower front and center. Easy on with snapped gusset. 100% cotton. Hand wash cold, dry flat. Made in the USA. SIZE NEWBORN AND 3 MONTH REMAIN. ^||,|$78.00$|,||,|KATIE-ROSE-INFANT-GIRLS-DRESS|,|$URL$katie-rose-infant-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-infant-girls-dress-with-flower-1.jpg||-||Katie Rose Infant Girls Romper Damask Print|,|^|New from designer Katie Rose, this delicate pink damask romper is sure to be a stunning addition for her summer portraits. The empire bodice is accented with short sleeves and a pink rosette sash on white satin ribbon that ties in the back. This design wouldn't be complete without the snap closures that make for a comfortable fit. The romper leggings are finished with eyelet lace and a matching satin bow. 100% cotton; excluding trim/accents. For best results, hand wash and air dry flat. SIZE 9 MOS ONLY LEFT.  ^||,|$39.00$|,||,|KATIE-ROSE-INFANT-GIRLS-ROMPER-DAMASK-PRINT|,|$URL$katie-rose-infant-girls-romper-damask-print.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-infant-girls-romper-damask-print-1.jpg||-||Katie Rose Infant Gown with Lace Skirt in White|,|Making any day special, this fabulous new infant gown comes from designer Katie Rose. The empire waist bodice boasts of 100% cotton, short puffy sleeves and a satin ribbon that ties around the waist. A embroidered design is found on the front accented with a sweet ribbon rosette. The long skirt offers two tiers of white tulle covered in an elegant floral lace embroidered design. The top tier is finished with a swooping scallop hem. Hand wash and lay flat to dry to keep this dress looking its best! |,|$86.00$|,||,|KATIE-ROSE-INFANT-DRESS-LACE-SKIRT-WHITE|,|$URL$katie-rose-infant-dress-lace-skirt-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-infant-dress-with-lace-skirt-in-white-20.jpg||-||Katie Rose Infant Pink Dress with Lace and Legging|,|New from popular infant designer Katie Rose, this new baby girls dress is sure to look fabulous this spring! The sleeveless bodice is a crisp white in soft cotton. A satin ribbon is tied in a bow around her waist while the front is decorated with light pink flowers. The skirt has a pink damask print and a full circle shape. Peeking out from beneath the scallop hemline is a touch of embroidered lace in white. Solid white leggings are paired beneath, boasting only of the single bell hem on both legs. Made with 100% cotton, exclusive of decorations. Hand wash both pieces with care and lay flat to dry. |,|$49.00$|,||,|KATIE-ROSE-INFANT-PINK-DRESS-WITH-LACE-AND-LEGGING|,|$URL$katie-rose-infant-pink-dress-with-lace-and-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-infant-pink-dress-with-lace-and-legging-1.jpg||-||Katie Rose Infant Take Home Outfit White Ashley Romper|,|^|Elegant and quaint, this new infant take home outfit from designer Katie Rose is fit for your new princess. The white romper boasts of an empire waist, short sleeves accented with scalloped lace, and a white satin ribbon around her waist tying in the back. The legs offer a line of snaps for easy changing and are adorned by a small bow on each leg. Accompanied by a matching hat featuring only a satin bow with a flower center. SIZE 6 MOS ONLY LEFT. ^||,|$74.00$|,||,|KATIE-ROSE-INFANT-TAKE-HOME-OUTFIT-ASHLEY|,|$URL$katie-rose-infant-take-home-outfit-ashley.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-infant-take-home-outfit-white-ashley-romper-11.jpg||-||Katie Rose Infant White Lace Dress Jillian with Cap|,|Made from 100% soft cotton, this new infant dress from Katie Rose is sure to please. Perfect for a take me home outfit, this dress features three small satin rosettes set upon the bodice with a lacey background, short sleeves edged in lace, and a ribbon that ties around the waist. Underneath the embroidered floral skirt, the romper offers full snaps and a satin bow on both legs. Accompanied with a matching white cap. Hand wash and lay flat to dry. |,|$79.00$|,||,|KATIE-ROSE-INFANT-WHITE-LACE-DRESS-JILLIAN-CAP|,|$URL$katie-rose-infant-white-lace-dress-jillian-cap.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-infant-white-lace-dress-jillian-with-cap-13.jpg||-||Katie Rose Ivory Baby Girls Dress|,|A true doll, this new fabulous dress from designer Katie Rose is unbelievably beautiful. The soft ivory shade is found throughout the dress and is elegant. The bodice boasts of a sleeveless neckline and an empire waist. The ivory satin belt ties into a bow on her back while a row of pink and ivory flowers accent the front. The tulle skirt is layered and cut in a full circle shape to add volume and grace. A matching satin ribbon is wrapped around the hemline to tie the piece together. This gorgeous baby gown is perfect for spring or summer and looks lovely at weddings, birthdays, in photographs, and on her first day home from the hospital! 100% cotton. Hand wash and dry flat. |,|$39.00$|,||,|KATIE-ROSE-IVORY-BABY-GIRLS-DRESS|,|$URL$katie-rose-ivory-baby-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-ivory-baby-girls-dress-1.jpg||-||Katie Rose Ivory Lace Baby Girls Dress|,|Designed by Katie Rose, this sweet infant bloomer dress is sure to make a lasting memory. The empire bodice is a soft ivory shade and features puffy short with lace embellished cuffs. The satin ribbon waist ties in a bow on her back and is accented with sweet, quaint flowers. The bloomer pants are comfortable on her delicate skin and offer classic changing snaps. A gorgeous lace skirt falls from the lace and is finished with he same scallop found on the hem. 100% cotton, excluding trim. Hand wash and dry flat. Accompanied by a matching lace headband adorned only by a quaint bow. |,|$79.00$|,||,|KATIE-ROSE-IVORY-LACE-BABY-GIRLS-GOWN|,|$URL$katie-rose-ivory-lace-baby-girls-gown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-ivory-lace-baby-girls-gown-1.jpg||-||Katie Rose Ivory Lace Infant Gown with Hat|,|Designed by Katie Rose, this new infant gown is a stunning choice for a baby's Christening gown. Made in the USA, this gown offers an empire waist bodice completed with lace cuffs on her long sleeves. The waist is embellished with an embroidered lace and small rosettes, all placed upon the thin satin ribbon. The skirt is elegantly long and features an embroidered lace overlay complete with the timeless look of a scallop hemline. The lining underneath finishes with an elastic hemline to help keep her little legs bundled! In 100% cotton excluding decorations. The waist ties in a bow on the back. Hand wash with care and allow to hang dry. Breathtaking! |,|$110.00$|,||,|KATIE-ROSE-CHRISTIE-IVORY-LACE-GOWN-BONNET|,|$URL$katie-rose-christie-ivory-lace-gown-bonnet.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-ivory-lace-infant-gown-with-hat-11.jpg||-||Katie Rose Leila Infant Girls Bloomer Dress and Hat|,|^|New from well love infant designer, Katie Rose, this bloomer dress is too adorable! The pink cotton knit bodice offers long sleeves and a satin waist that ties in the back. The bodice is also adorned with lace in the front to add a special and unique touch to the piece. The bloomers are hemmed with an elastic ruffles and offer classic changing snaps to make mom's life a bit easier. The skirt is created with the sweet overlay of tulle accented with a touch of lace that matches the bodice perfectly and an elegant scallop hemline. Paired with a roll brim hat adorned with a satin bow. Machine washable. 100% cotton. SIZE 6 MOS ONLY LEFT.  ^||,|$79.00$|,||,|KATIE-ROSE-LEILA-INFANT-GIRLS-BLOOMER-DRESS-HAT|,|$URL$katie-rose-leila-infant-girls-bloomer-dress-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-leila-infant-girls-bloomer-dress-and-hat-14.jpg||-||Katie Rose Lilac Newborn Take Me Home Outfit with Hat|,|^|One of the most popular pieces designed by Katie Rose, this fabulous infant outfit looks beautiful in her newborn photos! The cotton fabric was selected with her delicate skin in mind. The top offers a wrap style secured with snaps while a ribbon of lace edges the fabric and is also found on the cuffs. A single sweet bow is also found on the top. The matching bottoms also feature ribbons, rosettes and lace trim. A matching hat accompanies the piece to finish the look off from head to toe. 100% cotton excluding decorations. Hand wash with care. 6 MOS ONLY LEFT.  ^||,|$77.00$|,||,|KATIE-ROSE-LILAC-TAKE-ME-HOME-OUTFIT|,|http://www.labellaflorachildrensboutique.com/katie-rose-lilac-take-me-home-outfit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-lilac-newborn-take-me-home-outfit-with-hat-11.jpg||-||Katie Rose Pink Baby Girl Romper and Hat|,|^|Bring your sweet baby girl home from the hospital in this adorable pink romper and matching hat. This darling outfit is made of soft knit cotton in the USA by designer Katie Rose. Lace and ribbons adorn the wrists and ankles. Beautiful detailing delights the empire waist with lace, ribbons, and pearl centered rosettes. An elegant ribbon bow ties in the back of this adorable romper. Matching hat features the same accents and completes this stunning look. This item is hand washable only. 6 MOS AND 9 MOS REMAINING.  ^||,|$78.00$|,||,|KATIE-ROSE-PINK-ROMPER|,|$URL$katie-rose-pink-romper.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-pink-baby-girl-romper-and-hat-13.jpg||-||Katie Rose Pink Bloomer Dress for Baby Girls in Long Sleeve|,|How stunning is this adorable infant bloomer dress by the fabulous infant designer, Katie Rose? The soft pink cotton bodice has long sleeves to help keep her warm and cozy on her first ride home. The elegant pink tulle skirt flows from the empire waist. The tulle is adorned with a ribbon of flowers and leaves. Waist is tied with a simple pink satin bow in the back. Snaps line the inseam for an easy change. The adorable infant hat will keep baby warm. Made from 100% cotton. Hand wash cold, dry flat. |,|$79.00$|,||,|KATIE-ROSE-PINK-BLOOMER-DRESS-BABY-GIRLS-LONG-SLEEVE|,|$URL$katie-rose-pink-bloomer-dress-baby-girls-long-sleeve.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-pink-bloomer-dress-for-baby-girls-in-long-sleeve-2.jpg||-||Katie Rose Pink Eyelet Infant Dress and Legging|,|An adorable new spring arrival, this fabulous baby girls dress from designer Katie Rose is one you cannot resist. The empire bodice offers her a soft cotton that allows slight stretch in its fit. The sleeveless cut welcomes the warm sunshine while a wide pink satin ribbon ties around the waist decorated with a large flower. The skirt features a light pink fabric that boasts of a white layer just beneath. The hem is cut in a scallop shape with an eyelet design. Matching leggings are paired beneath with a bow dressing the bell hem. 100% cotton. Hand wash cold, lay flat to dry. |,|$76.00$|,||,|KATIE-ROSE-PINK-EYELET-INFANT-DRESS-LEGGING|,|$URL$katie-rose-pink-eyelet-infant-dress-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-pink-eyelet-infant-dress-and-legging-1.jpg||-||Katie Rose Pink Lace Infant Dress Ashley|,|With long sleeves to fend off the chilly air, this new baby girls dress comes from the sweet Katie Rose. The light baby pink is complimented with ivory scalloped trimmings found on the cuffs and framing the satin waist. The waist ties in a bow at her back while the bloomer bottoms boast of the lace skirt overlay. Accompanied with a matching hat, made with 100% cotton, hand wash for best results. |,|$79.00$|,||,|KATIE-ROSE-PINK-LACE-INFANT-DRESS-ASHLEY|,|$URL$katie-rose-pink-lace-infant-dress-ashley.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-pink-lace-infant-dress-ashley-14.jpg||-||Katie Rose Pink Leila Lace Baby Romper with Bonnet|,|Another beautiful creation from Katie Rose, this baby romper in pink comes with a delightful matching bonnet. The soft pink romper boasts of short gathered sleeves and a lace applique on the bodice. Small pink flowers with beaded pearl centers bloom on the lace applique and on the legs. Lace accents are also found on the sleeves and leg openings. Satin ties finish the back. Snaps are located at the bottom. The matching bonnet is lined in pink and has a lovely overlay of lace, as well as lace trim around her face. The bonnet ties with ribbons under her chin and gathers at the back with another ribbon. 100% cotton. Hand wash cold, lay flat to dry. |,|$86.00$|,||,|KATIE-ROSE-PINK-LEILA-LACE-BABY-ROMPER-BONNET|,|$URL$katie-rose-pink-leila-lace-baby-romper-bonnet.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-pink-leila-lace-baby-romper-with-bonnet-32.jpg||-||Katie Rose Pink Newborn Take Me Home Outfit|,|^|Designed by the loved Katie Rose, this baby girls outfit is one of our top sellers! The wrap style top is made from 100% cotton and is embellished with sweet lace. The front is secured with a snap and is dressed with a single satin bow. Matching pink cotton pants are worn beneath finished with an elastic hem and offering the same great comfort in fit. A single ribbon rosette is found on each leg. The outfit comes with a sweet matching hat! Hand wash all pieces with care and lay flat to dry. SIZE 6 MONTH AVAILABLE ONLY.  ^||,|$77.00$|,||,|KATIE-ROSE-PINK-NEWBORN-OUTFIT|,|http://www.labellaflorachildrensboutique.com/katie-rose-pink-newborn-outfit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-pink-newborn-take-me-home-outfit-25.jpg||-||Katie Rose Pink Tulle Infant Dress Sophia Rose|,|New from designer Katie Rose, this fabulous spring infant dress has a timeless elegance that will not be soon forgotten. The skirt of this dress is covered with a full circle overlay of sheer tulle that finishes with a satin hemline. The matching pink lining is seen from underneath. A sleeveless bodice has a comfortable fit with a classic jewel shape neckline. The ribbon that ties around the waist in a bow with the front dressed in a trio of flowers. 100% cotton. Hand wash cold, lay flat to dry. |,|$39.00$|,||,|KATIE-ROSE-PINK-TULLE-INFANT-DRESS-SOPHIA-ROSE|,|$URL$katie-rose-pink-tulle-infant-dress-sophia-rose.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-pink-tulle-infant-dress-sophia-rose-1.jpg||-||Katie Rose Sara Bloomer Dress with Hat in White|,|^|A beautiful creation from Katie Rose for your little one, this baby doll bloomer dress is simply irresistable. The bodice of white cotton boasts of long sleeves with lace trim at the edges. At the waist is a white lace applique flanked by two white satin bows. Satin strings reach around the back to finish off in a bow. An overlay of mesh in a satiny rose pattern is a masterpiece. The bloomers underneath the overlay have elastic at the ankles and are adorned with matching white satin bows just above the hem ruffle. Snaps on the bloomers make for ease of diapering. The matching hat is adorned with a satin bow on the flap. Made from 100% cotton, exclusive of overlay. Hand wash cold, dry flat. SIZE 6 MONTH REMAINS. ^||,|$86.00$|,||,|KATIE-ROSE-BABY-DOLL-SARA-BLOOMER-DRESS-HAT|,|$URL$katie-rose-baby-doll-sara-bloomer-dress-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-baby-doll-sara-bloomer-dress-with-hat-14.jpg||-||Katie Rose Sleeveless Pink Romper for Baby Girls|,|New from Katie Rose, this sweet romper dresses your young daughter with beauty. The sleeveless bodice boasts of the white embroidering that accents the waist as a white satin bow ties in the back. The legs fall in the same sweet light pink and finish with an elastic ruffle hem completed with lace and bows. The legs offer mom classic changing snaps. A matching lace headband also comes with the romper. Made with 100% cotton for her delicate skin. Hand wash and lay flat to dry. |,|$59.00$|,||,|KATIE-ROSE-SLEEVELESS-PINK-ROMPER-BABY-GIRLS|,|$URL$katie-rose-sleeveless-pink-romper-baby-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-sleeveless-pink-romper-for-baby-girls-1.jpg||-||Katie Rose Sophia Lace White Christening Gown for Baby Girls|,|Gorgeous with every small detail, this new girls christening gown comes from designer Katie Rose. The white knit bodice boasts of its gathered short sleeves ending with a wide lace trim to match her accented waist that ties in a bow on her back. Embroidered mesh falls with grace over the skirt, gaining a more intricate design as you reach the scallop hemline. A matching bonnet accompanies the beautiful dress. Made with 100% cotton. Hand wash and lay flat to dry. |,|$141.00$|,||,|KATIE-ROSE-SOPHIA-LACE-WHITE-CHRISTENING-GOWN-BABY-GIRLS|,|$URL$katie-rose-sophia-lace-white-christening-gown-baby-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-sophia-lace-white-christening-gown-for-baby-girls-14.jpg||-||Katie Rose White Baby Dress Special Occasion|,|New from designer Katie Rose, this baby bloomer dress is simply breathtaking. The cotton bodice is adorned with light pink ribbon with a delicate crochet overlay and matching rosette slightly off center. Soft, white tulle flows over the top of the bloomers with matching accent crochet-work and accent ribbons on each leg. A pink ribbon sash ties at the back. Hidden snap closures between the legs. The matching white lace headband with over-sized flower tops of this dress nicely. 100% cotton. Hand wash cold, dry flat. |,|$86.00$|,||,|KATIE-ROSE-WHITE-BABY-DRESS-SPECIAL-OCCASION|,|$URL$katie-rose-white-baby-dress-special-occasion.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-white-baby-dress-special-occasion-14.jpg||-||Katie Rose White Lace Infant Gown and Bonnet|,|Pure white elegance, this gorgeous infant gown is now offered from designer Katie Rose. Soft white cotton is adorned with lace embellishments on the empire bodice. The satin waist ties in a bow on the back and we also find sweet rosettes on the front. The outstanding embroidered lace skirt is finished with a scallop hem and fully lined. The lining is finished with an elastic hemline to help keep her little feet bundled. The gown comes with an accompanying sheer lace bonnet that is tied to secure the fit. This white baby girls gown is perfect for her christening or newborn photos! 100% cotton. Hand wash delicately and lay flat to dry. |,|$99.00$|,||,|KATIE-ROSE-WHITE-LACE-INFANT-GOWN-HAT|,|$URL$katie-rose-white-lace-infant-gown-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-white-lace-infant-gown-and-bonnet-14.jpg||-||Katie Rose White Rose Bud Infant Dress|,|A precious new baby girls dress sure to dazzle, this new arrival from designer Katie Rose is a real dream. The empire bodice boasts of puffy short sleeves finished with embroidered roses on the cuff. The pink ribbon waist is tied in a bow on her back and adorned with sweet flowers on the front. The white skirt is layered in white tulle with a matching rose bud hem. This gorgeous piece is accompanied by a matching headband. 100% cotton. Hand wash and dry flat. |,|$72.00$|,||,|KATIE-ROSE-WHITE-ROSE-BUD-INFANT-DRESS|,|$URL$katie-rose-white-rose-bud-infant-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/katie-rose-white-rose-bud-infant-dress-2.jpg||-||Keep It Gypsy Birdie Girls Diaper Bag|,|Designed like a messenger bag, this diaper bag from Keep it Gypsy is the perfect size for a short trip. A large flap snaps in the front and is covered with tassle trim and a large orange rosette. Light pink and brown stripe down the front and cover the entire interior. Four large side pockets are found on the inside while the scoop pockets on the outside are made with a green houndstooth print. The back blends different polka dots together to create a long pocket for more storage. The shoulder strap is covered with a brown zebra print. |,|$189.00$|,||,|KEEP-IT-GYPSY-BIRDIE-GIRLS-DIAPER-BAG|,|$URL$keep-it-gypsy-birdie-girls-diaper-bag.html|,|http://ep.yimg.com/ay/yhst-17102259411242/keep-it-gypsy-birdie-girls-diaper-bag-1.jpg||-||Keep It Gypsy Lavender Chenille Diaper Bag|,|Helping mom tote all of the things needed for her darling baby, this designer diaper bag comes from Keep it Gypsy. A fun tassle trim runs around the top of the bag while the lilac front is textured with a short chenille yarn. Bright modern prints are found on the sides creating large pockets. Lime and pink blend on the back in a large giraffe print. Chevron stripes race across the shoulder straps while a bright lime interior is covered with magenta spots. Four large inner pockets help keep everything organized. |,|$189.00$|,||,|KEEP-IT-GYPSY-LAVENDER-CHENILLE-DIAPER-BAG|,|$URL$keep-it-gypsy-lavender-chenille-diaper-bag.html|,|http://ep.yimg.com/ay/yhst-17102259411242/keep-it-gypsy-lavender-chenille-diaper-bag-1.jpg||-||Keep It Gypsy Turquoise and Goldenrod Diaper Bag|,|Hand made with care and style, Keep it Gypsy is now offering this fun designer diaper bag. The large bag features a fun lime, aqua, purple, and pink pattern that stands out on the front. The fun frolicing fringe dangles from the top of the back accented with a single oversized flower. Lime polka dots cover the large side pockets while the back stands out in sunshine yellow. A cool turquoise is textured with a subtle floral and frill print to create both the bottom and the straps. Fun stripes line the inside of the back which hosts four large pockets. |,|$189.00$|,||,|KEEP-IT-GYPSY-TURQUOISE-AND-GOLDENROD-DIAPER-BAG|,|$URL$keep-it-gypsy-turquoise-and-goldenrod-diaper-bag.html|,|http://ep.yimg.com/ay/yhst-17102259411242/keep-it-gypsy-turquoise-and-goldenrod-diaper-bag-1.jpg||-||KicKee Pant Footed Romper in Flamingo Pink|,|Matching several of the new arrivals from designer KicKee Pants, this baby romper is sure to be loved. The fabric is soft on her delicate skin while the flamingo pink is a unique shade that stands apart from the rest. Her long sleeves offer flip paw cuffs that protect from accidental scratches. A row of snaps fasten in the front and are followed by a single light pink ruffle. Matching blankets are available to create a one of a kind baby gift. Made with viscose blend. Machine wash cold, tumble dry low. |,|$29.00$|,||,|KICKEE-PANT-FOOTED-ROMPER-IN-FLAMINGO-PINK|,|$URL$kickee-pant-footed-romper-in-flamingo-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pant-footed-romper-in-flamingo-pink-1.jpg||-||KicKee Pant Girls Sundress in Peony|,|A friendly welcome to the warmer days, this new sundress was designed by KicKee Pants. The bodice features a smocked fit that allows stretch and comfort. Wide shoulder straps are made from the same fun print. The layers found on the front of the skirt are defined with the quaint ruffle. The soft fabric will follow her every move gracefully! Made with viscose blend. Machine wash cold, tumble dry low. |,|$34.00$|,||,|KICKEE-PANT-GIRLS-SUNDRESS-PEONY|,|$URL$kickee-pant-girls-sundress-peony.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pant-girls-sundress-in-peony-1.jpg||-||KicKee Pants Baby Girl Footie Glacier Girl|,|A new arrival from designer KicKee Pants this baby girls romper is an adorable piece for the new baby girl in your life. The glacier blue has an artic cool tone and is complimented with rose pink trimmings. The long sleeves help to keep her warm along with the closed feet. The row of snaps that runs up the front is decorated with a ruffle. The rose pink is added as ruffles across the back of the romper and creates small grips on the bottom of her feet. Machine wash on gentle. Bamboo viscose and spandex blend. |,|$39.00$|,||,|KICKEE-PANTS-BABY-GIRL-FOOTIE-GLACIER-GIRL|,|$URL$kickee-pants-baby-girl-footie-glacier-girl.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-baby-girl-footie-glacier-girl-1.jpg||-||KicKee Pants Baby Girl Footie Pink Polka Dot|,|^|New from designer KicKee Pants, this new infant footie is just as darling as can be. Two light shades of pink create the large polka dot print that covers her entire body. The long sleeves offer flip paws to help protect her from scratching her face with her finger nails. It is easy to change her into this footie with the row of classic snaps that fasten in the front accented with a single ruffle. Made with viscose blend. Machine wash cold, tumble dry low. SIZE PREEMIE AND NEWBORN ONLY LEFT.  ^||,|$29.00$|,||,|KICKEE-PANTS-BABY-GIRL-FOOTIE-PINK-POLKA-DOT|,|$URL$kickee-pants-baby-girl-footie-pink-polka-dot.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-baby-girl-footie-pink-polka-dot-1.jpg||-||KicKee Pants Baby Romper for Girls Ruffled Berry|,|From baby designer KicKee Pants, this new baby girls romper will look adorable on your sweet angel. The rich berry red is trimmed with black around the neckline and cuffs. The front closes with snaps that drop from the neck to her left leg, accompanied with a sweet ruffle to match the hemline. The soft fabric is covered with a flower garland print. KicKee Pants always uses fabric that is delicate on her skin. Made with 95% viscose from bamboo and 5% spandex (lycra). Wash on gentle cycle in cold water. |,|$36.00$|,||,|KICKEE-PANTS-BABY-ROMPER-GIRLS-RUFFLED-BERRY|,|$URL$kickee-pants-baby-romper-girls-ruffled-berry.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-baby-romper-for-girls-ruffled-berry-17.jpg||-||KicKee Pants Baby Ruffle Leggings and Top Winter Stripe|,|KicKee Pants is now offering this darling infant outfit for your baby girl this fall and winter. The long sleeve top is created in a solid berry red shade that is sure to look fabulous in both of the chilly seasons. The top is dressed with three accenting ruffles upon the front. Paired with the long sleeve top we find cute leggings worn beneath. The same soft fabric is covered with a pink stripe. The elastic waist is comfortable for your little girl while three tiers of ruffles are found on the back. Created with viscose from bamboo and spandex. Gentle cycle on cold. |,|$54.00$|,||,|KICKEE-PANTS-BABY-RUFFLE-LEGGINGS-TOP-WINTER-STRIPE|,|$URL$kickee-pants-baby-ruffle-leggings-top-winter-stripe.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-baby-ruffle-leggings-and-top-winter-stripe-1.jpg||-||KicKee Pants Convertible Baby Gown with Hat Winter Berry|,|Part of their fall collection, this new baby girls gown comes from designer KicKee Pants. The gown is created in a rich berry shade that is covered with a flower garland print. The neckline and the cuffs are finished with a light pink trim. A ruffle joins the snaps that run down the front to the waist. The snaps beneath where the ruffle ends can be fastened differently to create a romper instead of a gown. This piece comes with a matching knotted hat. Made with a soft viscose blend created from bamboo. Machine washable on the gentle cycle. |,|$48.00$|,||,|KICKEE-PANTS-CONVERTIBLE-BABY-GOWN-HAT-WINTER-BERRY|,|$URL$kickee-pants-convertible-baby-gown-hat-winter-berry.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-convertible-baby-gown-with-hat-winter-berry-17.jpg||-||KicKee Pants Convertible Gown and Hat Meadow Flower Lattice|,|KicKee Pants has created this adorable convertible gown as a part of their spring collection. The lime green is dressed with a flower and lattice print. The bodice has a pink trimmed neckline to match the cuffs found on her long sleeves. A quaint ruffle is found running down the front, adding the perfect touch. The rows of snaps found on the front and the back allow for this piece to be worn as a long gown or as a romper. Bamboo. Gentle cycle in cold. |,|$38.00$|,||,|KICKEE-PANTS-CONVERTIBLE-GOWN-HAT-MEADOW-FLOWER-LATTICE|,|$URL$kickee-pants-convertible-gown-hat-meadow-flower-lattice.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-convertible-gown-and-hat-meadow-flower-lattice-1.jpg||-||KicKee Pants Convertible Gown and Hat Winter Candy|,|A genius design, this new convertible gown from KicKee Pants is two adorable styles wrapped into one piece. The stripes that cover the piece are different shades of pink placed with neutral colors. A matching hat comes with the gown with a knotted top and a folded up brim. The snaps that run down the front of this gown can be fastened a second way to create a romper. The back of the cuffs are finished with a cute ruffle. Viscose blend. Machine wash on gentle. |,|$48.00$|,||,|KICKEE-PANTS-CONVERTIBLE-GOWN-HAT-WINTER-CANDY|,|$URL$kickee-pants-convertible-gown-hat-winter-candy.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-convertible-gown-and-hat-winter-candy-17.jpg||-||KicKee Pants Convertible Gown Pink Daisy and Hat|,|Coordinating wonderfully with so many new creations, this KicKee Pants gown is sure to be loved by mom and her baby girl. The two pinks create a sweet daisy print that wraps around in stripes. The snaps that fall down the center are accompanied with a ruffle while the garment can be worn as a gown or romper. A matching hat comes with the gown while the top is finished with a knot. Bamboo. Gentle cycle in cold. |,|$38.00$|,||,|KICKEE-PANTS-CONVERTIBLE-GOWN-PINK-DAISY-HAT|,|$URL$kickee-pants-convertible-gown-pink-daisy-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-convertible-gown-pink-daisy-and-hat-1.jpg||-||KicKee Pants Daisy Romper in Pink|,|Making a darling gift, this new romper for infant girls comes from the loved KicKee Pants. This designer is known for their luxuriously soft fabrics and sweet prints. This piece is no differing with its light pink daisy print. The long sleeved piece helps keep her from being chilly while the contrast found on the neckline is mimicked in the ruffles that accent the hemlines and also run down the front with the line of changing snaps. Look for other pieces made in the same sweet fabric. Bamboo. Gentle cycle in cold. |,|$29.00$|,||,|KICKEE-PANTS-DAISY-ROMPER-PINK|,|$URL$kickee-pants-daisy-romper-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-daisy-romper-in-pink-1.jpg||-||KicKee Pants Designer Infant Top and Leggings Christmas Berry|,|New from KicKee Pants, this fabulous baby girls outfit is both adorable and beyond comfortable for your little one. The top features a fitted top with a wrap neckline and long sleeves. The bottom of the tunic is finished with a skirting ruffle. Beneath this top is a pair of black leggings. The leggings are finished with a small ruffle at the hem of both legs. The waistline has an elastic stretch. Both pieces are made with a bamboo viscose blend that is delicate on her skin. |,|$85.00$|,||,|KICKEE-PANTS-DESIGNER-INFANT-TOP-LEGGINGS-CHRISTMAS-BERRY|,|$URL$kickee-pants-designer-infant-top-leggings-christmas-berry.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-designer-infant-top-and-leggings-christmas-berry-1.jpg||-||KicKee Pants Flamingo Pink Knot Hat|,|The perfect accessory to her new KicKee Pants accessory, this newborn girls hat is sweet. The dark flamingo pink fabric is a solid shade made from fabric that is brilliantly soft. The top of the hat is styled with a knot while the brim is rolled up. Bamboo. Gentle cycle in cold. |,|$9.00$|,||,|KICKEE-PANTS-FLAMINGO-PINK-KNOT-HAT|,|$URL$kickee-pants-flamingo-pink-knot-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-flamingo-pink-knot-hat-1.jpg||-||KicKee Pants Footie for Baby Ruffled Winter Berry|,|A beautiful design that keeps her comfortable and warm as she naps, this new footed romper is from designer KicKee Pants. The romper is created in a rich berry shade that is found on many of the other new arrivals. A light pink contrasting trim is found on the neckline and the cuffs. The changing snaps run down the front with a light pink ruffle. The closed feet of this romper are the perfect added warmth. The back of the romper is decorated with rows of ruffles and small grips are attached to the bottom of both feet. 95% viscose from bamboo, 5% spandex; machine wash cold on the gentle cycle. |,|$39.00$|,||,|KICKEE-PANTS-FOOTIE-BABY-RUFFLED-WINTER-BERRY|,|$URL$kickee-pants-footie-baby-ruffled-winter-berry.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-footie-for-baby-ruffled-winter-berry-1.jpg||-||KicKee Pants Girls Footie in Green Lattice|,|^|KicKee Pants is now offering this darling footed romper for infant girls. The adorable lime green blended with light pink is a classic summer style while the lattice print is unique. The row of changing snaps that run down the center are dressed with ruffles. The long sleeves keep her warm while the flip paw cuffs provide protection from scratches. A trio of ruffles wrap around the back of the romper in the sweet pink. Bamboo. Gentle cycle in cold. Only Newborn Left ^||,|$39.00$|,||,|KICKEE-PANTS-GIRLS-FOOTIE-GREEN-LATTICE|,|$URL$kickee-pants-girls-footie-green-lattice.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-girls-footie-in-green-lattice-1.jpg||-||KicKee Pants Girls Maxi Dress in Green Lattice|,|^|New from KicKee Pants, this fabulous designer maxi dress for toddlers is sure to brighten her spring and summer. The empire bodice features a straight neckline and thin shoulder straps in a light pink. The waist is a matching shade while the lime green lattice print is cute as can be. The skirt opens in shape to dance around her legs with ease. The hem is decorated with a ruffle to finish off this look. Bamboo. Gentle cycle in cold. SIZE 2T REMAINING.  ^||,|$39.00$|,||,|KICKEE-PANTS-GIRLS-MAXI-DRESS-GREEN-LATTICE|,|$URL$kickee-pants-girls-maxi-dress-green-lattice.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-girls-maxi-dress-in-green-lattice-1.jpg||-||KicKee Pants Girls Pajamas Short Sleeve in Pink Polka Dot|,|A sweet style that accompanies her to bed, these new designer pajamas are from KicKee Pants. The short sleeve top is designed for a fitted style that is safer for your darling little girl. Matching skinny pants come with the top and are in the same pink fabric. The light pink is covered with large, pale pink polka dots. Made with viscose blend. Machine wash cold, tumble dry low. |,|$29.00$|,||,|KICKEE-PANTS-GIRLS-PAJAMAS-SHORT-SLEEVE-PINK-POLKA-DOT|,|$URL$kickee-pants-girls-pajamas-short-sleeve-pink-polka-dot.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-girls-pajamas-short-sleeve-in-pink-polka-dot-1.jpg||-||KicKee Pants Girls Romper Green Meadow Lattice|,|Matching several new arrivals this season, this infant romper was created with love by KicKee Pants. The lime green fabric is soft on the skin and comfortable to wear while covered with a darling lattice print. The bodice is defined with elastic to gather the waist and a light pink ruffle to trim the neckline. The wide shoulder straps grace her shoulders while two pockets are found on the shorts. The elastic ruffle hem on both legs provide the cute bloomer look. A row of inseam snaps makes changing a breeze. Bamboo. Gentle cycle in cold. |,|$19.00$|,||,|KICKEE-PANTS-GIRLS-ROMPER-GREEN-MEADOW-LATTICE|,|$URL$kickee-pants-girls-romper-green-meadow-lattice.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-girls-romper-green-meadow-lattice-1.jpg||-||KicKee Pants Girls Ruffle Tee in Pink|,|^|Filled with a simply beautiful style, this new girls top comes from KicKee Pants line ""Catch a Tiger."" The light pink top offers her a classic fit. A darker pink accents the neckline and ruffles the short sleeves. This tee is perfect own its own or layered underneath a top to make it a touch warmer. Made with viscose blend. Machine wash cold, tumble dry low. ^||,|$19.00$|,||,|KICKEE-PANTS-GIRLS-RUFFLE-TEE-PINK|,|$URL$kickee-pants-girls-ruffle-tee-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-girls-ruffle-tee-in-pink-1.jpg||-||KicKee Pants Girls Striped Convertible Gown|,|^|Created by KicKee Pants, this new fabulous baby girls gown is more than meets the eye. Thin stripes wrap around her bodice and blend together in beautiful shades and colors. Her long sleeves feature flip paws and a single keyhole is found on the back. The row of snaps that fasten the front closed. A light pink ruffle also runs down the front while the snaps give mom the option of wearing this piece as a gown or as a romper. Made with viscose blend. Machine wash cold, tumble dry low. SIZE NEWBORN AND 3-6 MOS ONLY REMAINING.  ^||,|$29.00$|,||,|KICKEE-PANTS-GIRLS-STRIPED-CONVERTIBLE-GOWN|,|$URL$kickee-pants-girls-striped-convertible-gown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-girls-striped-convertible-gown-1.jpg||-||KicKee Pants Girls Striped Hat|,|A sweet accessory, this new baby girls hat comes from designer KicKee Pants and is available in preemie and newborn sizes. The hat boasts of its thin stripes that blend blues and pinks. The top of the hat is finished with two quaint knots. The folded brim creates a crisp look. Pair with several of the new outfits in KeeKee Pants' spring and summer collection. Viscose blend fabric made from bamboo, adding a luxury level of soft. Machine wash and tumble dry. |,|$11.00$|,||,|KICKEE-PANTS-GIRLS-STRIPED-HAT|,|$URL$kickee-pants-girls-striped-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-girls-striped-hat-1.jpg||-||KicKee Pants Girls Yoga Pant Sailaway Stripe|,|As comfy as can be, these new girls yoga pants are ready to take on the day. KicKee Pants designed this soft pants in colors with match several other new arrivals. Thin stripes blend pinks, blues, and black wonderfully. The fold over waist has a stretch fit and a single pink bow found in the center. Two pockets found on the front give a home for her hands. Made with viscose blend. Machine wash cold, tumble dry low. |,|$34.00$|,||,|KICKEE-PANTS-GIRLS-YOGA-PANT-SAILAWAY-STRIPE|,|$URL$kickee-pants-girls-yoga-pant-sailaway-stripe.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-girls-yoga-pant-sailaway-stripe-1.jpg||-||KicKee Pants Hat for Newborn Winter Rose|,|An accessory that looks darling with her new KicKee Pants outfit, this designer baby girls hat is a must have to finish the look. The rose pink color is found throughout the patterns and styles that are found in the fall and winter collection. The hat has a cute knotted top and a sweet ruffle on the brim. Adding this hat to your purchase can make your baby shower gift complete or add a cute decoration when tied to the bow on the top of your wrapping. |,|$14.00$|,||,|KICKEE-PANTS-HAT-NEWBORN-WINTER-ROSE|,|$URL$kickee-pants-hat-newborn-winter-rose.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-hat-for-newborn-winter-rose-1.jpg||-||KicKee Pants Infant Girl Knot Hat|,|Made to accompany many of the new outfits from KicKee Pants' spring collection, this baby girls hat is available in the newborn size. The hat is covered with thin, colorful stripes which include several pinks and a lime green. The top features a tied knot while the brim is folded up. Bamboo. Gentle cycle in cold. |,|$9.00$|,||,|KICKEE-PANTS-INFANT-GIRL-KNOT-HAT|,|$URL$kickee-pants-infant-girl-knot-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-infant-girl-knot-hat-1.jpg||-||KicKee Pants Infant Girls Gown in Watermelon|,|^|The perfect gift for the summer baby, this designer infant gown comes from KicKee Pants. The light pink sack boasts of long sleeves and a cute ruffle that runs down the center next to the changing snaps. The fabric is soft to the touch while covered with slices of juicy watermelon. The dark pink contrasts coordinate beautifully! The matching hat is finished with a knot at the top and a sweet, quaint ruffle. Bamboo. Gentle cycle in cold. SIZE NEWBORN ONLY.  ^||,|$38.00$|,||,|KICKEE-PANTS-INFANT-GIRLS-GOWN-WATERMELON-HAT|,|$URL$kickee-pants-infant-girls-gown-watermelon-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-infant-girls-gown-in-watermelon-1.jpg||-||KicKee Pants Koala Sack with Hat|,|^|An adorable animal print sure to fit any baby girl, this new gown is from the spring collection by designer KicKee Pants. The soft fabric is sweet to her delicate skin while covered in a darling koala bear print. The lime and pink blends together perfectly while small touches of ruffles add a feminine look. The sack is accompanied by a matching hat that boasts of a knot tied at the top and a pink brim. Bamboo. Gentle cycle in cold. SIZE NEWBORN ONLY AVAILABLE.  ^||,|$38.00$|,||,|KICKEE-PANTS-KOALA-SACK-HAT|,|$URL$kickee-pants-koala-sack-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-koala-sack-with-hat-1.jpg||-||KicKee Pants Large Baby Blanket Ruffled Berry|,|Designer KicKee Pants is now offering this stroller blanket as a part of their fall collection. The blanket boasts of a side covered with a flower garland pattern upon the dark berry pink. The light pink ruffle around the edges matches the reverse side. This piece matches several of the new outfits that are available in the collection, perfect for pairing them together for a baby girls shower gift! Viscose and spandex blend; wash on the gentle cycle. |,|$54.00$|,||,|KICKEE-PANTS-LARGE-BABY-BLANKET-RUFFLED-BERRY|,|$URL$kickee-pants-large-baby-blanket-ruffled-berry.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-large-baby-blanket-ruffled-berry-1.jpg||-||KicKee Pants Moped Infant Girls Romper|,|Made from designer KicKee Pants, this unique baby girls romper is adorable. The short sleeves are ruffled with a stretch elastic and a single keyhole is found on her back. The wrap neckline is accented with the small white ruffle. The rich pink fabric is covered with a cute scooter pattern. A row of changing snaps is found on the inseam of the shorts. This fabric is beyond soft and comfortable on her new and delicate skin! Made with viscose blend. Machine wash cold, tumble dry low. |,|$19.00$|,||,|KICKEE-PANTS-MOPED-INFANT-GIRLS-ROMPER|,|$URL$kickee-pants-moped-infant-girls-romper.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-moped-infant-girls-romper-1.jpg||-||KicKee Pants Moped Top in Pink Flamingo|,|A darling lounge wear new design, this girls tee is newly available from the designer KeeKee Pants. The dark flamingo pink is unique and beautiful in shade. Short flutter sleeves grace her shoulders while a touch of light pink is found on the jewel neckline. A large scooter is found placed upon the front. This scooter matches some of her baby sisters new arrivals for spring and summer! Made with viscose blend. Machine wash cold, tumble dry low. |,|$24.00$|,||,|KICKEE-PANTS-MOPED-TOP-PINK-FLAMINGO|,|$URL$kickee-pants-moped-top-pink-flamingo.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-moped-top-in-pink-flamingo-1.jpg||-||KicKee Pants Newborn Hat Winter Berry|,|Pairing perfectly with the new pieces that fill their fall and winter collection, this newborn hat comes from KicKee Pants. The hat is created with a soft fabric in a warm berry pink. The fabric is covered with a garland print while styled with a knotted tie on the top. The brim of the hat is completed with a single ruffle in a lighter pink. Look for the matching blanket to truly complete her outfit! Viscose blend, machine wash on cold. |,|$14.00$|,||,|KICKEE-PANTS-NEWBORN-HAT-WINTER-BERRY|,|$URL$kickee-pants-newborn-hat-winter-berry.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-newborn-hat-winter-berry-1.jpg||-||KicKee Pants Newborn Outfit Meadow Flower|,|^|A new design by KicKee Pants, this newborn gift set is an adorable outfit. The long sleeve onsie offers classic changing snaps while the front is styled to wrap, inspired by the kimono look. The light pink trim pops out from the lime green lattice print. This outfit is finished with light pink leggings that are worn beneath. The fabric is comfortable on her skin. Bamboo. Gentle cycle in cold. 3-6 MONTH REMAINING. ^||,|$29.00$|,||,|KICKEE-PANTS-NEWBORN-OUTFIT-MEADOW-FLOWER|,|$URL$kickee-pants-newborn-outfit-meadow-flower.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-newborn-outfit-meadow-flower-1.jpg||-||KicKee Pants Onesie Pant Set Girls Pink Snowflake|,|Designed by KicKee Pants, this new gift set is the perfect item to wrap up for your next baby shower! The outfit begins with an ivory onesie with a wrap style secured with snaps. A light pink garland print covers this piece as well as the matching knotted hat. This hat is completed with a light pink ruffle that matches the trimmings. The final piece to this outfit is a solid light pink legging with closed feet. A single ruffle is found on both feet. Viscose and spandex blend, wash on gentle cycle. |,|$42.00$|,||,|KICKEE-PANTS-ONESIE-PANT-SET-GIRLS-PINK-SNOWFLAKE|,|$URL$kickee-pants-onesie-pant-set-girls-pink-snowflake.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-onesie-pant-set-girls-pink-snowflake-1.jpg||-||KicKee Pants Peony Infant Girls Romper Footed|,|^|Designed by KicKee Pants, this infant romper is ready for the new life of springtime! The fabric is covered with a large flower print in rich fuchsia, light pink, and blue. The lighter pink trims her neckline and creates the quaint ruffle that runs down the front with the snaps. Long sleeves and footed legs offer her a bit more warmth. Made with viscose blend. Machine wash cold, tumble dry low. NEWBORN ONLY LEFT.  ^||,|$29.00$|,||,|KICKEE-PANTS-PEONY-INFANT-GIRLS-ROMPER-FOOTED|,|$URL$kickee-pants-peony-infant-girls-romper-footed.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-peony-infant-girls-romper-footed-1.jpg||-||KicKee Pants Peony Print Girls Sun Dress|,|^|This new sundress was designed by KicKee Pants and offers a fun large print that welcomes the new blooms of spring. The smocked bodice features comfortable fit that allows stretch. The sleeveless neckline is framed with wide shoulder straps in the same print. The quaint ruffles define the tiers found in the skirt. The graceful fabric follows with her every move and is soft against her skin! Made with viscose blend. Machine wash cold, tumble dry low. SIZE 6 AND 8 ONLY REMAINING. ^||,|$34.00$|,||,|KICKEE-PANTS-PEONY-PRINT-GIRLS-SUN-DRESS|,|$URL$kickee-pants-peony-print-girls-sun-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-peony-print-girls-sun-dress-1.jpg||-||KicKee Pants Peony Short Sleeve PJ Set|,|Offering a night filled with just as much style as the day, this new pajama set comes from KicKee Pants. The flamingo pink shade is rich and accented with light pink around her neckline and short sleeves. The front of the top has a large peony print. A smaller flower print covers the matching pants that come with the top. Both pieces are designed for a fitted look that is safer for your child. Made with viscose blend. Machine wash cold, tumble dry low. |,|$29.00$|,||,|KICKEEE-PANTS-PEONY-SHORT-SLEEVE-PJ-SET|,|$URL$kickeee-pants-peony-short-sleeve-pj-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-peony-short-sleeve-pj-set-1.jpg||-||KicKee Pants Pink Daisy Girls Dress Maxi|,|As sweet as she is, this new toddler dress comes from designer KicKee Pants. This summer dress welcomes the warm sunrays with its fabulous two-tone daisy print. The bodice offers a straight neckline framed with thin straps while the empire waist is a contrast cream. The skirt continues with the same soft, comfortable fabric down to the wide ruffle hem. The skirt comes to life with flowing movement everytime she moves. Pair this maxi dress with a coordinating bolero for an adorable look on a cool day. Bamboo. Gentle cycle in cold. |,|$39.00$|,||,|KICKEE-PANTS-PINK-DAISY-GIRLS-DRESS-MAXI|,|$URL$kickee-pants-pink-daisy-girls-dress-maxi.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-pink-daisy-girls-dress-maxi-1.jpg||-||KicKee Pants Pink Girls Knit Hat|,|Made to match several new arrivals for the spring and summer season, this new baby girls hat from designer KicKee Pants is the perfect way to finish her take home outfit. The fabric of this hat is beyond soft and is light weight. The top of the hat is styled with two tied knots while the brim is folded up. The right pink shade is inspired by the new blooms that are peaking out from the dirt. Made with viscose blend created from bamboo. Machine washable, tumble dry. |,|$9.00$|,||,|KICKEE-PANTS-PINK-GIRLS-KNIT-HAT|,|$URL$kickee-pants-pink-girls-knit-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-pink-girls-knit-hat-1.jpg||-||KicKee Pants Pink Knot Hat|,|From designer KicKee Pants, this newborn girls accessory is sure to be loved. The light pink fabric matches many of the new designs found in their spring collection. The hat is styled by a rolled brim and a knot tied at the top. Bamboo. Gentle cycle in cold. |,|$9.00$|,||,|KICKEE-PANTS-PINK-KNOT-HAT|,|$URL$kickee-pants-pink-knot-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-pink-knot-hat-1.jpg||-||KicKee Pants Pink Polka Dot Baby Gown|,|In a fun polka dot print, this new infant gown comes from designer KicKee Pants. The light pink baby gown features Long sleeves that offer a touch of warmth. The snaps that run down the front are accented with a cute ruffle that matches the hemline. This piece is perfect for lounging at home or for her photo debut! Be sure to look for the matching blankets to create the perfect baby shower gift! Made with viscose blend. Machine wash cold, tumble dry low. |,|$34.00$|,||,|KICKEE-PANTS-PINK-POLKA-DOT-BABY-GOWN|,|$URL$kickee-pants-pink-polka-dot-baby-gown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-pink-polka-dot-baby-gown-1.jpg||-||KicKee Pants Pink Polka Dot Infant Hat|,|KicKee Pants is now offering this fabulous newborn and preemie hat to complete several outfits from their newest creations. The fabulous light pink is bright and a classic choice. Large coordinating polka dots cover the fabric while the brim is folded up. The top of the hat is finished with two small knots. The soft fabric is made from a bamboo viscose blend. Machine washable, tumble dry on low. |,|$11.00$|,||,|KICKEE-PANTS-PINK-POLKA-DOT-INFANT-HAT|,|$URL$kickee-pants-pink-polka-dot-infant-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-pink-polka-dot-infant-hat-1.jpg||-||KicKee Pants Pink Polka Dot Yoga Pant|,|A comfortable new pair of yoga pants that she will love to wear every day, these new arrivals come from designer KicKee Pants. Two shades of light pink are found all over the pants in a large polka dot print. The fit is relaxed as you move down towards the hemline. These yoga pants have two front pockets and a fabric that allows stretch in its fit. The roll over waist is decorated with a single bow at the center. Made with viscose blend. Machine wash cold, tumble dry low. |,|$34.00$|,||,|KICKEE-PANTS-PINK-POLKA-DOT-YOGA-PANT|,|$URL$kickee-pants-pink-polka-dot-yoga-pant.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-pink-polka-dot-yoga-pant-1.jpg||-||KicKee Pants Plumeria Footie for Girls|,|Sure to bring sweet dreams this new infant footie comes from designer KicKee Pants. The pink outfit is covered in small daisies delight in the warmth of summer. Her long sleeves are finished with flip paw cuffs to keep scratches away as she naps. The tiny ruffle that runs down the center accompanies the changing snaps. The back of the romper is decorated with three qauint rows of ruffles. Bamboo. Gentle cycle in cold. |,|$39.00$|,||,|KICKEE-PANTS-PLUMERIA-FOOTIE-GIRLS|,|$URL$kickee-pants-plumeria-footie-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-plumeria-footie-for-girls-1.jpg||-||KicKee Pants Plumeria Romper Sweetie|,|Filled with the carefree spirit of summer, this new infant romper was designed by KicKee Pants. The light pink fabric is as soft as can be on her skin while sweet daisies dance in a girly print. The elastic waist gathers to separate the bodice from the shorts while the shoulder straps frame the ruffled neckline. Two swooping pockets are found on the front of the romper trimmed with the same ruffles. The legs feature inseam snaps and an elastic ruffled hem. Bamboo. Gentle cycle in cold. |,|$19.00$|,||,|KICKEE-PANTS-PLUMERIA-ROMPER-SWEETIE|,|$URL$kickee-pants-plumeria-romper-sweetie.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-plumeria-romper-sweetie-12.jpg||-||KicKee Pants Romper for Girls in Green Meadow Flower Lattice|,|^|A darling creation from designer KicKee Pants, this baby girls coverall is sure to make a great gift. The long sleeves and legs are perfect to keep her delicate skin warm and cozy in the comfortable, soft fabric. The lime green background is dressed with a sweet lattice print. Pink contrast is found at the cuffs, the hem, and running down the center in brilliant ruffles. Other new pieces from KicKee Pants are made in the same fabulous fabric! Bamboo. Gentle cycle in cold. NEWBORN AND 6-12 MOS ONLY AVAILABLE.  ^||,|$29.00$|,||,|KICKEE-PANTS-ROMPER-GIRLS-GREEN-MEADOW-FLOWER-LATTICE|,|$URL$kickee-pants-romper-girls-green-meadow-flower-lattice.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-romper-for-girls-in-green-meadow-flower-lattice-1.jpg||-||KicKee Pants Stripe Infant Girls Romper|,|Available in infant sizes, this KicKee Pants summer romper is a bright addition to her closet. The top of the romer featues a slight sweatheart neckline accented with fuchsia ruffles and wide shoulder straps. The island stripe print is fit for any princess while has a whimsical feel with its diagonal direction. The bottom of the romper is styled for a ruffled bloomer look while offering mom the ease of snaps lining the inseam. Pink ruffles accent the pockets while the hem of both legs are ruffled with a stretch elastic. Bamboo. Gentle cycle in cold. |,|$19.00$|,||,|KICKEE-PANTS-STRIPE-INFANT-GIRLS-ROMPER|,|$URL$kickee-pants-stripe-infant-girls-romper.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-stripe-infant-girls-romper-1.jpg||-||KicKee Pants Striped Gown Convertible and Hat|,|Unique from the rest, this fabulous convertible gown comes from KicKee Pants. The pink stripes wrap around the entire piece while her long sleeves give her warmth. A dark ruffle falls down the front while the changing snaps are fitted to create a gown or romper. The gown is accompanied by a matching hat. The fabric is soft on her skin and matches several other new arrivals for the season! Bamboo. Gentle cycle in cold. |,|$38.00$|,||,|KICKEE-PANTS-STRIPED-GOWN-CONVERTIBLE-HAT|,|$URL$kickee-pants-striped-gown-convertible-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-striped-gown-convertible-and-hat-1.jpg||-||KicKee Pants Swaddling Blanket Christmas Cranberry|,|A solid accessory to match the new outfit from KicKee Pants, this swaddling blanket makes a perfect finish to your baby shower gift. The berry pink is a rich shade while complimented with the lighter pink that runs around the edges. The soft fabric is created from bamboo and is gentle upon her skin. With a blanket this soft, she is sure to nap in cozy warmth. Machine wash on gentle, viscose blend. |,|$22.00$|,||,|KICKEE-PANTS-SWADDLING-BLANKET-CHRISTMAS-CRANBERRY|,|$URL$kickee-pants-swaddling-blanket-christmas-cranberry.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-swaddling-blanket-christmas-cranberry-1.jpg||-||KicKee Pants Swaddling Blanket in Rosy Pink|,|A receiving blanket that matches the new pieces from the fall collection by designer KicKee Pants. This blanket is made with the same soft viscose blend that fills the collection. The fabric is gentle on her skin and wraps her up in warmth. The rose pink shade is complimented with the glacier blue trimming. Wash on gentle cycle. |,|$22.00$|,||,|KICKEE-PANTS-SWADDLING-BLANKET-ROSY-PINK|,|$URL$kickee-pants-swaddling-blanket-rosy-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-swaddling-blanket-in-rosy-pink-1.jpg||-||KicKee Pants Watermelon Ruffled Blanket Large|,|In a sweet print, this baby girls blanket is perfect to keep her cozy or to lay her on the floor. The light pink front is decorated with slices of watermelon to match the dark flamingo pink found on the reverse. Girly ruffles run around the edges of this blanket to finish it off beautifully! This print matches several new arrivals. Bamboo. Gentle cycle in cold. |,|$39.00$|,||,|KICKEE-PANTS-WATERMELON-RUFFLED-BLANKET-LARGE|,|$URL$kickee-pants-watermelon-ruffled-blanket-large.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kickee-pants-watermelon-ruffled-blanket-large-1.jpg||-||Kone Shoes Infant Leather Moccasin Flats in Red|,|^|With that patent leather shine, these red moccasin flats from Kone Shoes cap off that holiday outfit perfectly. They feature a penny loafer inspired design on the toe, contrasting stitching, and no-slip grippers on the bottom sole to secure her every step. Lined with bone white leather. INFANT SIZE 1 AND 2 LEFT. ^||,|$9.00$|,||,|KONE-SHOES-MOCCASIN-FLATS-RED|,|$URL$kone-shoes-moccasin-flats-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kone-shoes-infant-leather-moccasin-flats-in-red-13.jpg||-||Kone Shoes Infant Leather Moccasin Fuchsia Pink|,|Reminiscent of the penny loafer style, these new patent leather flats from Kone Shoes feature the classic loafer style on each toe, contrast stitching for an extra pop, and no-slip grippers on the bottom of the shoe to keep her steps secure. Offered in a candy pink and lined with bone white leather. |,|$9.00$|,||,|KONE-SHOES-MOCCASIN-FLATS-FUCHSIA|,|$URL$kone-shoes-moccasin-flats-fuchsia.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kone-shoes-infant-leather-moccasin-fuchsia-pink-13.jpg||-||Kone Shoes Leather Moccasin Infant Petal Pink|,|Too adorable for words, these new leather moccasin flats offered from Kone Shoes are perfect for any little girl. Featuring a penny loafer style on each toe and no-slip grippers on the bottom sole, these shoes are the perfect finishing touch in a pretty petal pink. Lined with bone white leather. |,|$9.00$|,||,|KONE-SHOES-MOCCASIN-FLATS-PINK|,|$URL$kone-shoes-moccasin-flats-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kone-shoes-leather-moccasin-infant-petal-pink-12.jpg||-||Kone Shoes Patent Leather Heart Moccasins in Candy Pink|,|^|Delicious in candy pink, these new moccasin flats from Kone Shoes are a sweet finish to her favorite pink outfit. The pink shoes feature the contrast stitching typical in moccasins, two drawstring hearts on each toe, and a rubber bottom sole for a firm grip. Lined with a bone white leather. TODDLER SIZE 6 ONLY AVAILABLE. ^||,|$19.00$|,||,|KONE-SHOES-HEART-MOCCASINS-PINK|,|$URL$kone-shoes-heart-moccasins-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kone-shoes-patent-leather-heart-moccasins-in-candy-pink-11.jpg||-||Kone Shoes Patent Leather Heart Moccasins in Red|,|^|With plenty of spirit, these patent red leather moccasin flats new from Kone Shoes finish off that her outfit perfectly. The red shoes feature the contrast stitching typical in moccasins, two drawstring hearts on each toe, and a rubber bottom sole for a firm grip. Lined with a bone white leather. Amazing European quality leather shoes. SIZE 5 REMAINING.  ^||,|$19.00$|,||,|KONE-SHOES-HEART-MOCCASINS-RED|,|$URL$kone-shoes-heart-moccasins-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/kone-shoes-patent-leather-heart-moccasins-in-red-13.jpg||-||La Jenns Bunny Capri Set for Girls|,|Ready for any Easter egg hunt, this new La Jenns outfit is available from sizes 2T through 6X. The top is characterized by a large blue bunny applique dressed with a bowtie. The square neckline is framed by wide shoulder straps that are secured with wooden buttons. The yellow and pink patterns are a unique blend that coordinate perfectly. The wide ruffle hem is covered with large dots. The matching pants are created with the blue tulip print and finished with a pink bell hem. Cotton. Machine wash cold. |,|$59.00$|,||,|LA-JENNS-BUNNY-CAPRI-SET-GIRLS|,|$URL$la-jenns-bunny-capri-set-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/la-jenns-bunny-capri-set-for-girls-1.jpg||-||La Jenns Butterfly Dress for Infants|,|From designer La Jenns, this new infant dress is sure to be a hit this spring. The pink dress has a shapeless fit while small polka dots wrap around the piece. The large butterfly applique features button and rick rack ribbon accents. The dress is finished with a sky blue ruffle. The bloomer shorts placed beneath are covered with a large flower pattern. Both legs are hemmed with a ruffle. 100% cotton. Machine wash cool, tumble dry. Made in the USA. |,|$57.00$|,||,|LA-JENNS-BUTTERFLY-DRESS-INFANTS|,|$URL$la-jenns-butterfly-dress-infants.html|,|http://ep.yimg.com/ay/yhst-17102259411242/la-jenns-butterfly-dress-for-infants-1.jpg||-||La Jenns Capri Set for Toddlers with Dog Applique|,|A sweet arrival, this new girls outfit comes from designer La Jenns. The white top has a flowing, relaxed fit that is finished with a wide ruffle. Stripes of ribbons fall down the white fabric while the colorful neckline features quaint ruffled cap sleeves. A blue patterned wiener dog applique is found upon the front. The matching pants are created with a large floral print and elastic waistline. The ruffle found on both legs matches the neckline of the top. 100% cotton. Machine wash cool, tumble dry. Made in the USA. |,|$59.00$|,||,|LA-JENNS-CAPRI-SET-TODDLERS-DOG-APPLIQUE|,|$URL$la-jenns-capri-set-toddlers-dog-applique.html|,|http://ep.yimg.com/ay/yhst-17102259411242/la-jenns-capri-set-for-toddlers-with-dog-applique-1.jpg||-||La Jenns Dragonfly Infant Romper|,|Filled with a fun blend of patterns, these new girls overalls come from the fabulous brand La Jenns. The front features a lime zebra pattern and a square neckline. The wide shoulder straps are secured by wooden buttons. Upon the kaleidoscope flower print we find a large dragonfly applique. The body of the dragonfly is created with buttons. The wide legs are finished with a bell ruffle. 100% cotton. Machine wash cool, tumble dry. Made in the USA. |,|$49.00$|,||,|LA-JENNS-DRAGONFLY-INFANT-ROMPER|,|$URL$la-jenns-dragonfly-infant-romper.html|,|http://ep.yimg.com/ay/yhst-17102259411242/la-jenns-dragonfly-infant-romper-1.jpg||-||La Jenns Dress for Girls with Snail Applique|,|Sweet as can be, this new designer girls outfit comes from La Jenns. The dress features a relaxed fit that is finished with a quaint ruffle hemline. Two buttons are found on her shoulders while a cute flower blooms on the skirt. Beside the flower we find a unique snail applique completed with unique accents. 100% Cotton. Machine wash cool. Tumble dry. |,|$58.00$|,||,|LA-JENNS-DRESS-GIRLS-SNAIL-APPLIQUE|,|$URL$la-jenns-dress-girls-snail-applique.html|,|http://ep.yimg.com/ay/yhst-17102259411242/la-jenns-dress-for-girls-with-snail-applique-8.jpg||-||La Jenns Easter Basket Infant Romper|,|New from designer La Jenns, this fabulous girls overall is a delightful arrival for the coming spring. The empire waist top boasts of a soft blue and pink floral print . Wide lime green straps rest upon her shoulders and are adorned with wooden buttons. The light rose pink is covered with quaint polka dots while a wide green bell ruffle finishes both legs. A large basket applique is found on the let leg filled with three patterned eggs. A pleated ribbon, small pom poms, large bow, and a rick rack ribbon add the finishing touches. 100% cotton. Machine wash cool, tumble dry. |,|$49.00$|,||,|LA-JENNS-EASTER-BASKET-INFANT-ROMPER|,|$URL$la-jenns-easter-basket-infant-romper.html|,|http://ep.yimg.com/ay/yhst-17102259411242/la-jenns-easter-basket-infant-romper-1.jpg||-||La Jenns Girls Capri Set with Snail Applique|,|Matching her younger sisters dress, this new swing set from La Jenns is an adorable creation. The top boasts of a pale yellow bodice with an overall fit that is created by the wide shoulder straps and square neckline. A single ruffle rests upon the waist while the pink flower skirt is finished with a blue ruffle hem. A large snail applique is adorned with a ribbon shell. A single round flower blooms nearby. The matching pants are made from the tulip flower pattern and double bell hems. Cotton. Machine wash cool. Tumble dry. |,|$59.00$|,||,|LA-JENNS-GIRLS-CAPRI-SET-SNAIL-APPLIQUE|,|$URL$la-jenns-girls-capri-set-snail-applique.html|,|http://ep.yimg.com/ay/yhst-17102259411242/la-jenns-girls-capri-set-with-snail-applique-15.jpg||-||La Jenns Infant Bubble with Dog Applique|,|^|La Jenns is now offering this adorable baby girls romper. The white fabric is textured with ribbon stripes. The neckline is mimicked in the back while a wooden button rests upon both shoulders. The legs finish with an elastic ruffle hem. A large blue applique resembles a wiener dog complete with a flower on her ear. 100% cotton. Machine wash cool, tumble dry. Made in the USA. Only 6MOS Remaining ^||,|$39.00$|,||,|LA-JENNS-INFANT-BUBBLE-DOG-APPLIQUE|,|$URL$la-jenns-infant-bubble-dog-applique.html|,|http://ep.yimg.com/ay/yhst-17102259411242/la-jenns-infant-bubble-with-dog-applique-1.jpg||-||La Jenns Infant Romper Floral|,|Bright and enjoyable, this fun new design comes from La Jenns. The wide straps frame the classic square overall neckline secured with two buttons. The shoulders are adorned with striped ruffles. The spring flower print is placed upon a yellow background and coordinates with the large polka dot pattern. Both legs are finished with a wide ruffle. 100% cotton. Machine wash cool, tumble dry. |,|$49.00$|,||,|LA-JENNS-INFANT-ROMPER-FLORAL|,|$URL$la-jenns-infant-romper-floral.html|,|http://ep.yimg.com/ay/yhst-17102259411242/la-jenns-infant-romper-floral-1.jpg||-||La Jenns Toddler Capri Set with Elephant|,|^|Inspired by the fun found at the circus, this new little girls outfit comes from La Jenns. The top boasts of its white and black chevron stripe. The shoulders receive a punch of pink lemonade color with the ruffle accented straps. The large elephant applique has pink ears and a cute blue body. Held by his trunk is a single balloon. The legs are worn beneath in a rich pink pattern. The elastic waist is comfortable to wear. Both legs finish with a double bell hemline to match the bodice. Cotton. Machine wash cold. SIZE 2T ONLY LEFT.  ^||,|$59.00$|,||,|LA-JENNS-TODDLER-CAPRI-SET-ELEPHANT|,|$URL$la-jenns-toddler-capri-set-elephant.html|,|http://ep.yimg.com/ay/yhst-17102259411242/la-jenns-toddler-capri-set-with-elephant-17.jpg||-||La Piccola Danza Mermaid Blue Girls Sequin Dress|,|^|A dress to spark her imagination, this mermaid blue girls sequin dress comes from designer La Piccola Danza. The bodice and short sleeves of this beautiful dress are covered in mermaid blue sequins that shimmer and catch the light as she moves. The skirt is in a lighter shade of the same blue. Rows of ruffles flow from the drop waist over a satin mermaid blue underskirt. A satin sash sits at the waist. The back has a full zipper. Made from nylon/polyester. Hand wash cold, hang to dry. SIZE 8 ONLY LEFT.  ^||,|$69.00$|,||,|LA-PICCOLA-DANZA-MERMAID-BLUE-GIRLS-SEQUIN-DRESS|,|$URL$la-piccola-danza-mermaid-blue-girls-sequin-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/la-piccola-danza-mermaid-blue-girls-sequin-dress-17.jpg||-||La Piccola Danza Pink Satin Beaded Bodice Ruffle Dress|,|She sparkle like a diamond in this brilliant girls dress from designer La Piccola Danza. The strappy bodice of pink satin is beautifully embellished with faux pearls and sparkling jewel accents. The pink satin continues at the back. The skirt is adorned with white tulle ruffles over a white underskirt. A full zipper is at the back. Made from cotton/spandex/polyester. Dry clean only. |,|$39.00$|,||,|LA-PICCOLA-DANZA-PINK-SATIN-BEADED-BODICE-RUFFLE-DRESS|,|$URL$la-piccola-danza-pink-satin-beaded-bodice-ruffle-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/la-piccola-danza-pink-satin-beaded-bodice-ruffle-dress-14.jpg||-||La Piccola Danza Sequined Coral Ruffle Girls Dress|,|A dazzling dress for your little darling, this girls dress comes from designer La Piccola Danza. The sleeveless bodice is done in a stunning sequin pattern of flowers in shades of coral, pink and white. The sequin pattern is continued on the back of the bodice. The skirt is done in layers of coral tulle layers over a coral underskirt. A full zipper is at the back. Made from nylon/polyester. Hand wash cold, line dry. |,|$39.00$|,||,|LA-PICCOLA-DANZA-SEQUINED-CORAL-RUFFLE-GIRLS-DRESS|,|$URL$la-piccola-danza-sequined-coral-ruffle-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/la-piccola-danza-sequined-coral-ruffle-girls-dress-14.jpg||-||LaBella Flora Childrens Boutique Gift Certificate $100|,|Perfect for all special occasions, LaBella Flora Gift Certificates give her the gift of picking out a designer accessory or outfit that speaks to her style! The gift certificate is redeemable on any purchase. Expires 1 year from date of purchase.

A unique gift certificate code is emailed to the buyer one day after purchase. This code is redeemed online during the checkout process. |,|$100.00$|,||,|LABELLA-GIFT-100|,|$URL$labella-gift-100.html|,|http://ep.yimg.com/ay/yhst-17102259411242/labella-flora-childrens-boutique-gift-certificate-100-6.jpg||-||LaBella Flora Childrens Boutique Gift Certificate $25|,|Perfect for all special occasions, LaBella Flora Gift Certificates give her the gift of picking out a designer accessory or outfit that speaks to her style! The gift certificate is redeemable on any purchase. Expires 1 year from date of purchase.

A unique gift certificate code is emailed to the buyer one day after purchase. This code is redeemed online during the checkout process. |,|$25.00$|,||,|LABELLA-GIFT-25|,|$URL$labella-gift-25.html|,|http://ep.yimg.com/ay/yhst-17102259411242/labella-flora-childrens-boutique-gift-certificate-25-6.jpg||-||LaBella Flora Childrens Boutique Gift Certificate $50|,|Perfect for all special occasions, LaBella Flora Gift Certificates give her the gift of picking out a designer accessory or outfit that speaks to her style! The gift certificate is redeemable on any purchase. Expires 1 year from date of purchase.

A unique gift certificate code is emailed to the buyer one day after purchase. This code is redeemed online during the checkout process. |,|$50.00$|,||,|LABELLA-GIFT-50|,|$URL$labella-gift-50.html|,|http://ep.yimg.com/ay/yhst-17102259411242/labella-flora-childrens-boutique-gift-certificate-50-1.jpg||-||LaBella Flora Childrens Boutique Gift Certificate $75|,|Perfect for all special occasions, LaBella Flora Gift Certificates give her the gift of picking out a designer accessory or outfit that speaks to her style! The gift certificate is redeemable on any purchase. Expires 1 year from date of purchase.

A unique gift certificate code is emailed to the buyer one day after purchase. This code is redeemed online during the checkout process. |,|$75.00$|,||,|LABELLA-GIFT-75|,|$URL$labella-gift-75.html|,|http://ep.yimg.com/ay/yhst-17102259411242/labella-flora-childrens-boutique-gift-certificate-75-1.jpg||-||Le Pink Afternoon Tea Girls Cap Sleeve Dress|,|Sweet and sophisticated, this girls cap sleeve dress from Le Pink by Little Mass is a classic. Perfect for a holiday celebration, afternoon tea, a wedding or other upscale event, it's truly beautiful. Gorgeous white lace overlays the dress from neckline to hemline. The bodice boasts of a rounded neckline and cap sleeves. The full skirt has several layers with tulle accents peaking from the hemline. A ribbon of black lace rims the hem. A ribbon ties off at the waist. Made from polyester/cotton/acetate. Machine wash cold, hang to dry. |,|$19.00$|,||,|LE-PINK-AFTERNOON-TEA-GIRLS-CAP-SLEEVE-DRESS|,|$URL$le-pink-afternoon-tea-girls-cap-sleeve-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-afternoon-tea-girls-cap-sleeve-dress-14.jpg||-||Le Pink Bella Girls Dress|,|A gorgeous new creation by designer Le Pink, this spring dress for girls is perfect for birthdays and weddings. The empire bodice features a smocked back that stretches for a comfortable fit. The sheer straps are ruffles of matching tulle dressed with small flowers. The same blooms are set upon the front of the bodice with sequin centers. A tulle bow is found on the left side of her waistline. The skirt is filled with the dreamy tulle falling from white down to pink. Polyester. Hand wash, hang dry. Made in the USA. |,|$69.00$|,||,|LE-PINK-BELLA-GIRLS-DRESS|,|$URL$le-pink-bella-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-bella-girls-dress-1.jpg||-||Le Pink Electric Mermaid Pink Tutu Girls Dress|,|^|Bright and beautiful, this girls tutu dress is from the Le Pink line of designer Little Mass. The sleeveless bodice is outlined in bright yellow and has a scoop neck. Bright pink sequins sparkle all the way down to the drop waist. The back repeats the yellow. The tutu skirt is created from double layers of tiered pink tulle over an underskirt of tiered pink. A removable yellow ribbon bow sits at her waist. Made from cotton/polyester/spandex. Machine wash cold, tumble dry low. SIZE 2T, 3T AND 6X ONLY REMAINING. ^||,|$39.00$|,||,|LE-PINK-ELECTRIC-MERMAID-PINK-TUTU-GIRLS-DRESS|,|$URL$le-pink-electric-mermaid-pink-tutu-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-electric-mermaid-pink-tutu-girls-dress-15.jpg||-||Le Pink Fancy Girls Dress in Ivory Rose|,|Filled with sweet style, this gorgeous girls dress comes from the Le Pink line by designer Little Mass. The sleeveless bodice boasts of the textured ivory flowers that cover it entirely and a hidden zipper that secures the fit in the back. The peachy pink tulle is tied around the waist and adds a bit of dazzle with the sparkling bow in the front. The dreamy skirt falls in layers of the same pink tulle and offers the same pink lining as the bodice. This dress is perfect for holiday celebrations, birthdays, and recitals! Created in 100% polyester. Machine wash on gentle and tumble dry on low. |,|$49.00$|,||,|LE-PINK-FANCY-GIRLS-DRESS-IVORY-ROSE|,|$URL$le-pink-fancy-girls-dress-ivory-rose.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-fancy-girls-dress-in-ivory-rose-13.jpg||-||Le Pink Girls Aqua Mermaid Flower Dress|,|^|She'll fall in love completely with this gorgeous girls dress from Le Pink. The aqua coloring brings to mind a little mermaid. Petals of white, aqua and yellow with jewel centers grace the bodice. A double line of jewel embellishments shine from the empire waist. The skirt is done in several layers of white and light yellow tulle over an satiny aqua underskirt. The top layer of tulle is done in a bubble hem and holds more petal accents. A full zipper is at the back. Made from polyester/spandex. Machine wash cold, tumble dry low. (1) 6 AND (1) 6X ONLY.  ^||,|$39.00$|,||,|LE-PINK-GIRLS-AQUA-MERMAID-FLOWER-DRESS|,|$URL$le-pink-girls-aqua-mermaid-flower-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-girls-aqua-mermaid-flower-dress-14.jpg||-||Le Pink Girls Party Dress in Leopard Sequins|,|Simply precious, this new little girls dress from Le Pink will be one that she never forgets. The sleeveless neckline is accented with ivory tulle ruffles and a hidden zipper runs up the back. Small sequins line the top in a fun leopard print. The skirt is separated into three tiers of tulle layers finished with a ruffle. A lining on the skirt is the same warm ivory. Dress: 100% polyester; Lining: 100% acetate. Machine wash and hang to dry. |,|$39.00$|,||,|LE-PINK-GIRLS-PARTY-DRESS-LEOPARD-SEQUINS|,|$URL$le-pink-girls-party-dress-leopard-sequins.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-girls-party-dress-in-leopard-sequins-1.jpg||-||Le Pink Girls Pink Dress|,|Ready for her Easter celebration, this fancy girls dress from designer Le Pink is a fanciful creation sure to delight. The empire bodice is fitted with a hidden zipper in the back. The front is covered with colorful flowers and small touches of glimmering sequins. The skirt opens to a princess shape thanks to the layers of structured tulle overlays. The hemline of the tulle finds a few flower accents to match the bodice. The dress is fully lined. Polyester. Hand wash, hang dry. Made in the USA. |,|$79.00$|,||,|LE-PINK-GIRLS-EASTER-DRESS|,|$URL$le-pink-girls-easter-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-girls-pink-dress-1.jpg||-||Le Pink Girls Special Occasion Dress|,|Beyond elegance, this fabulous new girls dress comes from designer Le Pink. The bodice features a unique texture of petals that cover the front. The neckline is slightly curved and framed with thin spaghetti straps. Her empire waistline is decorated with shimmering gold and gems. The long skirt falls in the same light peachy pink. Layers of tulle overlay the skirt and fall below the hem and matching flowers are sprinkled down off centered to one side. Polyester. Hand wash, hang dry. Made in the USA. |,|$102.00$|,||,|LE-PINK-GIRLS-SPECIAL-OCCASION-DRESS|,|$URL$le-pink-girls-special-occasion-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-girls-special-occasion-dress-1.jpg||-||Le Pink Girls Tulle Dress in Pink|,|Filled with the precious style of spring, this designer dress for girls comes from Le Pink by Little Mass. The dress boasts of its feminine style created with the tiers of light pink tulle ruffles. The bodice has an empire waist that is accented with a ribbon that ties into a bow. Her thin straps create the neckline and make it easy to pair a light sweater over top if needed. The skirt opens in an A line shape. Polyester. Hand wash, hang dry. Made in the USA. |,|$78.00$|,||,|LE-PINK-GIRLS-TULLE-DRESS-PINK|,|$URL$le-pink-girls-tulle-dress-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-girls-tulle-dress-in-pink-1.jpg||-||Le Pink Jewel Girls Birthday Dress in Pink|,|^|Accompanying her on a very special day, this new girls dress comes from fabulous Le Pink. The empire bodice offers cap sleeves, a hidden zipper back, and cascading ruffles that add texture. A thin velvet ribbon wraps around her waist and ties in a bow at the back while accented with fun gems on the front. The skirt is created with layers of pink tulle. 100% polyester. Machine wash and hang to dry. Made in the USA. (1) 2T ONLY LEFT. ^||,|$39.00$|,||,|LE-PINK-JEWEL-GIRLS-BIRTHDAY-DRESS-PINK|,|$URL$le-pink-jewel-girls-birthday-dress-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-jewel-girls-birthday-dress-in-pink-1.jpg||-||Le Pink Le Beaute Cascading Ruffles Girls Dress|,|^|Your little beauty will shine in this lovely girls dress from the Le Pink collection of designer Little Mass. The strappy bodice is covered in sequins that create a heart pattern of gold and pink. The wispy straps are adjustable. The back of the bodice is smocked. White ruffles cascade from the waist to the bubble hemline over an underskirt of pink. Made from cotton/polyester/spandex. Machine wash cold, tumble dry low. 24 MOS ONLY LEFT.  ^||,|$29.00$|,||,|LE-PINK-LE-BEAUTE-CASCADING-RUFFLES-GIRLS-DRESS|,|$URL$le-pink-le-beaute-cascading-ruffles-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-le-beaute-cascading-ruffles-girls-dress-14.jpg||-||Le Pink Leopard Glam Tween Party Dress|,|^|Stunning in style, this new tween girls dress comes from the Le Pink line by designer Little Mass. The bodice features an eye catching leopard print created with rows of sequins masked slightly by the black tulle overlay. The same black tulle ruffles around the sleeveless neckline. Fully lined for comfort while a hidden zipper runs up the back. A thin black satin ribbon ties around the dress at her natural waist. The skirt is tiered with ruffled black mesh. Dress: 100% polyester. Lining: 100% acetate. Machine wash and hang to dry. (1) 8 ONLY LEFT.  ^||,|$47.00$|,||,|LE-PINK-LEOPARD-GLAM-TWEEN-PARTY-DRESS|,|$URL$le-pink-leopard-glam-tween-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-leopard-glam-tween-party-dress-17.jpg||-||Le Pink Little Girls Dress in Pucci Swirls|,|Matching her older sisters hi-low dress, this new arrival was designed by Le Pink. The cap sleeve garment boasts of a trapeze cut accented with a scoop neckline. A single button keyhole is found on the back while large black flowers sit beneath the neck on the front. The unique design is mixed with stripes and swirls. The fabric is slightly sheer and offers a silky feel. A single ruffle wraps around the hemline to finish this look. 100% polyester, fully lined. Machine wash and hang dry. |,|$32.00$|,||,|LE-PINK-LITTLE-GIRLS-DRESS-PUCCI-SWIRLS|,|$URL$le-pink-little-girls-dress-pucci-swirls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-little-girls-dress-in-pucci-swirls-1.jpg||-||Le Pink Mimosa Coral Chiffon Girls Dress|,|A touch of lace adorns this smart and stylish girls dress from Le Pink by Little Mass. The bodice boasts of cap sleeves and triangles of lace at the neckline. An overlay of coral chiffon gathers at the bodice and flows to the ruffled hemline. An additional lace accent is found on the ruffle. The waistline is gathered with elastic and ties with a white ribbon. Made from rayon/spandex/polyester. Machine wash cold, delicate cycle, hang to dry. |,|$29.00$|,||,|LE-PINK-MIMOSA-CORAL-CHIFFON-TWEEN-DRESS|,|$URL$le-pink-mimosa-coral-chiffon-tween-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-mimosa-coral-chiffon-girls-dress-1.jpg||-||Le Pink Mimosa Coral Girls Dress|,|^|This stunning girls dress is from the Le Pink collection of Little Mass. The dress is beautifully sequined on the bodice. Gold sequins follow a serpentine pattern across the front and back of the sleeveless bodice. Coral rosettes reside on the waist. The full skirt features a tulle overlay with a coral underskirt. A full zipper and ties in coral are found at the back. Made from 100% polyester. Machine wash cold, hang to dry. (1) SIZE 2T REMAINING. ^||,|$29.00$|,||,|LE-PINK-MIMOSA-CORAL-GIRLS-DRESS|,|$URL$le-pink-mimosa-coral-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-mimosa-coral-girls-dress-14.jpg||-||Le Pink Tween Girls Dress in Hi Low Hem|,|^|A new design by Le Pink, this tween dress is filled with a whimsical dream. The unique print boasts of shades of pink, teal, and plum that dances and billows upon the sheer fabric. The bodice receives a blouson look from the elastic waistline. Black sequins adorn the shoulders and a single button keyhole is found on the back. An accompanying tulle sash is tied around the waist and adorned with black sequins on the front. This dress finishes with a high low hemline and is fully lined. 100% polyester, machine wash and hang to dry. (2) SIZE 7 ONLY REMAIN.  ^||,|$42.00$|,||,|LE-PINK-TWEEN-GIRLS-DRESS-HI-LOW-HEM|,|$URL$le-pink-tween-girls-dress-hi-low-hem.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-tween-girls-dress-in-hi-low-hem-1.jpg||-||Le Pink Victoria Lace Girls Sleeveless Dress|,|^|This lace dress from designer Le Pink is a sweet style for the any season. The sleeveless bodice is a soft velvet and boasts of a belt that ties in the back and is adorned with scalloped velvet and lace in the front. The pink tulle skirt is covered with tiered black lace and holds its full shape. Perfect for photos or special occasions! Polyester blend, machine washable. SIZE 14 ONLY LEFT.  ^||,|$39.00$|,||,|LE-PINK-VICTORIA-LACE-GIRLS-SLEEVELESS-HOLIDAY-DRESS|,|$URL$le-pink-victoria-lace-girls-sleeveless-holiday-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-pink-victoria-lace-girls-sleeveless-dress-17.jpg||-||Le' Za Me Baby Bonnet for Girls Christmas Floral|,|For your little snow baby, this new girls bonnet comes from Le' Za Me. The bonnet is covered with red and lime to match the holiday season. The unique pattern is inspired by snowflakes and has a whimsical appeal. The ruffle that is found on the front is dressed with three blooms side by side. Two of these flowers are made with the same pattern while the center is a solid red to match the large bow that is tied for a sure fit. 100% Cotton. Machine Wash in Cold Water. Tumble Dry Low. |,|$19.00$|,||,|LE-ZA-ME-BABY-BONNET-GIRLS-CHRISTMAS-FLORAL|,|$URL$le-za-me-baby-bonnet-girls-christmas-floral.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-za-me-baby-bonnet-for-girls-christmas-floral-1.jpg||-||Le' Za Me Baby Girl Bonnet Golden Celebration|,| |,|$19.00$|,||,|LE-ZA-ME-BABY-GIRL-BONNET-GOLDEN-CELEBRATION|,|$URL$le-za-me-baby-girl-bonnet-golden-celebration.html|,|||-||Le' Za Me Baby Girl Bonnet Hat Fuchsia Fun|,|Le' Za Me is a boutique baby brand now offering this adorable baby girls bonnet. The pink fabric is covered with a flowery ivory pattern. The large bow tied under her chin is also in this fabric. Wrapping across the top is a grey flower pattern completed with scallop ruffles. Three rosettes sit on the right side of her head and complete this darling look. A sweet bonnet is the perfect prop for her next photo shoot! 100% Cotton. Machine wash cold. Tumble dry. |,|$19.00$|,||,|LE-ZA-ME-BABY-GIRL-BONNET-HAT-FUCHSIA-FUN|,|$URL$le-za-me-baby-girl-bonnet-hat-fuchsia-fun.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-za-me-baby-girl-bonnet-hat-fuchsia-fun-1.jpg||-||Le' Za Me Baby Girl Bonnet Hat Red Damask|,| |,|$19.00$|,||,|LE-ZA-ME-BABY-GIRL-BONNET-HAT-RED-DAMASK|,|$URL$le-za-me-baby-girl-bonnet-hat-red-damask.html|,|||-||Le' Za Me Baby Girl Bonnet Winter Fun|,|A unique piece, this baby bonnet was designed by Le' Za Me. The bonnet features a swirling print in blue, red, and gray. This fabric also creates the ruffle and rosette accents. The flowers are finished with large red button centers. A tie is secured under her chin into a bow. 100% Cotton. Machine Wash in Cold Water. Tumble Dry Low. |,|$19.00$|,||,|LE-ZA-ME-BABY-GIRL-BONNET-WINTER-FUN|,|$URL$le-za-me-baby-girl-bonnet-winter-fun.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-za-me-baby-girl-bonnet-winter-fun-1.jpg||-||Le' Za Me Infant Bonnet for Girls Checkered Christmas|,| |,|$19.00$|,||,|LE-ZA-ME-INFANT-BONNET-GIRLS-CHECKERED-CHRISTMAS|,|$URL$le-za-me-infant-bonnet-girls-checkered-christmas.html|,|||-||Le' Za Me Infant Bonnet Pumpkin Spice|,|A cute baby girls gift, this new bonnet comes from the Le' Za Me line. The bonnet blends a coral red with lime, blue, and brown. The chevron stripes provide a modern feel on this vintage twist. The long straps tie into a large bow beneath her chin while a ruffle runs across the top. Off to the right side we find three hand turned rosettes. This item is simply darling in photos! 100% Cotton. Machine Wash in Cold Water. Tumble Dry Low. |,|$19.00$|,||,|LE-ZA-ME-INFANT-BONNET-PUMPKIN-SPICE|,|$URL$le-za-me-infant-bonnet-pumpkin-spice.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-za-me-infant-bonnet-pumpkin-spice-1.jpg||-||Le' Za Me Infant Girl Bonnet Happy Holiday|,|Created by Le' Za Me, this new baby bonnet for girls will help make her next photo shoot memorable and unique. The bonnet features a large, pale sky blue pattern. The red tie is set upon a scallop lined ruffle and creates a large bow under her chin. On the right side we find three matching rosettes. Other cute bonnets are also available from Le' Za Me, a design for everyone! 100% Cotton. Machine Wash in Cold Water. Tumble Dry Low. |,|$19.00$|,||,|LE-ZA-ME-INFANT-GIRL-BONNET-HAPPY-HOLIDAY|,|$URL$le-za-me-infant-girl-bonnet-happy-holiday.html|,|http://ep.yimg.com/ay/yhst-17102259411242/le-za-me-infant-girl-bonnet-happy-holiday-1.jpg||-||Lemon Love Lime Fuchsia Girls Ruffled Top|,|^|From designer Lemon Loves Lime, this fabulous new girls tee has been created as part of their ""Enchanted Garden"" collection for spring and summer. The dark pink top features a soft cotton fabric that is cut for a fitted look. The neckline has a slight curve found to it while both shoulders are wrapped with several ruffles to create the straps. This top can be easily paired with almost any of the Lemon Loves Lime bottoms! Be sure to check out the new skirts. ^||,|$29.00$|,||,|LEMON-LOVE-LIME-FUCHSIA-GIRLS-RUFFLED-TOP|,|$URL$lemon-love-lime-fuchsia-girls-ruffled-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-love-lime-fuchsia-girls-ruffled-top-6.jpg||-||Lemon Love Lime Girls Dress with Cupcake in Fuchsia|,|^|In the ""Summer Fun"" collection, this new girls dress was designed by Lemon Loves Lime. The hot pink dress has an easy fit that pulls on and is made with a soft fabric that feels great on her skin. A frilly fun design, the bodice of the dress features a single cupcake. The cup is decorated with quaint touches while the large frosting is made in a bright blue. A small flower is placed on top of the frosting. The sleeveless tunic fit is relaxed and easy to pull on. The skirt falls in an assymetrical hemline with a wide ruffle that dances with her movements. ^||,|$39.00$|,||,|LEMON-LOVE-LIME-GIRLS-DRESS-CUPCAKE-FUCHSIA|,|$URL$lemon-love-lime-girls-dress-cupcake-fuchsia.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-love-lime-girls-dress-with-cupcake-in-fuchsia-6.jpg||-||Lemon Love Lime Girls Skort in Aqua|,|^|Designed by Lemon Loves Lime, this pair of girls shorts are a sweet separate that can be paired with any of the new character tees for the season. The bright aqua blue is a beautiful choice to wear in the summer sunshine. These shorts offer her a comfortable elastic waist that she won't want to take off. The body of the shorts are covered with tiers of coordinating ruffles, draped in a way that it disguises the short shape. SIZE 2 ONLY REMAINING. ^||,|$29.00$|,||,|LEMON-LOVE-LIME-GIRLS-SKORT-AQUA|,|$URL$lemon-love-lime-girls-skort-aqua.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-love-lime-girls-skort-in-aqua-7.jpg||-||Lemon Love Lime Hummingbird Top in Fuchsia|,|In a hot fuchsia pink, this new Lemon Loves Lime girls top is hard to ignore. The tank has a a jewel neckline and wide straps. The top is fitted and allows slight stretch in its fabric. Her right shoulder is dressed with a romantic rosette with a lime green vine of leaves. Placed directly beside is a beautiful hummingbird applique. The gorgeous lime and purple coloring stands out. |,|$39.00$|,||,|LEMON-LOVE-LIME-HUMMINGBIRD-TOP-FUCHSIA|,|$URL$lemon-love-lime-hummingbird-top-fuchsia.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-love-lime-hummingbird-top-in-fuchsia-6.jpg||-||Lemon Love Lime Little Girls Top in Aqua|,|In cool aqua blue, Lemon Loves Lime is offering this adorable tank top for girls. The light blue is a popular shade for the season, making her feel like she belongs amongst the clouds. The top is cut for a fitted look and the comfortable fabric does allow slight stretch. The neckline is designed with ruffles that become the straps to the top. The layers of these ruffles have great volume to them to match her favorite new skirt or bottoms. |,|$29.00$|,||,|LEMON-LOVE-LIME-LITTLE-GIRLS-TOP-AQUA|,|$URL$lemon-love-lime-little-girls-top-aqua.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-love-lime-little-girls-top-in-aqua-6.jpg||-||Lemon Loves Lime Aqua Infant Headband|,|A gogeous light blue, this baby girls headband is a new creation by Lemon Loves Lime. The light blue fills the two large blooms worn off to one side of her head. Coordinating tulle fabric is layered within the flowers for a dreamy touch. This accesory has a comfortable, stretch fit around her head. |,|$14.00$|,||,|LEMON-LOVES-LIME-AQUA-INFANT-HEADBAND|,|$URL$lemon-loves-lime-aqua-infant-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-aqua-infant-headband-1.jpg||-||Lemon Loves Lime Baby Girl Dress Ruffled Red|,|This new adorable infant dress was designed by fabulous Lemon Loves Lime. The bodice has long sleeves and boasts of its clean lines and wrap V neck. The skirt opens almost to a full circle shape. Scallop tiers of ruffles are layered on the skirt like the frosting on a cake. This dress looks darling at first birthdays or any day of the week! The true red shade is perfect for holiday celebrations! 100% Cotton. Machine wash inside out in warm water. Tumble dry on low. |,|$42.00$|,||,|LEMON-LOVES-LIME-BABY-GIRL-DRESS-RUFFLED-RED|,|$URL$lemon-loves-lime-baby-girl-dress-ruffled-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-baby-girl-dress-ruffled-red-1.jpg||-||Lemon Loves Lime Baby Girls Dress in Light Pink|,|^|Created by Lemon Loves Lime, this baby girls dress is one that will not be forgotten. The light pink cotton is selected for its great quality and ""soft-to-the-touch"" feel, perfect for her baby skin. The sleeveless bodice has a jewel neckline. The skirt of this dress is draped in ruffles. The rows of fabric run straight from waist to hem. These ruffles make a darling detail in photographs! Cotton. Machine wash. ^||,|$36.80$|,||,|LEMON-LOVES-LIME-BABY-GIRLS-DRESS-LIGHT-PINK|,|$URL$lemon-loves-lime-baby-girls-dress-light-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-baby-girls-dress-in-light-pink-1.jpg||-||Lemon Loves Lime Baby Girls Gown Light Purple|,|Created for your newborn princess, this fabulous infant girls gown comes from designer Lemon Loves Lime. The gown features a light lilac shade that compliments her glowing, healthy skin! The soft fabric is kind to her delicate skin while having the perfect drape to create this dreamy look! The wrap neckline is decorated with a few layers of ruffles identical to the one that sits upon the empire waist. The skirt falls gracefully down to the elastic gathered hemline that keeps her legs bundled and looks great in photographs. 100% Cotton. Machine wash inside out in warm water. Tumble dry on low. |,|$34.00$|,||,|LEMON-LOVES-LIME-BABY-GIRLS-GOWN-LIGHT-PURPLE|,|$URL$lemon-loves-lime-baby-girls-gown-light-purple.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-baby-girls-gown-light-purple-18.jpg||-||Lemon Loves Lime Baby Girls Holiday Cardigan|,|Bold in red, this fabulous holiday cardigan comes from the layette line by Lemon Loves Lime. The sweater is created with a classic neckline and long sleeves. The knit fabric is a warm staple for the season. A ring of poppies grace the neck with ruffle petals and a green center. A single button is fastened in the front to finish this look. A matching hat is also available from the collection while quantities last. 100% Cotton. Hand wash in warm water. Lay flat to dry. |,|$49.00$|,||,|LEMON-LOVES-LIME-BABY-GIRLS-HOLIDAY-CARDIGAN|,|$URL$lemon-loves-lime-baby-girls-holiday-cardigan.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-baby-girls-holiday-cardigan-18.jpg||-||Lemon Loves Lime Baby Ruffle Dress in Purple|,|^|The ""Jada"" style from designer Lemon Loves Lime is a fabulous infant dress that is filled with sweet style. The dress offers a wrap, V neck and long sleeves perfect for the months from fall through spring. The light lilac is a color that will look fabulous no matter the season. Tiers of ruffles fall upon the skirt in a scallop shape and dress it up for any occasion. The skirt has almost a full circle shape. 100% Cotton. Machine wash inside out in warm water. Tumble dry on low. ^||,|$42.00$|,||,|LEMON-LOVES-LIME-BABY-RUFFLE-DRESS-PURPLE|,|$URL$lemon-loves-lime-baby-ruffle-dress-purple.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-baby-ruffle-dress-in-purple-1.jpg||-||Lemon Loves Lime Baby Ruffle Pants in Fuchsia|,|Absolutely adorable, these new Lemon Loves Lime infant pants are the perfect piece to add style to her every day look. The rich fuchsia pink is a pop of color that is always welcomed. The pants have an easy pull on fit with a stretch waistband to match the cuffs. Both legs are covered completely with rows of ruffled fabric. Whether she is out shopping with mom, at daycare, or taking photos, these pants are darling. 100% Cotton. Machine wash inside out in warm water. Tumble dry on low. |,|$26.00$|,||,|LEMON-LOVES-LIME-BABY-RUFFLE-PANTS-FUCHSIA|,|$URL$lemon-loves-lime-baby-ruffle-pants-fuchsia.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-baby-ruffle-pants-in-fuchsia-1.jpg||-||Lemon Loves Lime Bella Bloomer in Fuchsia|,|In a fabulous fuchsia, these new baby bloomers were created by Lemon Loves Lime. The dark pink bloomers offer a comfortable elastic waist and a stretch hemline that creates the ruffle that runs around both legs. The combination of the waist and the hemline make the bubble shape that bloomers are known for. These would pair perfectly under her new dress! |,|$12.80$|,||,|LEMON-LOVES-LIME-BELLA-BLOOMER-FUCHSIA|,|$URL$lemon-loves-lime-bella-bloomer-fuchsia.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-bella-bloomer-in-fuchsia-7.jpg||-||Lemon Loves Lime Bella Bloomer in Light Pink|,|Whether they are paired beneath her dress, or matched with her onesies, these darling baby bloomers from Lemon Loves Lime are lovely. The soft light pink cotton fabric was selected to be delicate on her new skin. The bloomer style bubbles out and is gathered with an elastic hem on both legs. This elastic causes a cute rufle to run around both of her legs. Cotton. Machine wash. |,|$12.80$|,||,|LEMON-LOVES-LIME-BELLA-BLOOMER-LIGHT-PINK|,|$URL$lemon-loves-lime-bella-bloomer-light-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-bella-bloomer-in-light-pink-1.jpg||-||Lemon Loves Lime Buttercup Infant Dress|,|Made from a fairytale, this new designer baby dress comes from Lemon Loves Lime. The bright fuchsia pink owns the summer while the sleeveless neckline makes it easy to pair a light sweater with the dress if the air holds a touch of chill. The skirt opens in shape and falls down to a scallop hemline. Lime green threading accent the ruffles which divide the skirt when falling from the waist. |,|$38.40$|,||,|LEMON-LOVES-LIME-BUTTERCUP-INFANT-DRESS|,|$URL$lemon-loves-lime-buttercup-infant-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-buttercup-infant-dress-6.jpg||-||Lemon Loves Lime Cake Cream Skirt in Pink|,|^|Matching several new tops, this fabulous girls skirt from designer Lemon Loves Lime is like the frosting on top of the cake. The stretch waist has a great pull on fit that is perfect for her to pick out herself! The skirt opens to a full circle shape, allowing extra fabric to drape around her legs and dance along with every step. Layers of ruffles are tiered down the skirt. These ruffles alternate between the bright fuchsia and the two lighter pinks that fill the new summer collection. This adorable pink skirt is perfect for her next birthday celebration! SISE 4 AND 8 ONLY REMAINING.  ^||,|$39.00$|,||,|LEMON-LOVES-LIME-CAKE-CREAM-SKIRT-PINK|,|$URL$lemon-loves-lime-cake-cream-skirt-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-cake-cream-skirt-in-pink-7.jpg||-||Lemon Loves Lime Cozy Flower Clip in Purple|,|New from Lemon Loves Lime, this girls flower clip is so pretty. The crocheted petals have a life like shape while the rounded center is the same grape color. |,|$5.00$|,||,|LEMON-LOVES-LIME-COZY-FLOWER-CLIP-PURPLE|,|$URL$lemon-loves-lime-cozy-flower-clip-purple.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-cozy-flower-clip-in-purple-11.jpg||-||Lemon Loves Lime Designer Baby Sweater Ivory|,|Designed by the creative minds at Lemon Loves Lime, this sweet baby sweater is from the fall 2014 layette collection. A single button is fastened on the top of the front while the long sleeves and soft knit adds warmth to her outfit. Four flower accents sit upon the neckline. These flowers boast of light pink ruffles and a bold green center. Pair the matching hat to complete her outfit. 100% Cotton. Hand wash in warm water. Lay flat to dry. |,|$49.00$|,||,|LEMON-LOVES-LIME-DESIGNER-BABY-SWEATER-IVORY|,|$URL$lemon-loves-lime-designer-baby-sweater-ivory.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-designer-baby-sweater-ivory-18.jpg||-||Lemon Loves Lime Do A Dance Cascade Green Skirt|,|^|A perfect new separate to create fanciful outfits this spring, this girls skirt comes from designer Lemon Loves Lime. The soft daiquiri green cotton skirt boasts of an elastic fit waist while ruffles fall down the skirt creating an uneven hemline. Made from cotton. Machine wash warm, tumble dry low. SIZE 2 AND 3 ONLY LEFT.  ^||,|$19.00$|,||,|LEMON-LOVES-LIME-DO-A-DANCE-CASCADE-GREEN-SKIRT|,|$URL$lemon-loves-lime-do-a-dance-cascade-green-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-do-a-dance-cascade-green-skirt-18.jpg||-||Lemon Loves Lime Emma Cardigan for Infants Pink|,|Helping to keep your little girl warm in the cooler months, this new knit sweater from designer Lemon Loves Lime really takes the cake. This cardigan features a classic fit and long sleeves. The front is covered with rows of ruffles in a semi circle pattern. Mair with the Jada Dress for a stunning outfit! Made with 100% prima cotton. Machine wash gentle, tumble dry on low. |,|$29.00$|,||,|LEMON-LOVES-LIME-EMMA-CARDIGAN-INFANTS-PINK|,|$URL$lemon-loves-lime-emma-cardigan-infants-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-emma-cardigan-for-infants-pink-3.jpg||-||Lemon Loves Lime Fish Dress in White|,|A new creation from designer Lemon Loves Lime, this girls dress is sure to be a favorite summer outfit! The drop waist bodice has a tank fit with a sleeveless jewel neckline. The fabric allows slight stretch with its pull on fit. The skirt of this dress is wrapped with three tiers of solid white ruffles. A colorful fish is found upon the front. This applique is colored in bright lime and coral. A few bubbles are placed near where he swims. |,|$39.00$|,||,|LEMON-LOVES-LIME-FISH-DRESS-WHITE|,|$URL$lemon-loves-lime-fish-dress-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-fish-dress-in-white-6.jpg||-||Lemon Loves Lime Frog Necklace for Girls|,|One of Lemon Loves Lime's beautiful handmade necklace designs, this new arrival will have her leaping for joy. The necklace features a fun crochet frog sitting front and center while other crochet designs adorn the necklace as well. The final adornment fits through a loop in place of a clasp. Spot clean with damp cloth. Air dry. |,|$23.20$|,||,|LEMON-LOVES-LIME-FROG-NECKLACE-GIRLS|,|$URL$lemon-loves-lime-frog-necklace-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-frog-necklace-for-girls-1.jpg||-||Lemon Loves Lime Fuchsia Baby Hat with Flowers|,|^|An adorable creation by Lemon Loves Lime, this new infant girls hat is part of their ""Floral Collection."" The rich fuchsia knit is soft and filled with warmth. The bright color stands out during the season while the hem is a ribbed knit. Two mum accents in lilac are worn off to one side and complete with a pink center. This hat matches the ""Lemon Loves Lime Infant Girls Cardigan Poppy Fuchsia"". 100% Cotton. Hand wash in warm water. Lay flat to dry. ^||,|$34.00$|,||,|LEMON-LOVES-LIME-FUCHSIA-BABY-HAT-FLOWERS|,|$URL$lemon-loves-lime-fuchsia-baby-hat-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-fuchsia-baby-hat-with-flowers-1.jpg||-||Lemon Loves Lime Fuchsia Girls Twirly Dress|,|Sure to be loved the moment she puts it on, this fun new dress for girls was designed by Lemon Loves Lime. The hot pink fabric stands out amongst all the other colors that are sure to fill the summer months. The fitted bodice has a square neckline. The wide shoulder straps have slight gathering found at their base to allow for a pleasing shape. The skirt opens in shape and is tiered in four layers of ruffles. These ruffles are created from her dreams as they twirl about with ease. |,|$49.00$|,||,|LEMON-LOVES-LIME-FUCHSIA-GIRLS-TWIRLY-DRESS|,|$URL$lemon-loves-lime-fuchsia-girls-twirly-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-fuchsia-girls-twirly-dress-6.jpg||-||Lemon Loves Lime Fuchsia Headband|,|Bold in fuchsia, this bright new headband from Lemon Loves Lime is available in infant sizes. The rich pink band is solid in color and has the perfect stretch for comfort. The matching pink flower blooms are worn off to one side of her head while tulle is layered within the flower itself. |,|$14.00$|,||,|LEMON-LOVES-LIME-FUCHSIA-HEADBAND|,|$URL$lemon-loves-lime-fuchsia-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-fuchsia-headband-1.jpg||-||Lemon Loves Lime Fuchsia Infant Romper|,|^|New for infants, this adorable pink romper comes from designer Lemon Loves Lime. Made with 100% cotton, the bodice is soft on her delicate skin and offers a comfortable, sleeveless fit. The shorts boast of their falling tiers of ruffles that wrap around her legs. Machine washable. Made from cotton. Machine wash warm, tumble dry low. SIZE 3/6 MONTH ONLY AVAILABLE. ^||,|$19.00$|,||,|LEMON-LOVES-LIME-FUCHSIA-INFANT-ROMPER|,|$URL$lemon-loves-lime-fuchsia-infant-romper.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-fuchsia-infant-romper-19.jpg||-||Lemon Loves Lime Fuchsia Legging for Girls|,|Every little girls closet needs a pair of fuchsia leggings, such an easy wash and wear item. Soft Peruvian cotton knit with elastic waistband. Three tiers of ruffles complete the look. Made to match Lemon Loves Limes tops, dresses, top and skirts. 100% cotton. Machine wash warm water, inside out, gentle cycle. Low heat tumble dry. |,|$29.00$|,||,|LEMON-LOVES-LIME-FUCHSIA-LEGGING-GIRLS|,|$URL$lemon-loves-lime-fuchsia-legging-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-fuchsia-legging-for-girls-1.jpg||-||Lemon Loves Lime Fuchsia Ruffle Infant Hat|,|Ruffled for fun, this new infant hat comes from designer Lemon Loves Lime. The fuchsia pink hat matches several new arrivals from their fall season. The knit hat offers a fitted look of warmth. The rows of ruffles wrap around the hat at an angle. Created with 100% prima cotton. When needed, machine wash on gentle and tumble dry on low. |,|$28.00$|,||,|LEMON-LOVES-LIME-FUCHSIA-RUFFLE-INFANT-HAT|,|$URL$lemon-loves-lime-fuchsia-ruffle-infant-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-fuchsia-ruffle-infant-hat-3.jpg||-||Lemon Loves Lime Fuchsia Ruffle Romper for Girls|,|Turn heads in this sassy but sweet fuchsia ruffle romper by Lemon Loves Lime. The gorgeous long sleeved bodice is made from a soft fabric that is delicate on your baby girl�s skin, while a ruffle embellishes the neckline. A single ruffle fabric flower is placed on the waistline with ruffles swooping down from waist to hem. The full diaper changing snaps make dressing and changing baby easier for mom. Romper is made of 100% pima cotton. Please machine wash gentle and tumble try on low to maintain this item's beauty. |,|$49.00$|,||,|LEMON-LOVES-LIME-FUCHSIA-RUFFLE-ROMPER-GIRLS|,|$URL$lemon-loves-lime-fuchsia-ruffle-romper-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-fuchsia-ruffle-romper-for-girls-3.jpg||-||Lemon Loves Lime Fuchsia Ruffled Infant Gown|,|Whether she is arriving home from the hospital or posing for the camera, this new Lemon Loves Lime baby gown will suite her sweet smile perfectly. The pink fabric is delicate on her skin and features ruffled accents embellishing the wrap neckline and the waist. The long sleeves help to keep her warm while the skirts elastic ruffled hemline keeps her little toes bundled. Made with 100% prima cotton. Machine wash gentle, tumble dry on low. |,|$34.00$|,||,|LEMON-LOVES-LIME-FUCHSIA-RUFFLED-INFANT-GOWN|,|$URL$lemon-loves-lime-fuchsia-ruffled-infant-gown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-fuchsia-ruffled-infant-gown-3.jpg||-||Lemon Loves Lime Fuchsia Skort for Girls|,|^|Sold as a separate so that she can mix and match all of her favorite pieces, this new Lemon Loves Lime skort is a timeless design. The hot fuchsia creates the entire piece. The stretch waist has an all day fit while the layers of ruffles swoop down and around. The angle of the ruffles helps to mask the look of shorts. The soft fabric is sure to bring her comfort whenever she wears it. SIZE 3 REMAINS. ^||,|$29.00$|,||,|LEMON-LOVES-LIME-FUCHSIA-SKORT-GIRLS|,|$URL$lemon-loves-lime-fuchsia-skort-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-fuchsia-skort-for-girls-7.jpg||-||Lemon Loves Lime Giraffe Girls Top with Skort|,|^|Designed by whimsical Lemon Loves Lime, this girls spring and summer outfit is too adorable! The rose shadow tank boasts of fringe fluttering on her shoulders while the two sweet giraffes are cuddling on the front. Paired with the pink lemonade skort boasting of its fun tiers of ruffles and comfortable waist. Made from cotton. Machine wash warm, tumble dry low. SIZE 6 ONLY AVAILABLE. ^||,|$59.00$|,||,|LEMON-LOVES-LIME-GIRAFFE-GIRLS-TOP-SKORT|,|$URL$lemon-loves-lime-giraffe-girls-top-skort.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-giraffe-girls-top-with-skort-17.jpg||-||Lemon Loves Lime Girls Bella Mix Dress|,|^|A revisited design that was well loved last fall, this darling little girls dress comes from Lemon Loves Lime. The long sleeve bodice features a fitted cut in its soft fabric. The skirt is draped with coordinating ruffles with contrasting trim. The true red and ivory shades mix together beautifully to create a truly special dress for you beloved little girl. Sure to become one of her favorite arrivals for the fall and winter! 100% cotton. Machine washable, tumble dry on low. SIZE 5 AND 10 ONLY AVAILABLE.  ^||,|$49.00$|,||,|LEMON-LOVES-LIME-GIRLS-BELLA-MIX-HOLIDAY-DRESS|,|$URL$lemon-loves-lime-girls-bella-mix-holiday-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-girls-bella-mix-dress-1.jpg||-||Lemon Loves Lime Girls Fuchsia Skirt|,|^|From fabulous designer Lemon Loves Lime, this girls skirt will spark any young girls creativity! The pink lemonade skirt is made with soft and comfortable cotton with a stretch fit waist. The falling ruffles dangle past the hem for a cute look and catch the wind with her movement. Made from cotton. Machine wash warm, tumble dry low. SIZE 2 AND 3 ONLY LEFT.  ^||,|$19.00$|,||,|LEMON-LOVES-LIME-GIRLS-FUCHSIA-SKIRT|,|$URL$lemon-loves-lime-girls-fuchsia-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-girls-fuchsia-skirt-14.jpg||-||Lemon Loves Lime Girls Legging Aqua|,|There's one thing we know for sure, Lemon Loves Lime offers a super soft cotton legging. The easy pull on style legging has a nice wide waistband with triple ruffled hem. Pair it with her favorite dress or top for a cute summer look that will take her back to school in the fall. 100% cotton. Machine wash warm water, inside out, gentle cycle. Low heat tumble dry. |,|$29.00$|,||,|LEMON-LOVES-LIME-GIRLS-LEGGING-AQUA|,|$URL$lemon-loves-lime-girls-legging-aqua.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-girls-legging-aqua-6.jpg||-||Lemon Loves Lime Girls Twirly Dress in Aqua|,|Bright and bold in blue, this cute Lemon Loves Lime dress is ready to accompany her anywhere. The wide straps create the square, wide neckline that is featured on this piece. The aqua blue fabric allows slight stretch and is completely comfortable. The tiered skirt has four layers of ruffles, these twirl about with her in a carefree spirit. The bodice is cut for a fitted look. |,|$49.00$|,||,|LEMON-LOVES-LIME-GIRLS-TWIRLY-DRESS-AQUA|,|$URL$lemon-loves-lime-girls-twirly-dress-aqua.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-girls-twirly-dress-in-aqua-6.jpg||-||Lemon Loves Lime Green Ruffle Skort|,|^|Flirty fun for the spring and summer days, this new creation from Lemon Loves Lime pairs with many tops for a unique look every time! The green shorts feature a comfortable stretch fit waist while cute ruffles fall, wrapping around her legs. Made from cotton. Machine wash warm, tumble dry low. (1) SIZE 3 REMAINING.  ^||,|$29.00$|,||,|LEMON-LOVES-LIME-GREEN-RUFFLE-SKORT|,|$URL$lemon-loves-lime-green-ruffle-skort.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-green-ruffle-skort-15.jpg||-||Lemon Loves Lime Handmade Baby Hat Red Poppy|,|^|Designed to match the ""Poppy"" cardigan, this new baby girls hat is a part of the fall 2014 collection by Lemon Loves Lime. The hat is knit with a bold red that is comfortable and warm. A large poppy flower is placed off centered from the front of the hat. This bloom is created with ruffles of red alternated with cream and finished with a green center. This hat will be loved all season long! 100% Cotton. Hand wash in warm water. Lay flat to dry. ^||,|$29.00$|,||,|LEMON-LOVES-LIME-HANDMADE-BABY-HAT-RED-POPPY|,|$URL$lemon-loves-lime-handmade-baby-hat-red-poppy.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-handmade-baby-hat-red-poppy-1.jpg||-||Lemon Loves Lime Holiday Romper for Infants Red|,|Looking great in her holiday photos, this new girls infant romper comes from designer Lemon Loves Lime. The romper is dressed in gorgeous ruffles. These ruffles are found around the neckline was well as at the hem of both legs. The neckline is styled with a wrap detail while the legs have a wide fit. Changing is made easy with the line of snaps on her inseam. The fabric allows slight stretch and is delicate on her skin. 100% Cotton. Machine wash inside out in warm water. Tumble dry on low. |,|$46.00$|,||,|LEMON-LOVES-LIME-HOLIDAY-ROMPER-INFANTS-RED|,|$URL$lemon-loves-lime-holiday-romper-infants-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-holiday-romper-for-infants-red-1.jpg||-||Lemon Loves Lime Ice Cream Parlor Dress|,|Lemon Loves Lime is now offering this darling little girls dress as a part of their new summer collection. The sleeveless bodice is fitted and has slight stretch found in its fabric. Attention is drawn to the neckline with three colorful ruffles in yellow, blue, and lime. A pink lemon ruffle dresses the waistline. The skirt opens to about a half circle shape while four icecream cones sit near the ruffle hemline. The touch of blue to finish the piece is a perfect choice. These bold colors are sure to fill any summer day with fun! |,|$59.20$|,||,|LEMON-LOVES-LIME-ICE-CREAM-PARLOR-DRESS|,|$URL$lemon-loves-lime-ice-cream-parlor-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-ice-cream-parlor-dress-16.jpg||-||Lemon Loves Lime Infant Blanket Wrap in Fuchsia|,|In bright cabaret fuchsia, this new infant blanket from lemon Loves Lime is unique and beautiful. The circle blanket makes the perfect newborn photo shoot prop as it wraps her up like the bundle of joy that she is. The outer blanket is wrapped with spirals of fabric ruffles starting from the center and moving out to the edge. Made with 100% prima cotton. Machine wash gentle, tumble dry on low. |,|$46.00$|,||,|LEMON-LOVES-LIME-INFANT-BLANKET-WRAP-FUCHSIA|,|$URL$lemon-loves-lime-infant-blanket-wrap-fuchsia.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-infant-blanket-wrap-in-fuchsia-2.jpg||-||Lemon Loves Lime Infant Flower Hat Ivory and Pink|,|^|A fun accessory from the new fall 2014 collection, this baby girls hat comes from Lemon Loves Lime. A large flower created with pink ruffles is set off to one side of the front. The green center stands out on the bloom and matches the flower centers on her new ""Poppy"" cardigan. The ivory knit hat is a comfortable fit that will help keep your baby girl warm and snug. 100% Cotton. Hand wash in warm water. Lay flat to dry. ^||,|$29.00$|,||,|LEMON-LOVES-LIME-INFANT-FLOWER-HAT-IVORY-PINK|,|$URL$lemon-loves-lime-infant-flower-hat-ivory-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-infant-flower-hat-ivory-and-pink-1.jpg||-||Lemon Loves Lime Infant Girls Cardigan Poppy Fuchsia|,|A soft sweater that will look adorable over her knew Lemon Loves Lime outfits, this design is a must have! The knit fabric is soft on her skin and colored in a bright fuchsia. The front is dressed with a trio of lilac mums that fall down the center. The long sleeves add warmth while a single button fastens on the neckline. Also available for purchase is a matching hat! 100% Cotton. Hand wash in warm water. Lay flat to dry. |,|$49.00$|,||,|LEMON-LOVES-LIME-INFANT-GIRLS-CARDIGAN-POPPY-FUCHSIA|,|$URL$lemon-loves-lime-infant-girls-cardigan-poppy-fuchsia.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-infant-girls-cardigan-poppy-fuchsia-18.jpg||-||Lemon Loves Lime Infant Girls Dress in Fuchsia|,|Bright and warm in color, this fabulous spring and summer dress for baby girls comes from Lemon Loves Lime. The sleeveless neckline is in a classic rounded shape while the bodice features an easy pull over fit. The skirt of this dress receives a touch of drama in style. Rows and rows of ruffles fall in straight lines down the skirt, covering it in the same fuchsia fabric. This dress will not dissapoint! Be sure to look for the matching accessories! Cotton. Machine wash. |,|$36.80$|,||,|LEMON-LOVES-LIME-INFANT-GIRLS-DRESS-FUCHSIA|,|$URL$lemon-loves-lime-infant-girls-dress-fuchsia.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-infant-girls-dress-in-fuchsia-1.jpg||-||Lemon Loves Lime Infant Girls Hats Lilac Ruffles|,|Matching several new arrivals from Lemon Loves Lime, this hat for baby girls is created in the same lovely lilac that is used to create dresses and rompers alike. The hat has a classic shape with a twist. The entire piece is covered with ruffles from the crown of her head down to the hem. These ruffles are such a darling accent upon the hat and speak volumes of style in photographs! 100% Cotton. Machine wash inside out in warm water. Tumble dry on low. |,|$28.00$|,||,|LEMON-LOVES-LIME-INFANT-GIRLS-HATS-LILAC-RUFFLES|,|$URL$lemon-loves-lime-infant-girls-hats-lilac-ruffles.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-infant-girls-hats-lilac-ruffles-1.jpg||-||Lemon Loves Lime Infant Ruffle Pants in Purple|,|Also available in other colors while quantities last, these new baby girl pants are from Lemon Loves Lime. The star of this cute style is the layers of ruffles that wrap around both legs. The stretch fit waist pulls on with ease while matching the hem on both legs. These pants are unlike any other in your babies closet and are sure to receive many compliments! They also make the perfect piece for photographs! 100% Cotton. Machine wash inside out in warm water. Tumble dry on low. |,|$26.00$|,||,|LEMON-LOVES-LIME-INFANT-RUFFLE-PANTS-PURPLE|,|$URL$lemon-loves-lime-infant-ruffle-pants-purple.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-infant-ruffle-pants-in-purple-1.jpg||-||Lemon Loves Lime Ivory Hat for Baby Girls with Flower|,|^|Newly created by Lemon Loves Lime, this darling knit hat is the perfect match to her new ""Poppy"" cardigan. The hat is created in a light ivory and is a warm addition. An oversized bloom is set off to one side of the front, creating the perfect accent. This flower is in true red and ivory and is created with ruffles. The center of the flower is finished with a touch of green. 100% Cotton. Hand wash in warm water. Lay flat to dry. ^||,|$29.00$|,||,|LEMON-LOVES-LIME-IVORY-HAT-BABY-GIRLS-FLOWER|,|$URL$lemon-loves-lime-ivory-hat-baby-girls-flower.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-ivory-hat-for-baby-girls-with-flower-1.jpg||-||Lemon Loves Lime Ivory Isabel Hat with Ruffles|,|To go with her darling new Lemon Loves Lime pieces for the fall season, this new hat couldn't be more perfect! The infant hat boasts of its soft cotton blend fabric that hugs her head and gives her warmth. The rows of ruffles wrap around in unique angles. Created with 100% prima cotton. When needed, machine wash on gentle and tumble dry on low |,|$28.00$|,||,|LEMON-LOVES-LIME-IVORY-ISABEL-HAT-RUFFLES|,|$URL$lemon-loves-lime-ivory-isabel-hat-ruffles.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-ivory-isabel-hat-with-ruffles-2.jpg||-||Lemon Loves Lime Lilac Infant Headband|,|Lemon Loves Lime is now offering this baby girls hair accessory to match her new outfits! The soft lilac is a shade that will go with many of her new clothes. The stretch band is worn around her head and decorated with two flowers. The purple flowers are a blend of a solid fabric with the whimsical tulle. |,|$14.00$|,||,|LEMON-LOVES-LIME-LILAC-INFANT-HEADBAND|,|$URL$lemon-loves-lime-lilac-infant-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-lilac-infant-headband-1.jpg||-||Lemon Loves Lime Long Sleeve Girls Tee Frog Princess|,|^|Bringing new life to the classic character tees, the new creations from Lemon Loves Lime this fall bring a sweet familiar style. This long sleeve top is a solid blue and has the classic tee fit. Like a character from a carousel ride, the frog princess found on the front blows a kiss. With such a unique applique, your outfit options are limitless. Made with 100% cotton. Hand wash gentle, lay flat to dry. (1) 5 AND (1) 6 ONLY LEFT.  ^||,|$29.50$|,||,|LEMON-LOVES-LIME-LONG-SLEEVE-GIRLS-TEE-FROG-PRINCESS|,|$URL$lemon-loves-lime-long-sleeve-girls-tee-frog-princess.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-long-sleeve-girls-tee-frog-princess-2.jpg||-||Lemon Loves Lime Mermaid Rainbow Tee for Girls|,|^|With a darling character, this new designer girls top is a classic creation by Lemon Loves Lime. The tee features its cool shade of light pink and the comfortable fabric. The front of the top is adorned by a charming mermaid. She floats in the center while her yarn hair is made to curl and finished with a crown. The scales are made with a scallop crochet layered in alternating colors. A punch of lime green ruffles finishes off her tail with power. SIZE 2 AND 6 AVAILABLE.  ^||,|$39.00$|,||,|LEMON-LOVES-LIME-MERMAID-RAINBOW-TEE-GIRLS|,|$URL$lemon-loves-lime-mermaid-rainbow-tee-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-mermaid-rainbow-tee-for-girls-7.jpg||-||Lemon Loves Lime Octopus Top for Girls|,|In a pink salmon or coral, this new Lemon Loves Lime top is filled with splish splash style. The unique shade of pink is defined perfectly with the blend of cool blues. The large octopus applique has eight swirling legs that are decorated with suction pads. A cute flower is found on her head adding a touch of crochet detail. The ruffled cap sleeves add a fanciful detail that is both feminine and fun. |,|$44.80$|,||,|LEMON-LOVES-LIME-OCTOPUS-TOP-GIRLS|,|$URL$lemon-loves-lime-octopus-top-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-octopus-top-for-girls-7.jpg||-||Lemon Loves Lime Owl Necklace|,|Charming with its quaint details, this new necklace comes from Lemon Loves Lime. The dark green braided chain is adorned by small pom poms and tulle rosettes while a handmade owl charm is the focus. Easy clasp with a small acorn through a loop. |,|$19.50$|,||,|LEMON-LOVES-LIME-OWL-NECKLACE|,|$URL$lemon-loves-lime-owl-necklace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-owl-necklace-10.jpg||-||Lemon Loves Lime Peony Romper for Girls in Pink|,|^| Adorable as can be, this new infant girls romper comes from sweet Lemon Loves Lime. The long sleeve bodice boasts of a ruffled neckline and a single flower off centered at the waist. The legs are wrapped with draping ruffle rows down to the hemline. Classic changing snaps line the inner legs to make things easier for mom. Made with 100% pima cotton. Machine wash gentle, tumble dry on low. S/O 8/5/14  ^||,|$49.00$|,||,|LEMON-LOVES-LIME-PEONY-ROMPER-GIRLS-PINK|,|$URL$lemon-loves-lime-peony-romper-girls-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-peony-romper-for-girls-in-pink-3.jpg||-||Lemon Loves Lime Pink and White Dress with Capri|,|^|Created in wide stripes, this new girls dress from Lemon Loves Lime is an addition to their ""Seashell on the Seashore"" collection. The top of the dress has a pull on fit that allows slight stretch in its fabric. Bold pink and white stripes run across the piece horizontally. The skirt mixes up the direction of the skirt and adds an adorable ruffle. The handkerchief hem is decorated with a wide, matching ruffle. The dress is accompanied by matching leggings in the same light pink and white stripes. ^||,|$59.00$|,||,|LEMON-LOVES-LIME-PINK-WHITE-DRESS-CAPRI|,|$URL$lemon-loves-lime-pink-white-dress-capri.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-pink-and-white-dress-with-capri-6.jpg||-||Lemon Loves Lime Pink Infant Dress Jada Ruffles|,|Fitting for her first birthday or any other celebration, this adorable infant girls dress comes from designer Lemon Loves Lime. The long sleeve bodice is clean and solid and boasts only of a wrap, v neckline. The skirt adds character to the dress with the scalloped tiers of matching pink ruffles that layer down half of the skirt. Made with 100% prima cotton. Machine wash gentle, tumble dry on low. |,|$42.00$|,||,|LEMON-LOVES-LIME-PINK-INFANT-DRESS-JADA-RUFFLES|,|$URL$lemon-loves-lime-pink-infant-dress-jada-ruffles.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-pink-infant-dress-jada-ruffles-3.jpg||-||Lemon Loves Lime Pink Infant Ruffle Hat|,|Matching several of the new arrivals from Lemon Loves Lime Fall 2013 baby line, this hat really is the icing on the cake. This knit hat is enhanced by layers of light pink ruffles wrapping around the piece at an angle. Be sure to visit the Lemon Loves Lime page to see all of the other wonderful creations. Created with 100% prima cotton. When needed, machine wash on gentle and tumble dry on low. |,|$28.00$|,||,|LEMON-LOVES-LIME-PINK-INFANT-RUFFLE-HAT|,|$URL$lemon-loves-lime-pink-infant-ruffle-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-pink-infant-ruffle-hat-3.jpg||-||Lemon Loves Lime Popcorn Stand Tee Shirt|,|Created with a vintage inspiration, this lively new girls tee is from designer Lemon Loves Lime. The blue top is finished with a fitted look that is trendy and perfect for pairing with any style bottom. The front of the top receives a glorious decoration in the old popcorn stand. The circus red stands out while touches of yellow is found on the wheels, awning, and the writing. Even two bags of popcorn are added to the print, making it perfectly realistic and part of her dreams at the same time. |,|$39.00$|,||,|LEMON-LOVES-LIME-POPCORN-STAND-TEE-SHIRT|,|$URL$lemon-loves-lime-popcorn-stand-tee-shirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-popcorn-stand-tee-shirt-7.jpg||-||Lemon Loves Lime Poppy Cardigan for Infant Girls Ivory|,|Helping to keep your little girl warm in the cooler months, this new knit sweater from designer Lemon Loves Lime really takes the cake. The design is a creation from Lemon Loves Lime's fall 2014 collection and boasts of a matching hat also found within their new styles. This cardigan features a classic fit and long sleeves. The front of the neckline is decorated with sweet ruffle flowers. Complete the look by purchasing the matching hat! The soft knit is delicate on her skin. 100% Cotton. Hand wash in warm water. Lay flat to dry. |,|$49.00$|,||,|LEMON-LOVES-LIME-POPPY-CARDIGAN-INFANT-GIRLS-IVORY|,|$URL$lemon-loves-lime-poppy-cardigan-infant-girls-ivory.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-poppy-cardigan-for-infant-girls-ivory-18.jpg||-||Lemon Loves Lime Puffer Fish Girls Top|,|A bright new creation from Lemon Loves Lime, this fun designer tee will become one of her favorite pieces of clothing. The bright lime green is a punch of color and made from a soft fabric that is comfortable for her. The flutter cap sleeves are made with lime and hot fuchsia ruffles. A character applique on the front is a puffer fish. The light pink fish is accented with fringe and a crochet ruffle tail. |,|$39.00$|,||,|LEMON-LOVES-LIME-PUFFER-FISH-GIRLS-TOP|,|$URL$lemon-loves-lime-puffer-fish-girls-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-puffer-fish-girls-top-13.jpg||-||Lemon Loves Lime Red Holiday Shrug for Girls|,|The perfect shrug for holiday get togethers, this new creation comes from the fabulous Lemon Loves Lime Holly Holiday collection. The soft red shrug boasts of its many ruffles from her neck to the hem while the long sleeves finish in a ruffle cuff and protect her from the cold winds. |,|$19.00$|,||,|LEMON-LOVES-LIME-RED-HOLIDAY-SHRUG-GIRLS|,|$URL$lemon-loves-lime-red-holiday-shrug-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-red-holiday-shrug-for-girls-17.jpg||-||Lemon Loves Lime Rose Headband in Ivory|,|^|In soft ivory, this new designer headband for baby girls is part of Lemon Loves Lime's layette collection. The ivory band stretches to a comfortable fit that will stay on her head. The large duo of flowers is meant to sit off to one side. The small touches of tulle add elegance to this new piece. SIZE XS (0-6MOS) ONLY LEFT.  ^||,|$14.00$|,||,|LEMON-LOVES-LIME-ROSE-HEADBAND-IVORY|,|$URL$lemon-loves-lime-rose-headband-ivory.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-rose-headband-in-ivory-1.jpg||-||Lemon Loves Lime Ruffle Baby Romper Lilac Peony|,|Coming from designer Lemon Loves Lime, this new baby girls romper is a precious piece that mom and baby will both adore! The romper features a soft lilac purple and a ruffled neckline. The legs are draped with ruffles that fall from the waist and scoop down the legs. A single fabric flower is found on her waist. The inseam is lined with changing snaps. 100% Cotton. Machine wash inside out in warm water. Tumble dry on low. |,|$49.00$|,||,|LEMON-LOVES-LIME-RUFFLE-BABY-ROMPER-LILAC-PEONY|,|$URL$lemon-loves-lime-ruffle-baby-romper-lilac-peony.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-ruffle-baby-romper-lilac-peony-1.jpg||-||Lemon Loves Lime Ruffle Emma Cardigan in Fuchsia|,|Vibrant and lively, this sweet infant cardigan is sure to make a perfect finish to her new Lemon Loves Lime outfit. The long sleeves help her arms fend from the cold while the soft knit is delicate on her skin. The front is covered with semi circle ruffles. Made with 100% prima cotton. Machine wash gentle, tumble dry on low. |,|$29.00$|,||,|LEMON-LOVES-LIME-RUFFLE-EMMA-CARDIGAN-FUCHSIA|,|$URL$lemon-loves-lime-ruffle-emma-cardigan-fuchsia.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-ruffle-emma-cardigan-in-fuchsia-3.jpg||-||Lemon Loves Lime Ruffle White Infant Blanket|,|In a neutral white, this new baby blanket comes from designer Lemon Loves Lime. The white cotton blanket boasts of it unique shape created by fabric ruffles that start in the center and spiral clear out to the edge. Wrap your bundle of joy up to keep her warm or for a unique photo debut. Made with 100% pima cotton. Machine wash gentle, tumble dry on low. |,|$46.00$|,||,|LEMON-LOVES-LIME-RUFFLE-WHITE-INFANT-BLANKET|,|$URL$lemon-loves-lime-ruffle-white-infant-blanket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-ruffle-white-infant-blanket-2.jpg||-||Lemon Loves Lime Ruffled Infant Hat Holiday Red|,|^|Perfect from fall through the winter holiday season, this baby girls hat comes from the beloved designer Lemon Loves Lime as a part of their layette collection for fall 2014. The hat is named ""Isabel"" which is perfect for this sweet look that is not bound by time. Red ruffles cover the entire hat and slightly transfer the shape. The style matches the new dresses from Lemon Loves Lime perfectly, making this a must have accessory to complete her outfit! 100% Cotton. Machine wash inside out in warm water. Tumble dry on low. ^||,|$28.00$|,||,|LEMON-LOVES-LIME-RUFFLED-INFANT-HAT-HOLIDAY-RED|,|$URL$lemon-loves-lime-ruffled-infant-hat-holiday-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-ruffled-infant-hat-holiday-red-1.jpg||-||Lemon Loves Lime Ruffled Pants for Baby Girls White|,|Lemon Loves Lime is now offering these ruffled pants for your infant girl. The white fabric is easy to pair with many pieces while also soft and kind to her skin. The outside of the pants are dressed with tiers of fun ruffles that wrap around the legs. The fit is a simple pull on with the stretch waist and hem. Pair these pants over her every day onesie for a fresh new look! 100% Cotton. Machine wash inside out in warm water. Tumble dry on low. |,|$26.00$|,||,|LEMON-LOVES-LIME-RUFFLED-PANTS-BABY-GIRLS-WHITE|,|$URL$lemon-loves-lime-ruffled-pants-baby-girls-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-ruffled-pants-for-baby-girls-white-1.jpg||-||Lemon Loves Lime Scottish Terrier Necklace|,|The smallest details create the most wondrous things sometimes, as is the case with this new Lemon Loves Lime necklace. Small handmade charms adorn this necklace including a black Scottish terrier. |,|$13.00$|,||,|LEMON-LOVES-LIME-SCOTTISH-TERRIER-NECKLACE|,|$URL$lemon-loves-lime-scottish-terrier-necklace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-scottish-terrier-necklace-10.jpg||-||Lemon Loves Lime Take Home Gown Holiday Red|,|^|New from Lemon Loves Lime, this baby girls gown makes the perfect gift for the soon-to-be mom in your life. The bodice of this gown has a ruffled ""V"" neckline that is created in the wrap style. Long sleeves help to keep her cozy with the chilly fall air. A ruffle defines the empire waistline and matches to the elastic hem. The relaxed fit of the skirt has a bubble effect produced by the fitted waist and the elastic at her hem. 100% Cotton. Machine wash inside out in warm water. Tumble dry on low. ^||,|$34.00$|,||,|LEMON-LOVES-LIME-TAKE-HOME-GOWN-HOLIDAY-RED|,|$URL$lemon-loves-lime-take-home-gown-holiday-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-take-home-gown-holiday-red-17.jpg||-||Lemon Loves Lime White Infant Headband|,|From designer Lemon Loves Lime, this darling new baby girls accessory is sure to make a splash. The headband has a stretch fit with its solid matching band. The two off centered flower decorate the side of her head elgantly. The white flowers are layered with touches of tulle. |,|$14.00$|,||,|LEMON-LOVES-LIME-WHITE-INFANT-HEADBAND|,|$URL$lemon-loves-lime-white-infant-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-white-infant-headband-1.jpg||-||Lemon Loves Lime Wide Leg Girls Groovy Pants in Pink|,|Cozy and comfy, these new little girls pants for your darling daugher come from the fanciful Lemon Loves Lime. The pant offers her a stretch fit waist that is comfortable for all day wear and two pockets found just beneath. The wide legs bounce with freedom as she moves and plays. A ruffle hemline finishes off this adorable look. Created with a cotton-spandex blend. When needed, machine wash on gentle and tumble dry on low |,|$19.00$|,||,|LEMON-LOVES-LIME-WIDE-LEG-GIRLS-GROOVY-PANTS|,|$URL$lemon-loves-lime-wide-leg-girls-groovy-pants.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lemon-loves-lime-wide-leg-girls-groovy-pants-in-pink-3.jpg||-||Lime Apple Black Athletic Leggings for Girls|,|Looking fabulous with any new LimeApple top, these new girls leggings are created just for her! The black fabric provides a comfortable, fitted look while becoming the perfect companion during any high energy activity. The leggings are full length and offer a classic waistband. The solid black shade makes it simple to pair these leggings with any of her new activewear tops from Lime Apple. |,|$28.00$|,||,|LIME-APPLE-BLACK-ATHLETIC-LEGGINGS-GIRLS|,|$URL$lime-apple-black-athletic-leggings-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lime-apple-black-athletic-leggings-for-girls-1.jpg||-||Lime Apple Invincible Short Sleeve Top Active Wear|,|Designed by Limeapple, this new girls top is perfect for any work out. The fitted top boasts of an almost rashguard look created with its classic neckline and short sleeves. The top is divided into blocks of bright, fun colors. The blend of blue, red, and lime is out of this world while creating a cute match to any of the new shorts or leggings that have also arrived from the Limeapple collection. |,|$29.00$|,||,|LIME-APPLE-INVINCIBLE-SHORT-SLEEVE-TOP-ACTIVE-WEAR|,|$URL$lime-apple-invincible-short-sleeve-top-active-wear.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lime-apple-invincible-shot-sleeve-top-active-wear-1.jpg||-||Lime Apple Tween Girls Mini Shorts|,|Prepared to run the race, these designer shorts from Limeapple are a part of their activewear collection. The black shorts have a stretch fit in their solid black fabric. The waistline is adorned with a vibrant row of color block that wraps around the shorts. Pair these shorts with any of the new activewear tops for the perfect outfit. These shorts are great for dancers! |,|$27.00$|,||,|LIME-APPLE-TWEEN-GIRLS-MINI-SHORTS|,|$URL$lime-apple-tween-girls-mini-shorts.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lime-apple-tween-girls-mini-shorts-1.jpg||-||Limeapple Active Wear Girls Tank Top|,|From fabulous Limeapple, this new girls design is sure to be instantly loved by your active little girl. The top is created with a blend of turquoise, periwinkle, and lime. The unique straps have a large cut out on the back while the single stripe of green adds a real splash to the front. A hidden side pocket has a zipper to all of its contents in place as she runs and jumps. This top matches all of the new Limeapple active wear bottoms! |,|$27.00$|,||,|LIMEAPPLE-ACTIVE-WEAR-GIRLS-TANK-TOP|,|$URL$limeapple-active-wear-girls-tank-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/limeapple-active-wear-girls-tank-top-1.jpg||-||LimeApple Active Wear Half Top|,|In sweet periwinkle, this new designer top from Limeapple is sure to be one she loves. The fabric is created to keep her comfortable during any fun activity while the half style is a popular look. The cool blue is contrasted with a vibrant red. The shoulder straps are cut for a racer back design. Pair this top with any of the new activewear bottoms from Limeapple this season! |,|$24.00$|,||,|LIMEAPPLE-ACTIVE-WEAR-HALF-TOP|,|$URL$limeapple-active-wear-half-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/limeapple-active-wear-half-top-1.jpg||-||Limeapple Athletic Pant for Tweens|,|A brilliant new look, this new pair of athletic pants come from Limeapple. These pants are comfortable for all day wear and keep her looking great while still prepared for whatever she has in store. The long pants have a straight leg and are made from a fabric that allows stretch in its fit. A band of color wraps around the waistband to insure any of the new Limeapple tops will be a perfect match! |,|$29.00$|,||,|LIMEAPPLE-ATHLETIC-PANT-TWEENS|,|$URL$limeapple-athletic-pant-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/limeapple-athletic-pant-for-tweens-1.jpg||-||Limeapple Bikini for Tweens|,|^|Positively adorable, this new summer bikini comes from fabulous Limeapple. The wide bandeaux ties in a knot on her back while bright lime straps are placed securely on her shoulders. The front is dressed in tiers of ruffles while a single bow is placed in the center. The ruffles blend the bold turquoise and pink with sassy lime green. The matching bottoms are turquoise and black while the waist is skirted by a single green ruffle. SIZE 10 AND 14 ONLY LEFT.  ^||,|$35.00$|,||,|LIMEAPPLE-BIKINI-TWEENS-|,|$URL$limeapple-bikini-tweens-.html|,|http://ep.yimg.com/ay/yhst-17102259411242/limeapple-bikini-for-tweens-1.jpg||-||Limeapple Girls Activewear Detailed Leggings in Charcoal|,|Designed to match with their new tops and jackets, these tween active wear leggings come from Limeapple. A small pocket is offered on both legs to hold any exercise necessities. The unique waistline has a wrap style in a chevron print accented with a touch of pink. Stitching creates the unique shape detailing found on these leggings. Polyester/Spandex. Machine wash cold. Tumble dry on low. |,|$39.00$|,||,|LIMEAPPLE-GIRLS-ACTIVEWEAR-DETAILED-LEGGINGS-CHARCOAL|,|$URL$limeapple-girls-activewear-detailed-leggings-charcoal.html|,|http://ep.yimg.com/ay/yhst-17102259411242/limeapple-girls-activewear-detailed-leggings-in-charcoal-1.jpg||-||Limeapple Girls Activewear Racerback Tank in Teal|,|New from Limeapple, this tween tank is sure to be one of her favorite tops to wear for practice or exercising! The body of the top is a cool turquoise with color block lime sides. The double shoulder straps criss cross on her back. This top is fitted in style to keep any extra fabric out of her way. Matching active wear jackets and bottoms from Limeapple are also available! Polyester/Spandex. Machine wash cold. Tumble dry on low. |,|$35.00$|,||,|LIMEAPPLE-GIRLS-ACTIVEWEAR-RACERBACK-TANK-TEAL|,|$URL$limeapple-girls-activewear-racerback-tank-teal.html|,|http://ep.yimg.com/ay/yhst-17102259411242/limeapple-girls-activewear-racerback-tank-in-teal-21.jpg||-||Limeapple Girls Activewear Zip-Up Jacket|,|For your active little girl, this fabulous new athletic wear jacket comes from Limeapple. The grey jacket has long sleeves with turquoise cuffs to match the hemline. The turquoise is also found as a color block next to the lime on the top just beneath the collar. The two front pockets are trimmed in a rose pink while a grey chevron texture creates the bottom of the sleeves. Pair with the active shorts and tops for the complete look! Polyester/Spandex. Machine wash cold. Tumble dry on low. |,|$59.00$|,||,|LIMEAPPLE-GIRLS-ACTIVEWEAR-ZIP-UP-JACKET|,|$URL$limeapple-girls-activewear-zip-up-jacket.html|,|http://ep.yimg.com/ay/yhst-17102259411242/limeapple-girls-activewear-zip-up-jacket-1.jpg||-||Limeapple Girls Hoodie Activewear|,|Created for your active daughter, this fabulous new girls hoodie comes from designer Limeapple. The hoodie has a cool periwinkle blue shade while black cuffs are accented with a bright red zipper. A cozy hood pulls over her head and the front zipper is off centered to one side. Down the front of the hoodie are bright blocks of color in red, teal, and yellow. The top has a single pocket. |,|$39.00$|,||,|LIMEAPPLE-GIRLS-HOODIE-ACTIVEWEAR|,|$URL$limeapple-girls-hoodie-activewear.html|,|http://ep.yimg.com/ay/yhst-17102259411242/limeapple-girls-hoodie-activewear-1.jpg||-||Limeapple Girls Sports Tank Top|,|Ready for your active little girl, this new designer top from Limeapple will keep her feeling great! The top boasts of a red empire bodice finished with a bold colorblock waistband. The bottom of the top is finished with a soft periwinkle. The unique shoulder straps are doubled and feature a center cross upon her back. This top will look fabulous with any of the new activewear bottoms from Limeapple. |,|$26.00$|,||,|LIMEAPPLE-TWEEN-SPORTS-TANK-TOP|,|$URL$limeapple-tween-sports-tank-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/limeapple-tween-sports-tank-top-1.jpg||-||LimeApple Invincible Capri for Tweens|,|Created with an athletic stretch fit, these new girls capris come from designer Lime Apple. The jet black capris are created with the perfect fabric to handle any activity the day might bring. The comfortable fit keeps them out of the way while a punch of bright color is received by the waist. Pair these capris with any of the new Limeapple active wear tops! |,|$28.00$|,||,|LIMEAPPLE-INVINCIBLE-CAPRI-TWEENS|,|$URL$limeapple-invincible-capri-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/limeapple-invincible-capri-for-tweens-1.jpg||-||Limeapple Polka Dot Girls Swimsuit in Black and Hot Pink|,|With an adorable style, this new tween tankini from designer Limeapple. The top features a black and white polka dot print with a smocked stretch fit. The straight neckline is framed with pink, thin straps complete with a bow in the center. The matching pink bottoms are dressed up with black ruffles on both hips. This pair is sure to stand out from the crowd all season long! |,|$37.00$|,||,|LIMEAPPLE-POLKA-DOT-GIRLS-SWIMSUIT-BLACK-HOT-PINK|,|$URL$limeapple-polka-dot-girls-swimsuit-black-hot-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/limeapple-polka-dot-girls-swimsuit-in-black-and-hot-pink-1.jpg||-||Limeapple Rashguard with Boy Cut Swimsuit Bottoms|,|^|This fabulous pair for swimming comes from Limeapple for all of her sunny day fun! The fitted top has a black body with contrast long sleeves in black polka dot and solid turquoise. The neckline has a classic collar and a rainbow flower applique is found on her left side. The paired bottoms have a colorful waistband in colorblock and are styled with a boy cut. Keeping her modest and comfortable at the beach, this new designer swimsuit for tweens is just what she loves! SIZE 8 ONLY AVAILABLE.  ^||,|$39.00$|,||,|LIMEAPPLE-RASHGUARD-BOY-CUT-SWIMSUIT-BOTTOM|,|$URL$limeapple-rashguard-boy-cut-swimsuit-bottom.html|,|http://ep.yimg.com/ay/yhst-17102259411242/limeapple-rashguard-with-boy-cut-swimsuit-bottoms-1.jpg||-||Limeapple Savannah Rashguard with Bikini Bottom Swimsuit|,|^|A modern design for your beach-bound beauty, this fabulous tween swimsuit was designed by Limeapple. The long sleeve rashguard top features polka dots while the neck is graced with a standard collar. The front of the top has a comic strip face while the back is a bright turquoise. The paired bottoms are cut for the typical bikini style and are colored in a solid black. A single thin bow is found on both hips to complete the look. SIZE 14 ONLY LEFT. ^||,|$39.00$|,||,|LIMEAPPLE-SAVANNAH-RASHGUARD-BIKINI-BOTTOM-SWIMSUIT|,|$URL$limeapple-savannah-rashguard-bikini-bottom-swimsuit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/limeapple-savannah-rashguard-with-bikini-bottom-swimsuit-1.jpg||-||Limeapple Tankini in Turquoise for Tweens|,|Sure to make her stand out at the pool and beach, this new designer tween swimsuit comes from Limeapple. The bright turquoise blue top is cropped for an adorable tankini style. The black trim creates the thin shoulder straps and the cut out back. The matching bottoms have a touch of polka dots while boasting of the blue waist and the singe bow found on both hips. The side of the top is decorated with a flower applique. |,|$37.00$|,||,|LIMEAPPLE-TANKINI-TURQUOISE-TWEENS|,|$URL$limeapple-tankini-turquoise-tweens.html|,|http://ep.yimg.com/ay/yhst-17102259411242/limeapple-tankini-in-turquoise-for-tweens-12.jpg||-||Limeapple Tween Bikini with Rosettes|,|^|Created for your stylish tween, this new designer bikini comes from fabulous Limeapple. The bikini top boasts of the classic triangle cut while the bottom band ties around her back and a halter strap is secured around her neck. The front of the top is covered with red and black rosettes that add a great texture. Matching black bottoms accompany the top and feature the same blooms alternating in color on the front of her waist. A single bow is found adorning both hips. SIZE 7 AND 14 ONLY REMAINING.  ^||,|$41.00$|,||,|LIMEAPPLE-TWEEN-BIKINI-ROSETTES|,|$URL$limeapple-tween-bikini-rosettes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/limeapple-tween-bikini-with-rosettes-1.jpg||-||Limeapple Tween Two Piece Swimsuit with Rash Guard Top|,|From designer Limeapple, this new tween girls swimsuit is perfect for the coming season of fun in the sun. The short sleeve top has a stretch fit while styled by a short standing collar. A matching zipper funs down the back while bright colors create the color block that dresses the sides and both shoulders. The black center matches the accompanying bottoms that are cut to a boyshort style. The bright lime, turquoise, and pink are the perfect look for the beach! |,|$39.00$|,||,|LIMEAPPLE-TWEEN-TWO-PIECE-SWIMSUIT-RASH-GUARD-TOP|,|$URL$limeapple-tween-two-piece-swimsuit-rash-guard-top.html|,|http://ep.yimg.com/ay/yhst-17102259411242/limeapple-tween-two-piece-swimsuit-with-rash-guard-top-1.jpg||-||Limeapple Under The Sea Tween Bikini|,|^|A flirty fun, this new designer girls bikini comes from the trendy Limeapple. The pink swimsuit boasts of a traditional bikini top with a wide band that ties into a knot on her back and thin halter straps that become a bow to grace the back of her neck. The front of the top is covered with frilly ruffles. The matching bottoms are the same cool shade while the waistband is ruffled on the front. A thin bow is tied on both hips. SIZE 8 REMAINING.  ^||,|$39.00$|,||,|LIMEAPPLE-UNDER-SEA-TWEEN-BIKINI|,|$URL$limeapple-under-sea-tween-bikini.html|,|http://ep.yimg.com/ay/yhst-17102259411242/limeapple-under-the-sea-tween-bikini-1.jpg||-||Lipstik Girls Little Girls Sassy Shopper Skirt Set|,|^|Just for your sassy little shopper comes this skirt set from designer Lipstik Girls. It's the perfect outfit to wear on her shopping excursions or other fun activities. A sassy shopper decked out in a sequined ensemble and armed with her shopping bags adorns the top. The neckline and sleeves are trimmed with red piping. Black mesh with a jeweled black bow overlays the skirt of white with hearts and red dots. A black lace ruffle peaks from underneath the hemline. The stretch waistband is of black and white stripes. Top is a cotton/spandex blend, while the skirt is polyester. Both should be hand washed, line dry. SIZE 2T AND 4 REMAINING.  ^||,|$49.00$|,||,|LIPSTIK-GIRLS-LITTLE-GIRLS-SASSY-SHOPPER-SKIRT-SET|,|$URL$lipstik-girls-little-girls-sassy-shopper-skirt-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lipstik-girls-little-girls-sassy-shopper-skirt-set-14.jpg||-||Lipstik Girls Pink and Ivory Lace Girls Dress|,|^|A sweet dress for your sweet girl from Lipstik Girls. This pink and ivory lace girls dress is too darling. The dress boasts of an overlay of ivory lace in a flower pattern over a pink lining. The strappy bodice hosts three pink jewel buttons. Ruffles of lace and tulle adorn the hemline. Made from 100% polyester. Machine wash cold, line dry. (1) 3T ONLY LEFT. ^||,|$39.00$|,||,|LIPSTIK-GIRLS-PINK-IVORY-LACE-GIRLS-DRESS|,|$URL$lipstik-girls-pink-ivory-lace-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lipstik-girls-pink-and-ivory-lace-girls-dress-14.jpg||-||Lipstik Girls Tween Dress White Lace and Chiffon|,|^|Elegant in white, Lipstik Girls is now offering this tween summer dress in white lace. The A-line dress boasts of its chiffon detailing at the bodice's back and classic sheath fit. The white lace is covered in white floral designs made with tulle giving a unique look and texture. Made from 100% cotton, machine washable. (1) 16 ONLY LEFT.  ^||,|$39.00$|,||,|LIPSTIK-GIRLS-TWEEN-DRESS-WHITE-LACE|,|$URL$lipstik-girls-tween-dress-white-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lipstik-girls-tween-dress-white-lace-and-chiffon-11.jpg||-||Lipstik Girls Tween Dress with Chiffon Flowers|Elisa B|,|^|With its playful splash of color, this new black and white tween dress from Lipstik Girls brings a new look to spring time. The dress features wide straps, a classic jewel neckline, and is covered with spotted whit and black chiffon swirls. Bits of pink floral color pops out in the shape of fun flowers. Fully lined in black, 100% polyester, machine wash. ONE EACH OF SIZES 7 AND 8 LEFT. ^||,|$39.00$|,||,|LIPSTIK-GIRLS-TWEEN-DRESS-CHIFFON-FLOWERS|,|$URL$lipstik-girls-tween-dress-chiffon-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lipstik-girls-tween-dress-with-chiffon-flowers-elisa-b-11.jpg||-||Lipstik Girls Tween Lace Top with Black Tutu Skirt|,|^|With that great style we all love, Lipstik Girls is now offering this new tween girls top and skirt. The long sleeve tee boasts of its large dazzling heart adorning the black lace overlay covering the front. The matching skirt is created with layers of black tulle and features a small touch of sequins on the top. Stretch fit waist, hand wash. ONE SIZE 14 LEFT.  ^||,|$49.00$|,||,|LIPSTIK-GIRLS-TWEEN-LACE-TOP-BLACK-TUTU-SKIRT|,|$URL$lipstik-girls-tween-lace-top-black-tutu-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lipstik-girls-tween-lace-top-with-black-tutu-skirt-14.jpg||-||Lipstik Tween Tunic with Black Ruffles and Hearts|,|^|Sweet and beautiful, this new racerback tunic comes from the one and only Lipstik Girls. The top boasts of a zippered back and alternating mesh ruffles in black and black with silver hearts. The top is fully lined for her comfort, pair it with a great skirt or dark jean. 100% polyester, hand wash suggested. SIZE 12 ONLY LEFT.  ^||,|$29.00$|,||,|LIPSTIK-TWEEN-TUNIC-BLACK-RUFFLES-HEARTS|,|$URL$lipstik-tween-tunic-black-ruffles-hearts.html|,|http://ep.yimg.com/ay/yhst-17102259411242/lipstik-tween-tunic-with-black-ruffles-and-hearts-14.jpg||-||Little Girls Lace Headband with Pink and Grey Flowers|,|^|Placed upon a lacey headband, these five adorable flowers will compliment her dress beautifully. The light pink chiffon is spiraled and adorned with a pearl center while the structured grey petals are accented with tulle. Row of flowers measure 6"" long. ^||,|$24.00$|,||,|LITTLE-GIRLS-LACE-HEADBAND-PINK-GREY-FLOWERS|,|$URL$little-girls-lace-headband-pink-grey-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-girls-lace-headband-with-pink-and-grey-flowers-12.jpg||-||Little Girls Retro Swimsuit by Love U Lots|,|^|Matching a new infant bubble suit from Love U Lots, this cute swimsuit boasts of its retro inspiration. A wide black halter strap ties in a cute bow behind her neck while the rose pink neckline is decorated with a pleated bow. The white body of the swimsuit is covered with large black polka dots. This swimsuit is made with care and quality without loosing the amazing amount of style. All of her friends are sure to envy this gorgeous swimsuit. Made with polyester blend. Hand wash cold, line dry. SIZE 5 AND 6X ONLY LEFT.  ^||,|$35.00$|,||,|LITTLE-GIRLS-RETRO-SWIMSUIT-LOVE-U-LOTS|,|$URL$little-girls-retro-swimsuit-love-u-lots.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-girls-retro-swimsuit-by-love-u-lots-1.jpg||-||Little Mass Animal Print Back to School Dress for Girls|,|^|In a class all its own, this new girls dress from top designer Little Mass is beyond any other back to school dress. The zebra print bodice is bordered by the white leopard spots covering her long sleeves. The sharkbite hem is created with a multitude of patterns and colors and is accented by black lace. Made with a polyester and rayon belnd, machine wash and hang to dry. SIZE 4 AND 6 ONLY LEFT.  ^||,|$34.00$|,||,|LITTLE-MASS-ANIMAL-PRINT-BACK-SCHOOL-DRESS|,|$URL$little-mass-animal-print-back-school-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-animal-print-back-to-school-dress-for-girls-31.jpg||-||Little Mass Aqua Fleur Girls Dress|,|^|Embracing the blooming ideals of the spring season, this adorable girls dress was designed by Little Mass. The empire bodice is covered with a garden of flowers found on the front. These flowers are made with different textures which include tulle, satin, and gems. The fabric stretches for a unbelievably comfortable fit while the straps come to a V shape on her back. The fun floral fabric opens to a full shape from the waist while dotted pink mesh interrupts the pattern and creates the uneven hemline. The white lining can be seen through the fabric and finishes the design. Created in the United States. Fabric Content: [dress] 100% polyester; [lining] 100% cotton. SIZE 24 MOS AND 5 ONLY REMAINING.  ^||,|$57.00$|,||,|LITTLE-MASS-AQUA-FLUER-GIRLS-DRESS|,|$URL$little-mass-aqua-fluer-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-aqua-fluer-girls-dress-1.jpg||-||Little Mass Bling Meow Sequin Shorts and Tank Set|,|^|Dazzling fun, this new designer outfit comes from designer Little Mass. The sleeveless top has a scoop neckline that is edged with lime green. The scarf cut of the shirt has a free fit while a white tank is paired beneath. The sheer turquoise fabric is striped with metallic silver. Matching shorts are worn with the top and really make the outfit a star! The lime green waist is a stretch elastic and coordinates with the hem. The entire pair of shorts is covered with silver sequins that catch every ray of light. 100% polyester. Machine wash cold, tumble dry low. (1) SIZE 10 AVAILABLE.  ^||,|$64.50$|,||,|LITTLE-MASS-BLING-MEOW-SEQUIN-SHORTS-TANK-SET|,|$URL$little-mass-bling-meow-sequin-shorts-tank-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-bling-meow-sequin-shorts-and-tank-set-1.jpg||-||Little Mass Bloom Time Lace Girls Top with Twill Pants|,|^|Fashion meets fun in this girls pant set from designer Little Mass. The top features tiered lace and a scooped elastic neckline. The sleeves are also done in tiered lace. Three flowers with jewel centers bloom on the left side. Due to the sheer nature of the lace, we recommend pairing with a coordinating tank or cami. The twill pants are in a bright coral and have a skinny fit. Front and rear pockets are also featured. Made from polyester/cotton/spandex. Machine wash cold, line dry. SIZE 4 AND 5 AVAILABLE. ^||,|$29.00$|,||,|LITTLE-MASS-BLOOM-TIME-LACE-GIRLS-TOP-TWILL-PANTS|,|$URL$little-mass-bloom-time-lace-girls-top-twill-pants.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-bloom-time-lace-girls-top-with-twill-pants-14.jpg||-||Little Mass Blue Zipper Top for Girls with Velvet Legging|,|^|Taking popular trends to a new height, this fabulous girls outfit comes from the Little Mass Brand. The top boasts of a rich shade of royal blue that stands out from the masses. Two gold zippers framed in black draw attention to her shoulders while the oversized cut offers her a trendy fit. The coordinated leggings are a soft black velvet covered with a golden screen print. The tones found on the leggings draw out the zippers found on the top. Polyester blend fabrics. Machine wash and hang dry both pieces. SIZE 4 AND 5 ONLY REMAINING.  ^||,|$42.00$|,||,|LITTLE-MASS-BLUE-ZIPPER-TOP-GIRLS-VELVET-LEGGING|,|$URL$little-mass-blue-zipper-top-girls-velvet-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-blue-zipper-top-for-girls-with-velvet-legging-2.jpg||-||Little Mass British Flag Tee and Pleather Skirt for Girls|,|From trendy designer Little Mass, this new girls outfit boasts of its british infusion for an unforgettable back to school look. The long sleeve tee offers a textured natural fiber grey poly cotton blend fabric and a unique take on the British flag. The applique on the front is made with a scottish plaid edged with scalloped lace and enhanced with silver studs. Paired with the perfect pleather skirt with flattering pleating and a zipper that runs up the back. A black pleather and crochet flower is tacked just beneath the waist while ruffled red plaid matching the top peaks out beneath the hemline. Skirt is made with 100% polyester. Hand wash and hang dry. The top is machine washable. |,|$39.00$|,||,|LITTLE-MASS-BRITISH-FLAG-TEE-PLEATHER-SKIRT-GIRLS|,|$URL$little-mass-british-flag-tee-pleather-skirt-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-british-flag-tee-and-pleather-skirt-for-girls-31.jpg||-||Little Mass Cabos Ruffle Sleeve Eyelet Girls Dress|,|^|From designer Little Mass, this girls dress is a classic that never goes out of style. White eyelet covers the entire dress. The peasant style neckline is gathered with elastic. The short sleeves are ruffles of eyelet. A small pink bow sits beside multicolored rosettes on the right side of the bodice. The dress is lined in white cotton. Included with the dress is a beautiful necklace made from multicolored wooden beads. Made from 100% cotton. Machine wash cold, hang to dry or tumble dry low. ONE SIZE 6 LEFT.  ^||,|$24.00$|,||,|LITTLE-MASS-CABOS-RUFFLE-SLEEVE-EYELET-GIRLS-DRESS|,|$URL$little-mass-cabos-ruffle-sleeve-eyelet-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-cabos-ruffle-sleeve-eyelet-girls-dress-14.jpg||-||Little Mass Couture Skirt Outfit for Girls Puppy Fun|,|Created for your designer daughter, this new couture outfit is from Little Mass. The light top is long sleeve to help guard against the chilly air. Upon the front we find a large screen print with a sweet Yorkie puppy sitting in a designer purse. Stud accents complete this look. The top is paired with a sparkling gold skirt. The fabric is covered with rows of sequins. The stretch waist is a wild leopard print to match the hem. Top: Rayon/Spandex Blend. Skirt: 100% Polyester. Machine Wash in Cold Water. Tumble Dry Low. |,|$78.00$|,||,|LITTLE-MASS-COUTURE-SKIRT-OUTFIT-GIRLS-PUPPY-FUN|,|$URL$little-mass-couture-skirt-outfit-girls-puppy-fun.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-couture-skirt-outfit-for-girls-puppy-fun-22.jpg||-||Little Mass Denim Jacket for Girls Hard Rock|,|^|The perfect accompanmient piece for so many Little Mass creations for the fall 2013 collection, this girls jacket is a season must have. The dark denim boasts of slight fading for a distressed look and pin tucks on the front to give a structured shape. Silver metal buttons that run up the front and close the cuffs give it a real authentic feel. Petals and flowers accent the top near the collar. The shorter cut makes this jacket perfect for a casual dress with sass. Jacket: Cotton-polyblend. Machine wash on cold and hang dry. SIZE 4 AND 5 ONLY LEFT. ^||,|$37.00$|,||,|LITTLE-MASS-DENIM-JACKET-GIRLS-HARD-ROCK|,|$URL$little-mass-denim-jacket-girls-hard-rock.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-denim-jacket-for-girls-hard-rock-2.jpg||-||Little Mass Girls Dress with Daisies|,|Matching another new arrival from designer Little Mass, this spring dress for girls is absolutely fabulous. The bodice offers a high neckline and wide straps. The pull over fit is comfortable and covered with a sequin daisy design. Layers of yellow, pink, and blue tulle create the skirt. The shape of the skirt is a full circle with plenty of extra fabric for her to twirl around. The empire waist is a classic cut and looks fabulous with a light sweater over top if needed! 100% polyester. Machine wash cold, tumble dry low. |,|$59.00$|,||,|LITTLE-MASS-GIRLS-EASTER-DRESS-DAISIES|,|$URL$little-mass-girls-easter-dress-daisies.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-girls-dress-with-daisies-1.jpg||-||Little Mass Girls Dress with Neon Flowers|,|New from designer Little Mass, this girls dress is available in several size ranges. The long sleeve bodice boasts of a light fabric that is gentle on her skin. The front of the bodice is decorated with a yellow and pink floral screen print. The fabulous skirt spices up this design with soft black faux fur. Created with polyblend fabrics. Machine wash and hang to dry. |,|$34.00$|,||,|LITTLE-MASS-GIRLS-DRESS-NEON-FLOWERS|,|$URL$little-mass-girls-dress-neon-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-girls-dress-with-neon-flowers-2.jpg||-||Little Mass Girls Ivory Lace Dress|,|New from Little Mass, this fabulous girls dress is simply sugar sweet! The boat neckline is dressed with layered ruffles that lay on her shoulders and a thin chiffon flower is planted near by on the left. The ivory lace covers the bodice while boasting of a floral design. Two fancy ruffles finish the hem. Soft ivory fabric is seen through the lace and keeps this dress pure and beautiful. The shorter style is gorgeous for spring weddings and is easily paired with leggings or tights beneath. Made in the USA. Fabric Content: [lace] nylon and cotton blend; [under fabric] stretch rayon blend. Machine washable, tumble dry on low. |,|$39.00$|,||,|LITTLE-MASS-GIRLS-IVORY-LACE-DRESS|,|$URL$little-mass-girls-ivory-lace-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-girls-ivory-lace-dress-1.jpg||-||Little Mass Girls Ivory Lace Leggings with Faux Fur|,|^|Soft to the touch and adding a stylish flair, these new girls leggings are from designer Little Mass. The leggings boast of a brushed lace overlay, elastic fit waist, and matching faux fur found at the hem. Made with a cotton poly blend, machine washable. S/O 8/11/14 ^||,|$19.00$|,||,|LITTLE-MASS-GIRLS-IVORY-LACE-LEGGINGS-FAUX-FUR|,|$URL$little-mass-girls-ivory-lace-leggings-faux-fur.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-girls-ivory-lace-leggings-with-faux-fur-13.jpg||-||Little Mass Girls Red Rose Top and Legging|,|A cute new outfit that matches the Little Mass Mary Poppins dress, this fabulous new arrival is one she will want to wear constantly. The top boasts of a sweet red rose print that covers the body while her long sleeves contrast in black. A fabric flower under the neckline adds more texture. Solid black leggings are paired beneath and a black brushed lace insert is found on both sides of the top. Rose print: rayon blend, black fabric: polyester blend. Machine wash and hang to dry. |,|$36.00$|,||,|LITTLE-MASS-GIRLS-RED-ROSE-TOP-LEGGING|,|$URL$little-mass-girls-red-rose-top-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-girls-red-rose-top-and-legging-2.jpg||-||Little Mass Girls Ruffle Dress Hard Rock Plaid|,|Matching her sisters British flag set, this new little girls dress from Little Mass will be a hit this fall! The grey bodice features a black sequin heart adorned by a cute plaid bow to match the faux cap sleeves. Long back sleeves help protect her from the chilly air. The skirt is created with five ruffle tiers alternating between the red Scottish plaid and the sweet black lace. made with 100% polyester and poly cotton blends. Machine wash and hang dry. |,|$32.00$|,||,|LITTLE-MASS-GIRLS-RUFFLE-DRESS-HARD-ROCK-PLAID|,|$URL$little-mass-girls-ruffle-dress-hard-rock-plaid.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-girls-ruffle-dress-hard-rock-plaid-31.jpg||-||Little Mass Girls Ruffle Top with Printed Leggings|,|^|As cute as pie, this new little girls outfit comes from the loved designer, Little Mass. The long sleeved top boasts of three ruffles that wrap diagonally across the front while a single button keyhole is found on the back. The cap sleeve dresses up her shoulders while three fabric rosettes are placed to the right of the neckline. The uneven hem comes to a point in the center for a unique look. The paired leggings are covered with a fun print featuring bright oranges, pinks, and soft cloudy blues. Top: rayon and spandex blend; Leggings: polyester and spandex blend. Machine wash both pieces and hang to dry.(1) 3T ONLY LEFT.  ^||,|$37.00$|,||,|LITTLE-MASS-GIRLS-RUFFLE-TOP-PRINTED-LEGGINGS|,|$URL$little-mass-girls-ruffle-top-printed-leggings.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-girls-ruffle-top-with-printed-leggings-2.jpg||-||Little Mass Girls Tutu Dress in Butterfly Twist|,|^|Designed for the stylish girl with her head in the clouds, this new dress comes from the popular designer, Little Mass. The black long sleeve bodice boasts of a large pink butterfly that flutters on the front with pink and silver studs. Three chiffon flowers are also found on the front while her long sleeves are patterned with small gems that make up cute flower shapes. Her tutu skirt is made with draping layers of pink and red tulle falling to an uneven hemline. Bodice: polyblend. Skirt: nylon blend. Machine wash and hang to dry. 2T AND 3T ONLY REMAINING.  ^||,|$38.00$|,||,|LITTLE-MASS-GIRLS-TUTU-DRESS-BUTTERFLY-TWIST|,|$URL$little-mass-girls-tutu-dress-butterfly-twist.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-girls-tutu-dress-in-butterfly-twist-2.jpg||-||Little Mass Girls Tutu Dress with Heart|,|^|A vibrant new girls dress, this fabulous piece comes from designer Little Mass. The sleeveless bodice is a bold neon pink. A sheer white lace is used as an overlay found on both the front and back. A bright heart is made with chiffon flowers and tulle in the center of the bodice. The tutu skirt is a sky blue tulle layered for a full volume. A full circle shape creates extra fabric that dances around her legs. Cute ruffles in the tutu adorn the hemline. Made with a cotton and polyester blend. Machine wash this dress and tumble dry on low. SIZE 18 MOS AND 4T ONLY LEFT. ^||,|$54.00$|,||,|LITTLE-MASS-GIRLS-TUTU-DRESS-HEART|,|$URL$little-mass-girls-tutu-dress-heart.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-girls-tutu-dress-with-heart-1.jpg||-||Little Mass Little Girls Dress and Leggings Set Panda Fun|,|An adorable design, this new little girls dress comes from designer Little Mass. The bodice of the dress is wrapped in white polka dots and features contrasting black and white stripes. Her comfortable hood is lined in a pop of pink. A large panda applique sits upon the front created with sequins. The tulle skirt is layered and finishes with an uneven hemline. Beneath the dress we find striped leggings. The knees are decorated with a pink heart applique. Cotton/Polyester/Rayon Blend. Machine wash cold. Tumble dry low. |,|$104.00$|,||,|LITTLE-MASS-LITTLE-GIRLS-DRESS-LEGGINGS-SET-PANDA-FUN|,|$URL$little-mass-little-girls-dress-leggings-set-panda-fun.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-little-girls-dress-and-leggings-set-panda-fun-1.jpg||-||Little Mass Little Girls Tutu Dress in Velvet|,|The perfect new design to liven up this holiday season, this new girls dress comes from designer Little Mass. The black velvet bodice boasts of a long sleeve style to keep her warm in the winter and a pull over fit comfortable for all day wear. The front of the bodice is dressed with a gold foil screen print in a beautiful damask design. A quaint bow is found off centered on the ribbon waist adorned with metal and sequins. The skirt is inspired from the beloved tutu look and is created with layers of trimmed black tulle. Created with stretch polyester blend and 100% polyester tulle. Machine wash and hang to dry. |,|$37.00$|,||,|LITTLE-MASS-LITTLE-GIRLS-TUTU-DRESS-VELVET|,|$URL$little-mass-little-girls-tutu-dress-velvet.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-little-girls-tutu-dress-in-velvet-1.jpg||-||Little Mass Little Girls Tutu with Sweater and Leggings|,|Designed by Little Mass to stand out this season, this new little girls outfit is too adorable! The sweater top boasts of a small stripe accented with metallic thread and a wide hemline textured with roses and finished in blue. Sweet pink flowers are attached beneath the neckline. Golden leggings add a dreamy tone to the outfit. The pink tutu is layered for volume and decorated with fake petals. Top: Rayon Blend. Under shirt: stretch rayon blend. Skirt: 100% nylon. Leggings: 100% polyester. Machine wash all pieces and hang to dry. |,|$49.00$|,||,|LITTLE-MASS-LITTLE-GIRLS-TUTU-SWEATER-LEGGINGS|,|$URL$little-mass-little-girls-tutu-sweater-leggings.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-little-girls-tutu-with-sweater-and-leggings-17.jpg||-||Little Mass Mary Poppin Red Girls Dress|,|Style never looked so sweet! This new Little Mass dress is sure to make her smile bloom each time she wears it. The bodice is covered with a unique rose print while the sweater-like fabric adds warmth to the dress. Her long sleeves continue in the same pattern. A black bow is found off centered on her neckline framed with small swirls created with silver studs. The volume-filled skirt layers tulle in a gorgeous shade of red and finishes with a ruffled hemline. Stretch rayon blend and 100% polyester fabric, machine wash on gentle and hang to dry. |,|$38.00$|,||,|LITTLE-MASS-MARY-POPPIN-RED-GIRLS-DRESS|,|$URL$little-mass-mary-poppin-red-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-mary-poppin-red-girls-dress-2.jpg||-||Little Mass Mint Rose Girls Tutu Dress|,|^|Colored with a flirty, fun floral, this new girls dress comes from trending designer Little Mass. The bodice is cut for a fitted look and boasts of the pink flowers that pop off of the cool mint background. The sleeveless neckline is accented with a raw-edged fabric rosette to match the one just above her waist. The skirt is created with matching pink tones to truly pull the piece together. The tiers of the skirt are made with a stiff tulle that ruffles around her legs. The dark pink overlay of tulle is enriched by a lighter shade just beneath. A matching pink lining is comfortable against her legs and provides a canvas to which the tulle is attached. Fabric Contents: [self] polyester and spandex blend; [contrast] cotton and poly-nylon blend. Machine wash on cold and tumble dry low. SIZE 12 MONTH ONLY LEFT. ^||,|$51.00$|,||,|LITTLE-MASS-MINT-ROSE-GIRLS-TUTU-DRESS|,|$URL$little-mass-mint-rose-girls-tutu-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-mint-rose-girls-tutu-dress-1.jpg||-||Little Mass Miss Daisy Sequin Girls Dress|,|Created by Little Mass, this fancy little girls dress is sure to be a big hit this spring! The dress boasts of its a line shape. Colorful daisies cover the mesh overlay with their sequin shimmer and a touch of blue tulle ruffles around the neckline. A single button closes at the top of the back and a large tulle bow is tied in the center. The hemline is skirted with a matching blue ruffle. 100% polyester. Machine wash cold, tumble dry low. |,|$79.00$|,||,|LITTLE-MASS-MISS-DAISY-SEQUIN-GIRLS-DRESS|,|$URL$little-mass-miss-daisy-sequin-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-miss-daisy-sequin-girls-dress-1.jpg||-||Little Mass Neon Pink Girls Lace Dress|,|^|New from designer Little Mass, this trendy lace dress is sure to become your tweens favorite this summer. The soft neon pink knit dress is covered with an elegant floral lace overlay with neon piping outlining the flowers. 100% polyester. Machine wash cold, hang dry. SIZE 4 ONLY LEFT.  ^||,|$24.00$|,||,|LITTLE-MASS-NEON-PINK-LACE-DRESS-FANTA|,|$URL$little-mass-neon-pink-lace-dress-fanta.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-neon-pink-girls-lace-dress-14.jpg||-||Little Mass Owl Tunic with Capri Legging|,|^|A real hoot, this new designer top and legging set from Little Mass is right on trend. The long top is a soft white fabric accented with the orange trim around the sleeveless neckline. A fabric applique is found upon the front, a large owl. The bird features cute headphones and warm colors. Matching leggings are paired with the top. The stretch pants offer her a capri length and a splash of turquoise found in the middle of the orange and pink print. Rayon. Hand was cold. SIZE 6 AND 6X ONLY LEFT. ^||,|$51.00$|,||,|LITTLE-MASS-OWL-TUNIC-CAPRI-LEGGING|,|$URL$little-mass-owl-tunic-capri-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-owl-tunic-with-capri-legging-1.jpg||-||Little Mass Pink Flowers Girls Tutu & Top Set|,|^|An adorable new outfit for little girls, this new creation comes from fabulous designer, Little Mass. The ivory top features a fun snowflake creation adorned with small gems and long sleeves with ruffled caps in a soft brushed lace. The accompanying skirt is covered with light pink flowers and overlaid in an elegant netting. A bow sits upon a velvet belt that ties behind her waist. Skirt: lined, poly blend. Top: rayon blend. Machine wash both. SIZE 12 MOS ONLY LEFT.  ^||,|$29.00$|,||,|LITTLE-MASS-PINK-FLOWERS-GIRLS-TUTU-TOP-SET|,|$URL$little-mass-pink-flowers-girls-tutu-top-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-pink-flowers-girls-tutu-top-set-12.jpg||-||Little Mass Pink Striped Tween JoJo Caplet|,|^|A bright new piece sure to entice, this tween caplet comes from trendy designer Little Mass. The neon pink is striped with a heathered grey and boasts of its unique style. The cute hood hangs in the back while the loose fit and sequin adorned flutter cap sleeves are perfect for layering with her favorite camis or tanks. Made with a soft poly blend, machine washable. SIZE 8 AND 14 AVAILABLE.  ^||,|$19.00$|,||,|LITTLE-MASS-PINK-STRIPED-TWEEN-JOJO-CAPLET|,|$URL$little-mass-pink-striped-tween-jojo-caplet.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-pink-striped-tween-jojo-caplet-14.jpg||-||Little Mass Sunshine Chevron Girls Tutu Dress|,|^|This little girls party dress comes to you from fun designer Little Mass. The tank style knit bodice has a delicate lace overlay in a vibrant chevron print and adorned with a bright fuchsia flower with purple floral center. The triple layer tutu is embellished with embroidered floral accents of different sizes and colors. Perfect for all of her special occasions. Polyester/rayon/cotton blend. Machine wash cold, hang dry recommended. SIZE 12 MOS ONLY LEFT.  ^||,|$29.00$|,||,|LITTLE-MASS-SUNSHINE-CHEVRON-GIRLS-TUTU-DRESS|,|$URL$little-mass-sunshine-chevron-girls-tutu-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-sunshine-chevron-girls-tutu-dress-14.jpg||-||Little Mass Tunic Outfit for Little Girls Leopard Love|,|Part of their fall line, this new Little Mass outfit will look fabulous accompanying her to school. The tunic offers an empire waist and sheer lace sleeves. The skirt of the tunic is dresses with a lacey overlay. The bold turquoise is accented with leopard print rosettes and matching sequins at the neckline. Animal print leggings are paired beneath the tunic to complete the look. Nylon/Spandex/Chenille Blend. Machine Wash in Cold Water. Tumble Dry Low. |,|$66.00$|,||,|LITTLE-MASS-TUNIC-OUTFIT-LITTLE-GIRLS-LEOPARD-LOVE|,|$URL$little-mass-tunic-outfit-little-girls-leopard-love.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-tunic-outfit-for-little-girls-leopard-love-17.jpg||-||Little Mass Tween Oversized Top with Plaid Heart|,|^|Layered to fit the fall trends, this new tween top comes from designer Little Mass. The grey tank is fitted in cut and solid in color. The oversized black top is cut shorter and boasts of the batwing sleeves. A large plaid heart sits upon the front, embellished by sparkling studs. Tank: polyester-flex blend. Shirt: rayon-spandex blend. Machine wash both on cold and hang dry. SIZE 7 ONLY REMAINING.  ^||,|$24.50$|,||,|LITTLE-MASS-TWEEN-OVERSIZED-TOP-PLAID-HEART|,|$URL$little-mass-tween-oversized-top-plaid-heart.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-tween-oversized-top-with-plaid-heart-2.jpg||-||Little Mass Tween Skirt with Mesh Overlay|,|^|This fun and flirty skirt is from the Tru Luv line of designer Little Mass. The short white skirt has a longer overlay of white mesh flowing down from the waist. Rayone and polyester. Machine wash cold, hang to dry. ONE SIZE 14 LEFT. ^||,|$19.00$|,||,|LITTLE-MASS-TWEEN-SKIRT-TULLE-TULLE-OVERLAY|,|$URL$little-mass-tween-skirt-tulle-tulle-overlay.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-tween-skirt-with-mesh-overlay-13.jpg||-||Little Mass Tween Summer Dress White and Floral|,|^|A white cotton dream, this new tween summer dress from designer Little Mass is the epitome of the warm, carefree spirit. The bodice features a zippered racer back, a squared U neck accented by braided thread, and a front embroidered with a bright floral garden. The waist line is adorned by a small ruffle and a matching threads braided that tie in a bow in the back while the long skirt is trimmed with lilac thread and a wide ruffle at the hem. 100% cotton, machine washable. ONE SIZE 10 REMAINING.  ^||,|$29.00$|,||,|LITTLE-MASS-TWEEN-SUMMER-DRESS-WHITE|,|$URL$little-mass-tween-summer-dress-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/little-mass-tween-summer-dress-white-and-floral-11.jpg||-||Live & Luca Petal Shoes in Watermelon|,|A great color for all summer activities, these new Livie and Luca petal shoes are just as cute as can be! The watermelon red fits in not only with holidays, but is perfect for a pop of color to any outfit. The sandal has a rounded toe and a Velcro strap. The petal cut out pattern is one of the most popular designs from Livie and Luca. A great grip is provided by the rubber sole while the soft faux leather on the inside keeps her foot comfortable as she plays. |,|$54.00$|,||,|LIVE-LUCA-PETAL-SHOES-WATERMELON|,|$URL$live-luca-petal-shoes-watermelon.html|,|http://ep.yimg.com/ay/yhst-17102259411242/live-luca-petal-shoes-in-watermelon-14.jpg||-||Live and Luca Toi Toi Red Girls Shoes|,|Designed by Livie and Luca, these girls shoes are adorable and fashionable. The red shoes boast of an intricate weave that runs from the rounded toe up the front. A strap secures her foot with Velcro on the side. Small round cut outs and white pick stitching adds the small details that make this designer shoe one of a kind. The inside is padded with faux leather that is soft on her foot. The rubber sole has a great grip! |,|$39.00$|,||,|LIVE-LUCA-TOI-TOI-RED-GIRLS-SHOES|,|$URL$live-luca-toi-toi-red-girls-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/live-and-luca-toi-toi-red-girls-shoes-1.jpg||-||Livie & Luca Baby Girl Blossom Shoes Navy|,|Cute as a button, these little infant shoes will complete her outfit. The dark navy patent leather shines while a violet bloom sits on her toe. Accents of lime glitter are found on both sides and in the center of the flower whiles a touch of Velcro attaches the strap. Inner and outer soles are both soft leather, making these shoes light weight on her precious little feet. |,|$28.50$|,||,|LIVIE-LUCA-BABY-GIRL-BLOSSOM-SHOES-NAVY|,|$URL$livie-luca-baby-girl-blossom-shoes-navy.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-luca-baby-girl-blossom-shoes-navy-11.jpg||-||Livie & Luca Baby Girls Elephant Shoes in Red|,|With such a loveable character on the toe of this new Livie & Luca shoe, how can you resist? The shoe is made with red and pink leather and features a Velcro strap. Ellie the Elephant finds her home on this shoe while the soft inner and outer leather soles keep her shoes comfy and light weight! |,|$19.00$|,||,|LIVIE-LUCA-BABY-GIRLS-ELEPHANT-SHOES-RED|,|$URL$livie-luca-baby-girls-elephant-shoes-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-luca-baby-girls-elephant-shoes-in-red-11.jpg||-||Livie & Luca Bloom Shoes Light Blue for Baby|,|A sky blue beauty, this new designer baby shoe comes from Livie and Luca. The bloom shoe offers soft faux leather both on the outside and inside of this shoe, making not only a great look, but also great comfort. Velcro secures the single strap and a touch of elastic makes it easy for mom to place them on her little feet. A large cut out flower is found on the rounded, peep toe. |,|$27.75$|,||,|LIVIE-LUCA-BLOOM-SHOES-LIGHT-BLOOM-BABY|,|$URL$livie-luca-bloom-shoes-light-bloom-baby.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-luca-bloom-shoes-light-bloom-for-baby-1.jpg||-||Livie & Luca Fuchsia Bloom Girls Shoes|,|^|A classic style in fuchsia from Livie & Luca, this sandal is a delight! The fuchsia pink is accented by an orange flower in full bloom on the top of her foot. Her toes will peek through the front opening. The rubber sole gives stability as she skips and plays. (1) 4 ONLY LEFT.  ^||,|$29.00$|,||,|LIVIE-LUCA-FUCHSIA-BLOOM-GIRLS-SANDALS|,|$URL$livie-luca-fuchsia-bloom-girls-sandals.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-luca-fuchsia-bloom-girls-shoes-13.jpg||-||Livie & Luca Girls Leather Shoes Navy Patent with Blossom|,|^|Matching the younger infant version, these little girl shoes come from the fabulous Livie & Luca. The navy patent shoe features a firm rubber outer sole and a Velcro strap while a violet flower blooms on the toe. Touches of lime glitter add the perfect bit of sparkle. SIZE 4 AND 6 ONLY LEFT.  ^||,|$38.25$|,||,|LIVIE-LUCA-GIRLS-LEATHER-SHOES-NAVY-PATENT-BLOSSOM|,|$URL$livie-luca-girls-leather-shoes-navy-patent-blossom.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-luca-girls-leather-shoes-navy-patent-with-blossom-11.jpg||-||Livie & Luca Girls Petal Shoes in Pink|,|^|For infants to girls, this patent leather shoe is a hit from Livie & Luca. Pink petals enclose the toes and a velcro strap at the ankle makes them easy to take on and off. 10 and 13 only remaining. ^||,|$56.00$|,||,|LIVIE-LUCA-GIRLS-PETAL-PAT-SHOES-PINK|,|$URL$livie-luca-girls-petal-pat-shoes-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-luca-girls-petal-shoes-in-pink-13.jpg||-||Livie & Luca Gray Little Girls Shoes with Blossom|,|^|Whether she's out at the park or in her early years of school, these adorable little girls shoes from Livie and Luca will be the perfect finishing touch to her adorable outfit! The gray patent leather receives a touch of color with the plum blossom on the toe and matching accent stitching. The Velcro strap keeps her foot secure while a hard rubber sole helps give traction. Look for the matching baby version for her infant sister! (1) 5 ONLY LEFT. ^||,|$29.00$|,||,|LIVIE-LUCA-GRAY-LITTLE-GIRL-SHOES-BLOSSOM|,|$URL$livie-luca-gray-little-girl-shoes-blossom.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-luca-gray-little-girls-shoes-with-blossom-13.jpg||-||Livie & Luca Guava Merry Bell Girls Shoes|,|^|These merry girls shoes are from designer Livie & Luca. The guava pink is accented with blue trim. An open toe design allows her toes to peek out. Two little green flowers bloom on the fastening strap. SIZE 4 ONLY AVAILABLE. ^||,|$29.00$|,||,|LIVIE-LUCA-GUAVA-MERRY-BELL-GIRLS-SHOES|,|$URL$livie-luca-guava-merry-bell-girls-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-luca-guava-merry-bell-girls-shoes-13.jpg||-||Livie & Luca Lavender Bloom Shoes for Babies|,|In a sweet lilac shade, these new purple baby shoes were designed by Livie and Luca. The dark trimming has a cute scallop edge. The single strap features a flower with a glitter center hiding the Velcro that secures the fit. The soft sole is perfect for her delicate feet, keep her comfortable and stylish! Purchase older sizes to match the sisters! |,|$27.75$|,||,|LIVIE-LUCA-LAVENDER-BLOOM-SHOES-BABIES|,|$URL$livie-luca-lavender-bloom-shoes-babies.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-luca-lavender-bloom-shoes-for-babies-1.jpg||-||Livie & Luca Light Pink Bloom Shoes for Toddlers and Girls|,|Matching the baby sizes that are also available, these little girls shoes come from Livie and Luca. A sweet peep toe interrupts the rounded shape of the shoe while the detail stitching is a subtle accent. A large flower is found on the top of her foot with a light blue center. The strap that travels around her ankle is secured with Velcro. The rubber outsole has grip while the leather is a comfortable padding for her foot. |,|$39.00$|,||,|LIVIE-LUCA-LIGHT-PINK-BLOOM-SHOES-TODDLERS-GIRLS|,|$URL$livie-luca-light-pink-bloom-shoes-toddlers-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-luca-light-pink-bloom-shoes-for-toddlers-and-girls-1.jpg||-||Livie & Luca Lime Bloom Girls Sandals|,|^|This classic from Livie & Luca in lime is blooming just in time for spring! A fuchsia rosette adorns the top of her foot as her toes peek from the front. Fastens at the ankle with velcro. SIZE 4 AND 13 ONLY LEFT.  ^||,|$29.00$|,||,|LIVIE-LUCA-LIME-BLOOM-GIRLS-SANDALS|,|$URL$livie-luca-lime-bloom-girls-sandals.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-luca-lime-bloom-girls-sandals-13.jpg||-||Livie & Luca Luz Orange Girls Shoes|,|Unlike any other shoes she owns, these new Livie and Lucas are so fun! The orange shoe has a rounded tow and is created with an orange and magenta blend. Three rectangle windows are lined with pick stitching on the toes. The criss cross straps are secured with Velcro near her heel. The rubber sole is textured like a bee hive and grips the ground as she runs and plays. |,|$39.00$|,||,|LIVIE-LUCA-LUZ-ORANGE-GIRLS-SHOES|,|$URL$livie-luca-luz-orange-girls-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-luca-luz-orange-girls-shoes-1.jpg||-||Livie & Luca Merry Bell Mint Baby Shoes|,|A trendy springtime color, these new baby shoes from Livie and Luca are both unexpected and comfortably familiar. The soft faux leather is as cozy for her feet as can be. The mint green is a bright pastel accented with blue, scallop trim. The rounded toe has a small peep hole cut out. A strap runs across the front and is accented with a sweet flower bloom. Fasten the velcro on the side to secure her foot in place. |,|$27.75$|,||,|LIVIE-LUCA-MERRY-BELL-MINT-BABY-SHOES|,|$URL$livie-luca-merry-bell-mint-baby-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-luca-merry-bell-mint-baby-shoes-1.jpg||-||Livie & Luca Red Baby Girls Shoe with Blossom|,|^|The soft inner padding keeps her comfortable while the fabric outer sole keeps this new baby shoe light weight. From Livie & Luca, the dazzling red patent leather features a Velcro strap and a rich brown toe blossom accented with sparkling gold glitter. 0-6 MOS ONLY LEFT.  ^||,|$19.00$|,||,|LIVIE-LUCA-RED-BABY-GIRLS-SHOE-BLOSSOM|,|$URL$livie-luca-red-baby-girls-shoe-blossom.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-luca-red-baby-girls-shoe-with-blossom-12.jpg||-||Livie & Luca Violet Merry Bell Girls Shoes|,|^|Violet merry bells from designer Livie & Luca will bloom beautifully on her feet this spring! An open toe design with flower accents on the strap and lime green trim add to the adorable charm of these shoes. Rubber soles give stability. SIZE 4 REMAINING.  ^||,|$29.00$|,||,|LIVIE-LUCA-VIOLET-MERRY-BELL-GIRLS-SHOES|,|$URL$livie-luca-violet-merry-bell-girls-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-luca-violet-merry-bell-girls-shoes-16.jpg||-||Livie and Luca Baby Blossom Gold Shoe|,|^|Matching her older sisters new shoes, these baby shoes come from the fabulous Livie and Luca. The soft shimmering gold is a subtle shade and boasts of the faux leather look. The purple blossom found on the toe of both feet is accented with a glittering gold center. At the back of her heel the shoe is slit to allow slight stretch with elastic, helping ensure a comfy fit for her little feet. The strap is attached with Velcro while the soft sole has two round rubber pads to help give a good grip. SIZE AND 18/24 MOS REMAINING.  ^||,|$29.00$|,||,|LIVIE-LUCA-BABY-BLOSSOM-GOLD-SHOE|,|$URL$livie-luca-baby-blossom-gold-shoe.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-baby-blossom-gold-shoe-2.jpg||-||Livie and Luca Baby Shoes in Grey Bluebell|,|Created by Livie Luca for your darling infants feet, these sweet shoes are sure to make her stand apart. The grey patent leather helps to catch the light while the cobalt grey goes with just about anything. Purple scalloped trimming accent is found on some of the edges while the Velcro strap is adorned with a cute little flower. Two slits at the back of her heels allow stretch along with some elastic, making the fit as comfortable as possible. The soft sole boasts of two rubber pads that give some grip. |,|$29.00$|,||,|LIVIE-LUCA-BABY-SHOES-GREY-BLUEBELL|,|$URL$livie-luca-baby-shoes-grey-bluebell.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-baby-shoes-in-grey-bluebell-2.jpg||-||Livie and Luca Bird Shoes in Turquoise|,|From Livie and Luca, these new little girls shoes are a breath of fresh air all fall and winter long. The Mary Jane's are colored in a bold turquoise that adds a pop of color to her outfit. The side of the toe is adorned with a gold glitter bird applique. A second glitter applique is found on the Velcro ankle strap. These shoes are lined with a soft leather. The outer sole is a gripping leather, the older sizes of these shoes have a slightly different shape due to the different sole used. |,|$58.00$|,||,|LIVIE-AND-LUCA-BIRD-SHOES-TURQUOISE|,|$URL$livie-and-luca-bird-shoes-turquoise.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-bird-shoes-in-turquoise-17.jpg||-||Livie and Luca Black Toi Toi Shoes for Girls|,|^|Livie and Luca will never cease to provide adorable shoes for girls unique in style. The closed toe shoe features a rounded shape and subtle contrast with the ivory thread stitching. The weaved leather design runs up the top of her shoe with a matching ivory background. The velcro strap is perfect for her little hands to use and the rubber sole provides great grip as she runs and plays. Please note that the sizes 4-9 have a wider shape than the older sizes available, please see photos for details. SIZE 4 ONLY LEFT.  ^||,|$39.00$|,||,|LIVIE-LUCA-BLACK-TOI-TOI-SHOES-GIRLS|,|$URL$livie-luca-black-toi-toi-shoes-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-black-toi-toi-shoes-for-girls-3.jpg||-||Livie and Luca Blossom Shoes for Girls in Gold|,|^|One of the popular styles from designer Livie and Luca, these new arrivals are part of the Blossom shoes that many customers love. The gold shoe boasts of a slight shimmer in its color and an easy to use Velcro strap. The toe of both feet is adorned by a purple blossom garnished by a gold glitter center. The rubber sole is perfect for her active feet, supplying a grip to hard surfaces. These shoes offer a wider sole style for the younger sizes, please see the photographs for further information. ^||,|$42.00$|,||,|LIVIE-LUCA-BLOSSOM-SHOE-GIRLS-GOLD|,|$URL$livie-luca-blossom-shoe-girls-gold.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-blossom-shoes-for-girls-in-gold-2.jpg||-||Livie and Luca Dawn Light Pink Girls Shoes|,|^|A new style from designer Livie and Luca, these little girls shoes are ready for all of her fun in the sun. The light pink shoe features metallic gold sun rays covering her rounded toe. The strap on the top of her foot is striped in gold and pink, creating a girly rainbow to the sweet golden cloud that is fastened on the outer side of both shoes. The inner sole and patting is a soft faux leather. The rubber outsole has a great grip for her active life. The light pink is sure to catch her eye and match many pieces in her closet! SIZE 4 AND 5 ONLY REMAINING. ^||,|$39.00$|,||,|LIVIE-LUCA-DAWN-LIGHT-PINK-GIRLS-SHOES|,|$URL$livie-luca-dawn-light-pink-girls-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-dawn-light-pink-girls-shoes-14.jpg||-||Livie and Luca Fall Boots for Little Girls in Red PREORDER|,|^|Boot strapin' cute, these fabulous ""Hopper"" boots are from designer Livie and Luca. The red suede is a great color to accent the red found in her outfit. A cute stitched design wraps around her toe for a moccasin accent. Light aqua rawhide straps lace up the front with a tassel finish. The boots are easy to slip on with the satiny swan lining and the matching zipper! Please note that this Livie and Luca item is on PreOrder and is NOT currently in stock. This item is expected to arrive in stock by September 4, 2014. For further information on our PreOrder policies, visit our PreOrder page.  ^||,|$68.00$|,||,|LIVIE-AND-LUCA-FALL-BOOTS-LITTLE-GIRLS-RED|,|$URL$livie-and-luca-fall-boots-little-girls-red.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-fall-boots-for-little-girls-in-red-12.jpg||-||Livie and Luca Girls Designer Boots in Fuchsia with Buttons PREORDER|,|^|A fabulously adorable boot, these new designer shoes for little girls come from Livie and Luca. The ""Marchita"" boots are a popular design from their fall collection while this fuchsia suede is a perfect pop of color. The outer side of the boot is closed with large metal buttons that create a ruffled fit. The shoe is finished with a honeycomb sole with a great grip and flexibility. Please note that this Livie and Luca item is on PreOrder and is NOT currently in stock. This item is expected to arrive in stock by September 4, 2014. For further information on our PreOrder policies, visit our PreOrder page.  ^||,|$68.00$|,||,|LIVIE-AND-LUCA-GIRLS-DESIGNER-BOOTS-FUCHSIA-BUTTONS|,|$URL$livie-and-luca-girls-designer-boots-fuchsia-buttons.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-girls-designer-boots-in-fuchsia-with-buttons-12.jpg||-||Livie and Luca Girls Embossed Leather Shoes in Yellow|,|A unique creation, these little girls fall shoes are from Livie and Luca. The rich mustard yellow leather is a hot fall color. The shoe is dressed with the embossed baroque pattern. The strap is decorated with a brass buckle that allows her little hands to practice buckling and unbuckling. These shoes are hand sewn for an added value. |,|$58.00$|,||,|LIVIE-AND-LUCA-GIRLS-EMBOSSED-LEATHER-SHOES-YELLOW|,|$URL$livie-and-luca-girls-embossed-leather-shoes-yellow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-girls-embossed-leather-shoes-in-yellow-12.jpg||-||Livie and Luca Girls Leather Shoes in Gold Metallic|,|Created in neutral tones to match many different outfits, this new little girls shoe was designed by Livie and Luca. The gold leather is a soft, brushed shade that has just the perfect amount of shimmer. Soft leather lines the inside while a rubber sole grips the ground with every step. The ankle strap is a secure fit that is dressed with suede flower accents. The final decoration is found on the top of her foot, a touch of scallop edges with matching brown suede. |,|$58.00$|,||,|LIVIE-AND-LUCA-GIRLS-LEATHER-SHOES-GOLD-METALLIC|,|$URL$livie-and-luca-girls-leather-shoes-gold-metallic.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-girls-leather-shoes-in-gold-metallic-12.jpg||-||Livie and Luca Girls Patent Leather Shoes in Grape|,|A fabulous new design by Livie and Luca, these adorable little girl shoes have arrived in tie for the fall and winter season. The shoes are created in a grape patent leather and is trimmed with touches of red suede. The top of her foot boasts of a scallop edge. The Velcro strap is finished with a suede bow complete with flower tassels. The rubber outer sole offers grip as she runs and plays. |,|$58.00$|,||,|LIVIE-AND-LUCA-GIRLS-PATENT-LEATHER-SHOES-GRAPE|,|$URL$livie-and-luca-girls-patent-leather-shoes-grape.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-girls-patent-leather-shoes-in-grape-6.jpg||-||Livie and Luca Girls Petal Shoes in Black Leather|,|Designed by Livie and Luca, these new little girl shoes are a sweet design that is a touch of elegance and playfulness. The shoe boasts of the petal accent that sits upon the top of her toes. This shoe is made with a classic patent leather look that is a fabulous match to many different outfits. A soft leather lines the inside while the outer sole is a gripping leather. Please note that the older sizes of the shoes may have a different shape due to the different style of sole. |,|$58.00$|,||,|LIVIE-AND-LUCA-GIRLS-PETAL-SHOES-BLACK-LEATHER|,|$URL$livie-and-luca-girls-petal-shoes-black-leather.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-girls-petal-shoes-in-black-leather-12.jpg||-||Livie and Luca Girls Red Petal Shoes in Suede|,|A favorite design with a new recipe, these Livie and Luca petal shoes are perfect for holiday parties. The red shoe boasts of the blend of soft suede and shiny patent leather. The petal design is the perfect decoration on her toe. The ankle strap is finished with Velcro for an easy fit. While quantities last, this shoe is also created in black, check out our Livie and Luca page! |,|$58.00$|,||,|LIVIE-AND-LUCA-GIRLS-RED-PETAL-SHOES-SUEDE|,|$URL$livie-and-luca-girls-red-petal-shoes-suede.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-girls-red-petal-shoes-in-suede-22.jpg||-||Livie and Luca Girls Ruched Leather Shoes in Gold|,|Livie and Luca is now offering this adorable little girls shoes as a part of their fall and winter collection. These golden shoes are created with leather for a classic look. The ankle strap is secured with Velcro and dressed with fringe lining. A ruched ruffle sits on the top of her foot and finishes with a scallop edge. The rubber honeycomb sole is styled with stitching around the edge. This sole is made from Stroebel construction, increasing the shoes flexibility. |,|$58.00$|,||,|LIVIE-AND-LUCA-GIRLS-RUCHED-LEATHER-SHOES-GOLD|,|$URL$livie-and-luca-girls-ruched-leather-shoes-gold.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-girls-ruched-leather-shoes-in-gold-12.jpg||-||Livie and Luca Girls Ruched Leather Shoes in Shimmer Magenta|,|Designed with love, these new Live and Luca girls shoes are a sweet creation that can be worn for any occasion. The comfortable fit is created by the soft leather lining and the Velcro ankle strap. The honeycomb sole has a great grip and is a flexible fit that moves with her every step. The shimmering magenta leather catches the light and is easy to pair with her outfit. The ruched ruffle accents the top of her foot while a touch of fringe edges the strap. |,|$58.00$|,||,|LIVIE-AND-LUCA-GIRLS-RUCHED-LEATHER-SHOES-SHIMMER-MAGENTA|,|$URL$livie-and-luca-girls-ruched-leather-shoes-shimmer-magenta.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-girls-ruched-leather-shoes-in-shimmer-magenta-6.jpg||-||Livie and Luca Girls Shoes Fuschia Toi Toi|,|In fun pink, these new designer girls shoes have arrived as a part of the Livie and Luca fall and winter collection. The shoe is made with a pink suede while patent leather creates the braided accent on the top of her foot. The Velcro strap is easy for her to use on her own. The show is lined with soft leather while the sole is made of gripping rubber. Please note that the sizes 10 and larger have a different rubber sole that alters the shape of the shoe slightly. |,|$58.00$|,||,|LIVIE-AND-LUCA-GIRLS-SHOES-FUSCHIA-TOI-TOI|,|$URL$livie-and-luca-girls-shoes-fuschia-toi-toi.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-girls-shoes-fuschia-toi-toi-6.jpg||-||Livie and Luca Girls Shoes Knoll Cloud|,|An inspired style from Livie and Luca, these new little girls shoes are a fabulous floral. The toe has a rounded square look as a single strap runs across the top of her foot to the Velcro found on the outer side. The rose pink is complimented with a flower pattern and light grey. A beehive textured rubber grips the flour and the faux leather insole offers the perfect level of comfort for her feet. |,|$39.00$|,||,|LIVIE-LUCA-GIRLS-SHOES-KNOLL-CLOUD|,|$URL$livie-luca-girls-shoes-knoll-cloud.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-girls-shoes-knoll-cloud-2.jpg||-||Livie and Luca Girls Yellow Leather Shoes with Hedgehog|,|An adorable design from Livie and Luca, these little girl shoes are a playful twist to add to her wardrobe. The bright yellow leather is a bold pop of color while the shoe is lined in pink. A cute little friend is found on the front. The hedgehog is made with grey patent leather and grey suede. The strap is finished with Velcro. |,|$56.00$|,||,|LIVIE-AND-LUCA-GIRLS-YELLOW-LEATHER-SHOES-HEDGEHOG|,|$URL$livie-and-luca-girls-yellow-leather-shoes-hedgehog.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-girls-yellow-leather-shoes-with-hedgehog-12.jpg||-||Livie and Luca Gray Patent Leather Shoes with Blossom PREORDER|,|^|From designer Livie and Luca, these baby girls shoes are a real cutie. The shoes are dressed in stone gray patent leather. This leather is accented with white stitching and a soft outer sole. The strap is secured with Velcro while the back stretches with a touch of elastic for a comfortable fit with every step. A teal flower sits on the top of her toes while silver glitter is found at the center. These shoes are lined in pink and are sure to add the perfect color to her fall and winter wardrobe. Please note that this Livie and Luca item is on PreOrder and is NOT currently in stock. This item is expected to arrive in stock by July 18, 2014. For further information on our PreOrder policies, visit our PreOrder page.  ^||,|$39.00$|,||,|LIVIE-AND-LUCA-GRAY-PATENT-LEATHER-SHOES-BLOSSOM|,|$URL$livie-and-luca-gray-patent-leather-shoes-blossom.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-gray-patent-leather-shoes-with-blossom-1.jpg||-||Livie and Luca Green Girls Shoes Opal|,|^|A rich grass green, these new little girls shoes are from Livie and Luca. The velcro ankle strap is perfect for her to put on her shoes all by herself! A small touch of watermelon red trims the fancy design that accents the top of the shoe. The rounded toe has a small peep hole. The rubber sole is firm and sure of its grip. SIZE 6 ONLY LEFT.  ^||,|$39.00$|,||,|LIVIE-LUCA-GREEN-GIRLS-SHOES-OPAL|,|$URL$livie-luca-green-girls-shoes-opal.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-green-girls-shoes-opal-1.jpg||-||Livie and Luca Leather Boots for Little Girls in Olive PREORDER|,|^|The ""Stitcher"" boot from Livie and Luca is a fabulous blend of textures as they have created this new fall boot for girls. The boat is created with an embossed leather in olive green. The white stitching is a sweet accent while three straps wrap around the boot. A simple woven cotton flower creates a sweet accent on this boot. The embossed design on the leather is floral and fabulous! A zipper is found on the inner side of the boot, making it easy for her to pull them on her self! The closer you look at this boot, the more details you will find and love! Please note that this Livie and Luca item is on PreOrder and is NOT currently in stock. This item is expected to arrive in stock by September 4, 2014. For further information on our PreOrder policies, visit our PreOrder page.  ^||,|$68.00$|,||,|LIVIE-AND-LUCA-LEATHER-BOOTS-LITTLE-GIRLS-OLIVE|,|$URL$livie-and-luca-leather-boots-little-girls-olive.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-leather-boots-for-little-girls-in-olive-12.jpg||-||Livie and Luca Light Blue Baby Shoes Merry Bell|,|A new creation from designer Livie and Luca, these darling baby shoes are sure to be a favorite this spring and summer. The light blue shoe is made with faux leather. The light brown scallop cut outs trim the entire shoe and frame the single strap. A small flower is found above where the strap is fastened with Velcro. This light blue design is a perfect match to several other styles available in older sizes for her sister! |,|$27.75$|,||,|LIVIE-LUCA-LIGHT-BLUE-BABY-SHOES-MERRY-BELL|,|$URL$livie-luca-light-blue-baby-shoes-merry-bell.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-light-blue-baby-shoes-merry-bell-2.jpg||-||Livie and Luca Light Blue Bloom Shoes for Girls|,|A style worthy of your princess, this light blue shoe from Livie and Luca is a popular style in a fresh new color. The light pastel blue is complimented with the purple flower found on the toe. A touch of glittering blue is found at the center of the flower while a peep toe makes this shoe trendy. A strap wraps around her ankle and is secured with Velcro. The faux leather insole is sure to keep her foot comfortable all day long. A rubber out sole gives her foot a secure grip. |,|$39.00$|,||,|LIVIE-LUCA-LIGHT-BLUE-BLOOM-SHOES-GIRLS|,|$URL$livie-luca-light-blue-bloom-shoes-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-light-blue-bloom-shoes-for-girls-1.jpg||-||Livie and Luca Little Girls Blue Bell Shoe|,|^|Preparing her for the back to school days, these adorable new ""Blue Bells"" come from designer Livie and Luca. The round toe show boasts of a rubber sole for a great grip and a velcro strap made easy for little hands. A pink floral bow adorns the end of the strap and matches the cute scalloped trim on the shoe. Sizes 4-9 have a different shape than the older girl styles. Please see the photos for more details. (1) EACH SIZE 4 ONLY LEFT. ^||,|$39.00$|,||,|LIVIE-LUCA-LITTLE-GIRLS-BLUE-BELL-SHOE|,|$URL$livie-luca-little-girls-blue-bell-shoe.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-little-girls-blue-bell-shoe-3.jpg||-||Livie and Luca Little Girls Suede Boots in Mocha PREORDER|,|^|In a rich mocha brown, these new girls boots are designed by the beloved brand, Livie and Luca. The suede boots have an adorable, comfortable fit created by the satiny swan lining that was custom designed for these shoes. The toe is dressed with a stitched accent. The pink laces are a rawhide leather and boast of their tassels. The honeycomb sole is flexible and offers great grip! Please note that this Livie and Luca item is on PreOrder and is NOT currently in stock. This item is expected to arrive in stock by September 4, 2014. For further information on our PreOrder policies, visit our PreOrder page.  ^||,|$68.00$|,||,|LIVIE-AND-LUCA-LITTLE-GIRLS-SUEDE-BOOTS-MOCHA|,|$URL$livie-and-luca-little-girls-suede-boots-mocha.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-little-girls-suede-boots-in-mocha-12.jpg||-||Livie and Luca Merry Bell Lavender Girls Shoes|,|A light lavender shade covers her foot with these new Livie and Luca merry bells. A matching faux leather insole is comfortable while dark scallop trim edges the shoe. The Velcro strap is accented with a bow and two cut out flowers. A rubber sole gives great grip to the floor while she plays. Match these with her little baby sisters new pair of Livie and Lucas for the perfect spring photo! |,|$39.00$|,||,|LIVIE-LUCA-MERRY-BELL-LAVENDER-GIRLS-SHOES|,|$URL$livie-luca-merry-bell-lavender-girls-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-merry-bell-lavender-girls-shoes-1.jpg||-||Livie and Luca Merry Bell Light Blue Girls Shoes|,|A sky blue shoe, these new arrivals come from Livie and Luca. The sandal features a peep toe and quaint scallops that are found trimming the edges. A Velcro straps is styled with a contrasting bow, the tails dangling cut out flowers. The shoe is made with faux leather and a firm sole is made from rubber for a great grip. |,|$39.00$|,||,|LIVIE-LUCA-MERRY-BELL-LIGHT-BLUE-GIRLS-SHOES|,|$URL$livie-luca-merry-bell-light-blue-girls-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-merry-bell-light-blue-girls-shoes-1.jpg||-||Livie and Luca Mint Girls Shoes Merry Bell|,|Bright and filled with spring, these new Livie and Luca shoes are sure to rival the new life blooming from the ground. The light mint green is coordinated with aqua and purple accents. The scallop trimming is perfect for small details while the small bow boasts of two cut out flowers on both tails. A velcro strap helps to secure her foot along with the rubber sole grip. The faux leather insole is soft and comfy. |,|$39.00$|,||,|LIVIE-LUCA-MINT-GIRLS-SHOES-MERRY-BELL-MINT|,|$URL$livie-luca-mint-girls-shoes-merry-bell-mint.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-mint-girls-shoes-merry-bell-1.jpg||-||Livie and Luca Moccasin Boots for Girls in Grape PREORDER|,|^|A bright and fun creation, these new boots are from Livie and Luca. The grape suede is dressed with a stitching accent on the toe. The bold green laces are a rawhide leather and are finished with tassels. The honeycomb sole is flexible for her every step. A convenient zipper is found on the inner side of both shoes while the lining is a custom designed pattern of elegant swans. These boots are easy to pair with outfits and are a run creation she will rock! Please note that this Livie and Luca item is on PreOrder and is NOT currently in stock. This item is expected to arrive in stock by September 4, 2014. For further information on our PreOrder policies, visit our PreOrder page.  ^||,|$68.00$|,||,|LIVIE-AND-LUCA-MOCCASIN-BOOTS-GIRLS-GRAPE|,|$URL$livie-and-luca-moccasin-boots-girls-grape.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-moccasin-boots-for-girls-in-grape-12.jpg||-||Livie and Luca Navy Blue Bell Infant Shoe|,|^|Adorable baby shoes new from designer Livie and Luca, these darling blue bells have incredible charm. The round toe shoe is made with a dark navy blue leather and boasts of the elastic that allows slight stretch at the back of her heel for comfort. The strap over the top of her foot is fastened with velcro. The mauve pink flower on the end of her strap matches the scalloped pink edging that adds the finishing touch. Also available in a style of older sizes! SIZE 6/12MOS ONLY REMAINING.  ^||,|$29.00$|,||,|LIVIE-LUCA-NAVY-BLUE-BELL-INFANT-SHOE|,|$URL$livie-luca-navy-blue-bell-infant-shoe.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-navy-blue-bell-infant-shoe-2.jpg||-||Livie and Luca Opal Purple Girls Shoes|,|The tuxedo of new shoes, these fancy new arrivals come from Livie and Luca,. The dark purple shade is both unique and loved. The Velcro strap is easy for her little hands to use while a cut out pattern is found on the top of her foot. A small little peep hole is found on the toe of both shoes. This style is also available in green and watermelon red. |,|$39.00$|,||,|LIVIE-LUCA-OPAL-PURPLE-GIRLS-SHOES|,|$URL$livie-luca-opal-purple-girls-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-opal-purple-girls-shoes-1.jpg||-||Livie and Luca Opal Shoes for Girls Watermelon|,|A unique color for summer or spring, the watermelon red shoes come from Livie and Luca. The deep color is rich and warm. The velcro strap is secured on the outer side of both feet. A light trim outlines the cutout pattern that falls down from the strap to the top of her foot. The round toe is finished with a small peep hole cut out found in the center. These shoes are positively darling and are perfect for both the every day outfit and a special occasion! |,|$39.00$|,||,|LIVIE-LUCA-OPAL-SHOES-GIRLS-WATERMELON|,|$URL$livie-luca-opal-shoes-girls-watermelon.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-opal-shoes-for-girls-watermelon-1.jpg||-||Livie and Luca Patent Flouret Boots for Girls Burgundy|,|^|A new style that is hitting the fall market by storm, these new Livie and Luca boots are sure to appeal to those who love the petal shoes. The short boots boast of a rich burgundy shade of faux patent leather and two Velcro straps with fancy edges. On the toes of each feet are the famous petal pattern with matching glitter center. The final cap on this style comes from the scalloped tongue. Please note that the younger sizes have a slightly different shape of sole, look at the images for more details. (1) SIZE 4 ONLY LEFT. ^||,|$29.00$|,||,|LIVIE-LUCA-PATENT-FLOURET-BOOTS-GIRLS-BURGUNDY|,|$URL$livie-luca-patent-flouret-boots-girls-burgundy.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-patent-flouret-boots-for-girls-burgundy-2.jpg||-||Livie and Luca Petal Shoes Sky Blue|,|^|One of the most popular Livie and Luca styles, these petal shoes are in a cool new shade for spring. The light blue patent leather has a great shine that reflects the lights. The toe of the shoe has a fun cut out petal pattern lined with stitching. A rubber outsole and a faux leather insole creates both comfort and a secure step. SIZE 4 REMAINING.  ^||,|$54.00$|,||,|LIVIE-LUCA-PETAL-SHOES-SKY-BLUE|,|$URL$livie-luca-petal-shoes-sky-blue.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-petal-shoes-sky-blue-1.jpg||-||Livie and Luca Pink Bloom Baby Shoes|,|^|A match to her older sister's shoes, these new baby shoes come from Livie and Luca. The light pink shoe offers her a comfortable fit with a soft sole and a touch of elastic. The strap that runs across the front is fastened on the outer side with Velcro. The peep toe is home to a dark pink flower with a glitter green center. This shoe goes great both with pants and dresses! 6-12 MOS ONLY LEFT.  ^||,|$27.75$|,||,|LIVIE-LUCA-PINK-BLOOM-BABY-SHOES|,|$URL$livie-luca-pink-bloom-baby-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-pink-bloom-baby-shoes-11.jpg||-||Livie and Luca Pink Blossom Infant Girls Shoes PREORDER|,|^|A sweet arrival, these new baby shoes from designer Livie and Luca are perfect for your sweet girl. These patent leather shoes are made in a soft baby pink shade. The comfortable collar has elastic for a stretch fit around her ankle. Both toes are adorned by a fuchsia flower completed by a glitter center. The strap is secured with Velcro while the shoe is finished with a soft outer sole. Please note that this Livie and Luca item is on PreOrder and is NOT currently in stock. This item is expected to arrive in stock by July 18, 2014. For further information on our PreOrder policies, visit our PreOrder page.  ^||,|$39.00$|,||,|LIVIE-AND-LUCA-PINK-BLOSSOM-INFANT-GIRLS-SHOES|,|$URL$livie-and-luca-pink-blossom-infant-girls-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-pink-blossom-infant-girls-shoes-1.jpg||-||Livie and Luca Pro Tempore Blue Girls Shoes|,|Such an adorable new arrival, this fabulous girls summer shoe comes from the beloved brand Livie and Luca. Livie and Luca offers her a quality shoe that is filled with a unique and beautiful style. This mary jane is styled with their classic ruche look. The name comes from the scallop fabric that wraps around on top of the toes! The pale cornflower blue is a fun pop of color that will draw out similar tones from her outfit. The grip sole is a honeycomb texture while the ankle strap is fastened easily with Velcro. This style is a special limited quantity offer, so don't delay! |,|$39.00$|,||,|LIVIE-AND-LUCA-PRO-TEMPORE-BLUE-GIRLS-SHOES|,|$URL$livie-and-luca-pro-tempore-blue-girls-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-pro-tempore-blue-girls-shoes-1.jpg||-||Livie and Luca Red Ruche Girls Shoes|,|^|Perfect to go with her new school outfits, these cute little girls shoes come from designer Livie and Luca. The red faux leather is subtly accented by white pick stitching. A cute ruched ruffle runs around her toe while the Velcro strap that sits on the top of her feet features slit edges. The honeycomb sole offers her a grip as she runs and plays. SIZE 4 AND 6 AVAILABLE. ^||,|$42.00$|,||,|LIVIE-LUCA-RED-RUCHE-GIRLS-SHOES|,|$URL$livie-luca-red-ruche-girls-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-red-ruche-girls-shoes-2.jpg||-||Livie and Luca Rose Shimmer Pink Shoes|,|Sure to delight the most stylish of girls, these new girls shoes have just arrived from loved Livie and Luca! The shoe is a soft shade of rose pink accented with matching pink thread around the bottom. The ruche accent is found atop the toe and is the perfect small detail that makes this look all its own! The ankle strap is easy for her to fasten herself with the Velcro fasten on the outer side. Only available in limited quantity, this pink Livie and Luca Ruche shoe also arrived in cornflower blue and orchid purple! Check them out before its too late! |,|$39.00$|,||,|LIVIE-AND-LUCA-ROSE-SHIMMER-PINK-SHOES|,|$URL$livie-and-luca-rose-shimmer-pink-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-rose-shimmer-pink-shoes-1.jpg||-||Livie and Luca Ruche Purple Shoes|,|^|Livie and Luca has released this orchid purple summer time shoe as part of a limited quantity item for the summer! The punch of purple looks great with her sunny day outfits while the comfortable fit and unique style make this show a must have piece for every day wear! A scallop finished accent wraps around the top of the toe, lending the name ""ruche"" to this style. An easy Velcro strap fastens around her ankle and along with the rubber bottom sole give a firm fit and grip. The sole is a honeycomb texture. Look for this shoe in limited time pink and blue while quantities last! ^||,|$39.00$|,||,|LIVIE-AND-LUCA-RUCHE-PURPLE-SHOES|,|$URL$livie-and-luca-ruche-purple-shoes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-ruche-purple-shoes-3.jpg||-||Livie and Luca Suede Boots for Girls Marchita Taupe PREORDER|,|^|A warm brown boot perfect to welcome fall weather, this new shoe comes from fabulous Livie and Luca. The faux suede is the perfect texture in a taupe brown shade. A long zipper runs up the inner side of both boots for a classic fit. The outer side is ruffled and adorned by three metal buttons that look like old clock faces.Please note that this Livie and Luca item is on PreOrder and is NOT currently in stock. This item is expected to arrive in stock by September 4, 2014. For further information on our PreOrder policies, visit our PreOrder page.  ^||,|$68.00$|,||,|LIVIE-LUCA-SUEDE-BOOTS-GIRLS-MARCHITA-TAUPE|,|$URL$livie-luca-suede-boots-girls-marchita-taupe.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-suede-boots-for-girls-marchita-taupe-2.jpg||-||Livie and Luca Toi Toi Shoes for Girls in Turquoise|,|Created with a lovely vintage feel, these new little girls shoes are from designer Livie and Luca. The turquoise suede is a hot color for the season while boasting of great texture. The braided accent on the top of her foot is created in a patent leather. The ankle strap is threaded through the braids and secured with Velcro. The outer sole is different for sizes 10 and up, altering the shape of the shoe slightly. No matter the style of the sole, this shoe offers a grip with every step! |,|$58.00$|,||,|LIVIE-AND-LUCA-TOI-TOI-SHOES-GIRLS-TURQUOISE|,|$URL$livie-and-luca-toi-toi-shoes-girls-turquoise.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-toi-toi-shoes-for-girls-in-turquoise-12.jpg||-||Livie and Luca Vintage Girls Boots in Stitcher Brown|,|^|A vintage style shoe created for your darling daughter's fall wardrobe, Livie and Luca has really set themselves apart. The brown faux leather is accented with white stitching and horizontal stripes. The warm floral cord fabric runs up the front of the boot while a cute rosette is attached to the outer side. A dark brown zipper runs up the side to secure her feet and the honeycomb rubber sole grips the ground as she runs around the playground. (1) SIZE 4 ONLY LEFT. ^||,|$49.00$|,||,|LIVIE-LUCA-VINTAGE-GIRLS-BOOTS-STITCHER-BROWN|,|$URL$livie-luca-vintage-girls-boots-stitcher-brown.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-vintage-girls-boots-in-stitcher-brown-2.jpg||-||Livie and Luca Vintage Gold Charm Sandal|,|^|Ready to be shown off this spring and summer, these new designer sandals for girls comes from Livie and Luca. The golden faux leather has a great metallic shimmer and texture. Two straps run across her toes accented with a rose in the center. The ankle strap is closed with easy to use Velcro on the outer side. The outer sole is a grip rubber to secure her feet as she walks, runs, or plays. SIZE 4 & 9 ONLY LEFT.  ^||,|$39.00$|,||,|LIVIE-AND-LUCA-VINTAGE-GOLD-CHARM-SANDAL|,|$URL$livie-and-luca-vintage-gold-charm-sandal.html|,|http://ep.yimg.com/ay/yhst-17102259411242/livie-and-luca-vintage-gold-charm-sandal-1.jpg||-||Love U Lots Blue Girls Swimsuit Coverup with Pom Poms|,|Perfect for her trip down to the pool or beach, this new swimsuit coverup comes from Love U Lots. The navy blue top is covered with multiple different prints. Loose fit sleeves and a relaxed cut makes this cover up a cozy piece to wear. The unique keyhole neckline is accented with cute pom poms that dance as she walks. 100% viscose. Made in the USA. Hand wash cold, line dry. |,|$29.00$|,||,|LOVE-U-LOTS-BLUE-GIRLS-SWIMSUIT-COVERUP-POM-POMS|,|$URL$love-u-lots-blue-girls-swimsuit-coverup-pom-poms.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-blue-girls-swimsuit-coverup-with-pom-poms-1.jpg||-||Love U Lots Casual Summer Outfit Aqua|,|Created in a trendy color, this new summer outfit for girls comes from designer Love U Lots. The tunic is covered with two tone stripes and boasts of a single shoulder neckline. A ruffle wraps around the neck and a thin shoulder strap is placed on her left shoulder. The cute little flowers that sit upon the neck introduce new colors to the piece. The hemline of the tunic is finished with a ruffle. The solid capri leggings worn beneath are finished with three bows on both legs. |,|$29.00$|,||,|LOVE-U-LOTS-CASUAL-SUMMER-OUTFIT-AQUA|,|$URL$love-u-lots-casual-summer-outfit-aqua.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-casual-summer-outfit-aqua-1.jpg||-||Love U Lots Cute Girls Swimsuit|,|Love U Lots is now offering this fabulous girls bikini. The straight top features straps that criss cross in the back made with metallic silver to match the neckline. A cute little ruffle skirts around with the same fun polka dot print. The matching silver bottoms boasts of a pink dotted skirt accented with a single silver bow. A touch of tulle ruffles out from beneath the hemline. Made with polyester blend. Hand wash cold, line dry. |,|$35.00$|,||,|LOVE-U-LOTS-CUTE-GIRLS-SWIMSUIT|,|$URL$love-u-lots-cute-girls-swimsuit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-cute-girls-swimsuit-1.jpg||-||Love U Lots Designer Cropped Denim Jacket for Girls|,|A fabulous way to compliment her new outfits, this designer vest is from Love U Lots. The vest is created in a dark wash, boasting of its true blue tone and slight distressing. Large metal buttons fasten the front and close the two flap pockets. The cropped cut accents an empire waistline perfectly. Whether it is over a dress or a designer top, this vest is sure to look darling! Cotton/Spandex Blend. Machine Wash in Cold Water. Line Dry. |,|$31.00$|,||,|LOVE-U-LOTS-DESIGNER-CROPPED-DENIM-JACKET-GIRLS|,|$URL$love-u-lots-designer-cropped-denim-jacket-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-designer-cropped-denim-jacket-for-girls-1.jpg||-||Love U Lots Designer Girls Swimsuit|,|Unique and gorgeous, this girls swimsuit was created by fabulous designer Love U Lots. The one piece suit offers a straight neckline that is framed by the wide halter strap in lime. A single large wrap rosette is found off center on the top in blue. Matching lace covers the entire body while the fun green peeks out from underneath. Also available in pink and orange, this swimsuit is one that she will want to wear all vacation long! Made with polyester blend. Hand wash cold, line dry. |,|$37.00$|,||,|LOVE-U-LOTS-DESIGNER-GIRLS-SWIMSUIT|,|$URL$love-u-lots-designer-girls-swimsuit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-designer-girls-swimsuit-1.jpg||-||Love U Lots Floral Chiffon Girls Dress with Belt|,|From designer Love U Lots, this new girls dress is a flowy delight. The sheer chiffon fabric is striped with waving floral vines from neck to hem. The peasant neckline offers the classic gathers and a single keyhole in the front. A matching green slip is provided to wear beneath. The chiffon ruffles at the hem to finish off the darling style. A brown braided belt complete with large beads and tassles accompanies the dress to tie around her waist in a bow. Made with polyblend and rayon blend fabrics. Machine wash and hang to dry. |,|$28.00$|,||,|LOVE-U-LOTS-FLORAL-CHIFFON-GIRLS-DRESS-BELT|,|$URL$love-u-lots-floral-chiffon-girls-dress-belt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-floral-chiffon-girls-dress-with-belt-32.jpg||-||Love U Lots Girls White Summer Dress|,|New from designer Love U Lots, this fabulous girls dress is sure to fill summer with a sweet scent. The white flare dress boasts of the bold floral print that runs down the center. Dark pink shoulder straps are threaded through the neckline giving it a gathered look. Pair this dress with her favorite casual shoes for every day play! Made with rayon blend. Machine wash cold, line dry. |,|$44.00$|,||,|LOVE-U-LOTS-GIRLS-WHITE-SUMMER-DRESS|,|$URL$love-u-lots-girls-white-summer-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-girls-white-summer-dress-1.jpg||-||Love U Lots Girls Bathing Suit|,|^|A darling new girls swimsuit from Love U Lots, this tankini is simply adorable. The pink bathing top features a rich pink color and a single ruffle that dances around the hemline. A garden of petal flowers is found in the center of the neckline and thin orange straps adorn the shoulders. Matching orange bottoms are paired with the top. Both hips are decorated with cute flowers that are twin to those found above. The blend of colors is perfect whether she wears it on spring break or during the summer. SIZE 5 AND 6 ONLY LEFT. ^||,|$37.00$|,||,|LOVE-U-LOTS-GIRLS-BATHING-SUIT|,|$URL$love-u-lots-girls-bathing-suit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-girls-bathing-suit-1.jpg||-||Love U Lots Girls Capri Outfit Black and White Stripe|,|A new design from Love U Lots, this designer girls summer outfit is sure to fit any occasion. The black and white stripes race across the soft fabric horizontally. The straight neckline is wrapped in sweet, colorful rosettes. Matching shoulder straps are about an inch wide. A solid pair of capri leggings are paired beneath the top in black. The outer side of both legs are accented thin bows. Made with cotton blend. Machine wash cold, line dry. |,|$39.00$|,||,|LOVE-U-LOTS-GIRLS-CAPRI-OUTFIT-BLACK-WHITE-STRIPE|,|$URL$love-u-lots-girls-capri-outfit-black-white-stripe.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-girls-capri-outfit-black-and-white-stripe-1.jpg||-||Love U Lots Girls Dolman Top and Pant in Ladybug|,|^|An irresistible creation new from Love U lots, this darling girls outfit stands far above all others. The top is cut in a dolman sleeve shape, giving a looser fit up top, batwing sleeves, and a fitted hem to flatter her shape. The front is a red orange spotted in black while the green polka dot bow found on the hemline matches the back. Her cuffs match the grey and black striped knit hem. Paired with solid black yoga pants boasting of the roll down waist and triple ruffle legs. Top: Made with acrylic blend. Machine wash cold, gentle cycle. Pants: Made with a cotton blend. Machine wash cold, line dry. 5 AND 6 AVAILABLE ONLY. ^||,|$38.50$|,||,|LOVE-U-LOTS-GIRLS-DOLMAN-TOP-PANT-LADYBUG|,|$URL$love-u-lots-girls-dolman-top-pant-ladybug.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-girls-dolman-top-and-pant-in-ladybug-2.jpg||-||Love U Lots Girls Peasant Dress with Gold Belt|,|^|Unlike any other fall dress, this new creation from Love U Lots boasts of her incredible style. The sheer brown tulle is covered with a striped floral pattern that pops out thanks to the solid brown slip that accompanies the dress. The long sleeves are also sheer while the peasant neckline is graced by a single button keyhole. A thin braided gold belt ties around her waist in a bow. A wide ruffle creates the hem. Designed with Poly blend and rayon blend fabrics. Machine washable, hang to dry. (1) SIZE 5 ONLY LEFT. ^||,|$28.00$|,||,|LOVE-U-LOTS-GIRLS-PEASANT-DRESS-GOLD-BELT|,|$URL$love-u-lots-girls-peasant-dress-gold-belt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-girls-peasant-dress-with-gold-belt-32.jpg||-||Love U Lots Girls Pink Cotton Dress with Rosettes|,|^|Designed by Love U Lots, this new girls dress is sure to be loved in spring and summer! The rich fuchsia shade is striped with a lighter pink. The empire bodice has a sleeveless neckline and three flowers placed upon the waist. The skirt opens in shape and is cut with a high low hemline. Small ruffled lines run down the front of the skirt. Made with a cotton blend. Machine wash cold, line dry. SIZE 5 ONLY AVAILABLE.  ^||,|$39.00$|,||,|LOVE-U-LOTS-GIRLS-PINK-COTTON-DRESS-ROSETTES|,|$URL$love-u-lots-girls-pink-cotton-dress-rosettes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-girls-pink-cotton-dress-with-rosettes-1.jpg||-||Love U Lots Girls Striped Dress in Fuchsia and Navy|,|Part of their darling fall collection, this new Love U Lots dress is a sweet piece she will love to show off to her friends at school! The dress is created with stripes of navy and pink. The soft fabric is perfect for the season while the straight shape allows her to wear this dress nearly anywhere! A green ribbon ties around the waist with cute ribbon bows. This dress will look darling with tights paired beneath. Cotton/Polyester Blend. Machine Wash in Cold Water. Line Dry. |,|$49.00$|,||,|LOVE-U-LOTS-GIRLS-STRIPED-DRESS-FUCHSIA-NAVY|,|$URL$love-u-lots-girls-striped-dress-fuchsia-navy.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-girls-striped-dress-in-fuchsia-and-navy-1.jpg||-||Love U Lots Girls Striped Tunic with Leggings in Cranberry|,|A new creation by Love U Lots, this fabulous set for girls comes from their fall collection. The rich colors on the tunic are found throughout the fall season and boasts of the color block trendy in creating wide stripes. Her neckline and long sleeves are covered with a thinner stripe. Cute fabric flowers are placed upon leaf appliques off centered by the neckline. Her sharkbite hem is the perfect style to pair with the sweet matching leggings that come with the top. These leggings are in cranberry and feature an elastic waistband and a ruffled hem. Acrylic/Wool Blend. Hand Wash in Cold Water. Line Dry. |,|$62.00$|,||,|LOVE-U-LOTS-GIRLS-STRIPED-TUNIC-LEGGINGS-CRANBERRY|,|$URL$love-u-lots-girls-striped-tunic-leggings-cranberry.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-girls-striped-tunic-with-leggings-in-cranberry-1.jpg||-||Love U Lots Girls Summer Skort Oufit|,|A bright new designer girls outfit, this creation from Love U Lots is simply adorable. The warm orange top features a soft cotton fabric. The neckline is trimmed with pink flowers. The black and white striped skort is paired beneath. The two front pockets are accented with swooping ruffles. |,|$29.00$|,||,|LOVE-U-LOTS-GIRLS-SUMMER-SKORT-OUFIT|,|$URL$love-u-lots-girls-summer-skort-oufit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-girls-summer-skort-oufit-1.jpg||-||Love U Lots Gold Girls Swimsuit Coverup|,|New from designer Love U Lots, this girls swimsuit cover up is just what she needs. The white coverup dress is covered with sweet polka dots. The bodice offers a wide V neckline and short sleeves. The elastic empire waist allows slight stretch. A bold gold rosette shimmers in metallic at the center of her waistline. This piece is perfect for traveling down to the pool or beach and for relaxing in between swims! |,|$19.00$|,||,|LOVE-U-LOTS-GOLD-GIRLS-SWIMSUIT-COVERUP|,|$URL$love-u-lots-gold-girls-swimsuit-coverup.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-gold-girls-swimsuit-coverup-1.jpg||-||Love U Lots Little Girls Owl Dress with Tights|,|^|Created by designer Love U Lots, this new little girls dress will quickly become her favorite. The red orange bodice is made with a soft ribbed knit and features long sleeves and a large owl applique resting on the front. The fun skirt is made with layers of ruffled plaid coordinating perfectly to compliment the orange. Accompanied by matching brown tights with colored polka dots. Made with polyester blend and 100% cotton, hand wash with care. SIZE 4 ONLY LEFT.  ^||,|$36.50$|,||,|LOVE-U-LOTS-LITTLE-GIRLS-OWL-DRESS-TIGHTS|,|$URL$love-u-lots-little-girls-owl-dress-tights.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-little-girls-owl-dress-with-tights-11.jpg||-||Love U Lots Neon Pink Girls Bathing Suit|,|Filled with warm sunshine, this one piece swimsuit is sure to make many of her summer memories last. The cool orange is found on the wide halter tie and the trimming. Her straight neckline is accented with a single pink rosette created with a spiral ruffle. The orange body of the suit is covered with a pink overlay of floral lace. The lace adds an elegant touch and truly makes this suit one of a kind! Made with polyester blend. Hand wash cold, line dry. |,|$37.00$|,||,|LOVE-U-LOTS-NEON-PINK-GIRLS-BATHING-SUIT|,|$URL$love-u-lots-neon-pink-girls-bathing-suit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-neon-pink-girls-bathing-suit-2.jpg||-||Love U Lots One Shoulder Girls Swimsuit|,|Prepared for some real summer fun, this new designer bathing suit was designed by Love U Lots. The one piece suit is in a deep pink shade that mimics the new roses that blossom in summer. The single shoulder neckline is accented with a row of rosettes in red pink and orange. A thin strap is found on her left shoulder to keep the suit securely in place. This bathing suit is sure to stand out from the crowd whether she is at the beach or playing in the pool. |,|$37.00$|,||,|LOVE-U-LOTS-ONE-SHOULDER-GIRLS-SWIMSUIT|,|$URL$love-u-lots-one-shoulder-girls-swimsuit.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-one-shoulder-girls-swimsuit-12.jpg||-||Love U Lots Pretty Girls Swimsuit Fuchsia|,|Matching a new bikini from Love U Lots, this one piece swimsuit for girls offers a touch of glitz. The fuchsia suit boasts of a one shoulder neckline with two ruffles that wrap around to accent. A thin silver strap sits upon her left shoulder. The pink coordinates beautifully with the bright metallic silver polka dots that spot the body. With its fun-filled style, this new swimsuit is sure to become a quick favorite. |,|$35.00$|,||,|LOVE-U-LOTS-PRETTY-GIRLS-SWIMSUIT-FUCHSIA|,|$URL$love-u-lots-pretty-girls-swimsuit-fuchsia.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-pretty-girls-swimsuit-fuchsia-1.jpg||-||Love U Lots Sangria Ruffle Heart Set|,|^|New from trendy girls designer Love U Lots, this sangria ruffle heart tee, skirt, and leggings set is adorable. She'll love the bright long sleeve tee with its ruffle hem and cuffs, along with the large ruffle heart in the center that is decorated with assorted rosettes. Finishing off this stylish outfit, the swingy multi-colored striped skirt with ruffled hem and indigo stitching detail is beautiful over the adorable denim knit ruffle yoga pants. Knit from a poly blend, the blue denim knit pants have a curved ruffled hem with a higher ankle and soft pink cotton rosettes with green leaves details on each ankle. The perfect addition to any fall wardrobe, she'll stay comfy and cute in this cotton/spandex blend outfit. Machine wash, line dry. (1) 4T ONLY LEFT.  ^||,|$44.50$|,||,|LOVE-U-LOTS-SANGRIA-RUFFLE-HEART-SET|,|$URL$love-u-lots-sangria-ruffle-heart-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-sangria-ruffle-heart-set-11.jpg||-||Love U Lots Swimsuit Coverup in Tropical Print|,|Ready for any spring or summer vacation, this new girls swimsuit coverup is part of the Love U Lots collection. The fabulous tropical print is a classic choice in pattern while mixing pink, orange, and green effortlessly. With a relaxed, comfortable fit, the top offers short sleeves and a unique, keyhole neckline. Small pink pom poms outline the shape of the neck. |,|$29.00$|,||,|LOVE-U-LOTS-SWIMSUIT-COVERUP-TROPICAL-PRINT|,|$URL$love-u-lots-swimsuit-coverup-tropical-print.html|,|http://ep.yimg.com/ay/yhst-17102259411242/love-u-lots-swimsuit-coverup-in-tropical-print-7.jpg||-||Luna Luna Chocolate Girls Chippie Top and Skirt|,|^|In a rich milk chocolate color, this new casual sweatshirt outfit for girls comes from Luna Luna Copenhagen. The skirt is trimmed with cute faux fur while attached leggings keep her legs warm. The soft matching sweatshirt boasts only of its satin lined hood hemmed with the same faux fur. Cotton and poly blend, machine washable. SIZE 5/6 LEFT. ^||,|$49.00$|,||,|LUNA-LUNA-CHOCOLATE-GIRLS-CHIPPIE-TOP-SKIRT|,|$URL$luna-luna-chocolate-girls-chippie-top-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/luna-luna-chocolate-girls-chippie-top-and-skirt-14.jpg||-||Luna Luna Copenhagen Coral Sailor Hoodie Short Set|,|^|Another fabulous lounge set by designer Luna Luna Copenhagen. This terry cotton top has a relaxed feel with long sleeves and a hood with striped lining. The set would not be complete without the adorable sailor-style shorts with matching striped lining and belt. Cotton/polyester blend. Machine wash warm, tumble dry low. SIZE 5/6 ONLY LEFT.  ^||,|$39.00$|,||,|LUNA-LUNA-COPENHAGEN-CORAL-SAILOR-SHORT-SET|,|$URL$luna-luna-copenhagen-coral-sailor-short-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/luna-luna-copenhagen-coral-sailor-hoodie-short-set-14.jpg||-||Luna Luna Copenhagen Halle Lavender Lounge Set|,|She will love this fabulous lounge set from Luna Luna Copenhagen for its comfort and style. The lavender top boasts of ruffled sleeves and a sequined pocket on the front. A high low ruffled hemline gives it a trendy style. The top is also lined in lavender. The matching pants feature a ruffled skirt in lavender at the top. A drawstring on the right side ties off into a small bow. The fabric is soft and stretchy. Made from rayon/spandex. Hand wash cold, line dry. |,|$29.00$|,||,|LUNA-LUNA-COPENHAGEN-HALLE-LAVENDER-LOUNGE-SET|,|$URL$luna-luna-copenhagen-halle-lavender-lounge-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/luna-luna-copenhagen-halle-lavender-lounge-set-14.jpg||-||Luna Luna Girls Dress White Seaurchin|,|^|As dreamy as a cloud, this new seaurchin dress from designer Luna Luna is perfect for a birthday celebration. The dress features a metallic silver ruched neckline with adjustable straps that criss cross in the back. The back offers an easy stretch fit while the skirt is covered with several layers of white tulle and spotted with tulle circle flowers. The gown finishes off with a small ruffle peaking from the hem, and is fully lined. Made with polyester, hand wash. SIZE 2T ONLY LEFT. ^||,|$58.00$|,||,|LUNA-LUNA-GIRLS-EASTER-DRESS-WHITE|,|$URL$luna-luna-girls-easter-dress-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/luna-luna-girls-dress-white-seaurchin-11.jpg||-||Luna Luna Pierette Tween Girls Sweater Set|,|^|A comfy new outfit with plenty of style, this tween girls sweater set from designer Luna Luna is adorable. The cardigan top features a black stripe pattern, long sleeves, and jeweled snaps running up the front. Slight gathering is found from the center while the matching shorts feature a pleated skirt overlay. Top is fully lined, both made with rayon blend, machine washable. (1) SIZE 8 AND SIZE 14 AVAILABLE. ^||,|$39.00$|,||,|LUNA-LUNA-PIERETTE-TWEEN-GIRLS-SWEATER-SET|,|$URL$luna-luna-pierette-tween-girls-sweater-set.html|,|http://ep.yimg.com/ay/yhst-17102259411242/luna-luna-pierette-tween-girls-sweater-set-11.jpg||-||Luna Luna Teaberry Girls Hat and Scarf in Stripes|,|^|New from Luna Luna Copenhagen, this new hat and scarf set helps her keep away the chilly air in style. The striped hat features a perfect mixture between a berry burgundy and vintage rose pink alternating stripes while a small puff of faux fur sits just above the hem. The hat fits in a slouched fashion while the matching scarf is made with the same soft light knit. Hand wash if needed. LARGE (4-6X) ONLY LEFT.  ^||,|$17.00$|,||,|LUNA-LUNA-TEABERRY-GIRLS-HAT-SCARF-STRIPES|,|$URL$luna-luna-teaberry-girls-hat-scarf-stripes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/luna-luna-teaberry-girls-hat-and-scarf-in-stripes-11.jpg||-||Luv U Lots Blush Pink Girls Flower Dress|,|^|Your blushing girl will fall in love with this blush pink girls flower dress from Luv U Lots. It is too gorgeous and perfect for twirling! The sleeveless bodice in blush pink sits above an empire waist blooming with brightly colored flowers of blue, orange, and green. Ruffles of green run between the flowers. The full skirt is done in horizontal panels of blush pink with purled edges. The same purl edging can be found along the hemline. Made of cotton/spandex. Machine wash cold, line dry. ALL SOLD OUT 5/24/14.  ^||,|$34.00$|,||,|LUV-U-LOTS-BLUSH-PINK-GIRLS-FLOWER-DRESS|,|$URL$luv-u-lots-blush-pink-girls-flower-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/luv-u-lots-blush-pink-girls-flower-dress-14.jpg||-||Luv U Lots Girls Coral Seersucker Bikini|,|From designer Luv U Lots, this girls bikini is right in style. The seersucker fabric in coral minicheck is just divine. The halter style top ties at the neck. A coral rosette adorns the front along with two leaves of green. The matching bottoms repeat the coral seersucker fabric. The suit is lined. Made from polyester/lycra/nylon. Hand wash cold, line dry. |,|$19.00$|,||,|LUV-U-LOTS-GIRLS-CORAL-SEERSUCKER-BIKINI|,|$URL$luv-u-lots-girls-coral-seersucker-bikini.html|,|http://ep.yimg.com/ay/yhst-17102259411242/luv-u-lots-girls-coral-seersucker-bikini-13.jpg||-||Mack & Co Little Girls Blue Fleece Coat|,|^|So cute! This new little girls coat comes from designer Crivelli Mack. The soft blue fleece dresses her as the ice princess she is while a cute ruffle runs around the neck. The three buttons on the bodice are hidden with a soft grey ruffle that matches both cuffs. Tucking on the bodice provides a structured shape. The skirt falls in a high low hemline boasting of the vintage inspiration that fills its ruffled back. Made in the USA. 100% polyester. Machine wash and tumble dry. SIZE 18 MOS AND 24 MOS ONLY LEFT.  ^||,|$44.00$|,||,|MACK-CO-LITTLE-GIRLS-BLUE-FLEECE-COAT|,|$URL$mack-co-little-girls-blue-fleece-coat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mack-co-little-girls-blue-fleece-coat-1.jpg||-||Mack and Co Fancy Girls Fleece Coat Ivory Bow|,|^|A sweet new design by Mack and Co, this fabulous girls winter coat is a darling look! The coat is made with a soft, warm black fleece. The neck is wrapped with a ruffle collar that drapes down the front and is dressed with a single, large ivory bow with a decoration placed on the center. The bell ruffle cuffs mimic the look of her hemline and the pin tucks on the back create the shape. Buttons are fastened in the front of this coat and a matching hat is available while quantities last. This hat is found on the Mack and Co page named ""Mack and Co Girls Fancy Winter Hat Ivory Bow."" 100% Polyester. Machine wash lukewarm. Dry on low. ^||,|$62.00$|,||,|MACK-CO-FANCY-GIRLS-FLEECE-COAT-IVORY-BOW|,|$URL$mack-co-fancy-girls-fleece-coat-ivory-bow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mack-and-co-fancy-girls-fleece-coat-ivory-bow-17.jpg||-||Mack and Co Girls Fancy Winter Hat Ivory Bow|,|^|Designed to be the perfect match to one of their new winter coats, this Mack and Co hat for girls is a cute design. The soft fleece is a jet black while styled with three rows of whirling ruffles to match the hem. The fitted cut of the hat is a comfy fit that will help keep her warm on those chilly fall and winter days. The front of the hat is dressed with a large ivory bow decorated with a single button at the center. Pair this hat with the ""Mack and Co Fancy Girls Fleece Coat Ivory Bow."" SIZE 4-6X ONLY LEFT.  ^||,|$29.00$|,||,|MACK-CO-GIRLS-FANCY-WINTER-HAT-IVORY-BOW|,|$URL$mack-co-girls-fancy-winter-hat-ivory-bow.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mack-and-co-girls-fancy-winter-hat-ivory-bow-1.jpg||-||Mack and Co Girls Fleece Ruffle Coat Classy Charcoal|,|^|A new creation by designer Mack and Co, this fabulous girls winter coat is a part of their new winter 2014 line and is named as the ""pearl fleece ruffle."" The charcoal grey shade is textured with raw fiber while her wide sleeves are finished with a dancing bell ruffle. A whimsical edge is found on her collar and at the hemline. A row of buttons fall down the front hedged by ruffles on both sides. These ruffles have pearl bead accents found among their folds. The top of the coat has a more fitted look that relaxed at the waist. 100% Polyester. Machine Wash in Cold Water on Gently Cycle. Tumble Dry Low. ^||,|$69.00$|,||,|MACK-CO-GIRLS-FLEECE-RUFFLE-COAT-CLASSY-CHARCOAL|,|$URL$mack-co-girls-fleece-ruffle-coat-classy-charcoal.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mack-and-co-girls-fleece-ruffle-coat-classy-charcoal-1.jpg||-||Mack and Co Girls Winter Hat Polka Dot Fun|,|^|Matching her fabulous new Mack and Co winter coat, this fleece girls hat is a must have. The soft black fabric is covered with large white polka dots. Several ruffles wrap around the hat for a darling detail. The large bow placed upon the front brings a pop of pink to the look. This hat is the perfect match to the new ""Mack and Co Winter Coat for Little Girls Polka Dot Pink."" SIZE 2T-4T ONLY LEFT.  ^||,|$29.00$|,||,|MACK-CO-GIRLS-WINTER-HAT-POLKA-DOT-FUN|,|$URL$mack-co-girls-winter-hat-polka-dot-fun.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mack-and-co-girls-winter-hat-polka-dot-fun-1.jpg||-||Mack and Co Girls Winter Hat Ruffle Charcoal|,|^|Mack and Co is now offering this winter hat for girls to match their fabulous ""pearl fleece ruffle"" coat. The hat fits her head with the soft fleece and helps to keep her warm. Cute ruffles stripe around the hat for added style. A large ivory lace flower is set upon the at to create the perfect finishing detail. As with all Mack and Co creations, this hat is boutique quality and is certain to receive many compliments! 100% Polyester. Machine Wash in Cold Water on Gently Cycle. Tumble Dry Low. ^||,|$29.00$|,||,|MACK-CO-GIRLS-WINTER-HAT-RUFFLE-CHARCOAL|,|$URL$mack-co-girls-winter-hat-ruffle-charcoal.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mack-and-co-girls-winter-hat-ruffle-charcoal-1.jpg||-||Mack and Co Girls Winter Ruffle Fleece Hat|,|^|Created to match her fabulous new fleece coat from Mack and Co, this darling winter hat is a gorgeous accessory. The fleece is soft and keeps her warm while the light blue shade is an elegant look for the season. Small ruffles run around the hat while a large fabric rosette sits upon one side of her head. The sheer ivory fabric that creates this bloom matches perfectly to the ruffles that are found on the ""Mack and Co Ruffle Fleece Coat for Girls in Blue."" ^||,|$29.00$|,||,|MACK-CO-GIRLS-WINTER-RUFFLE-FLEECE-HAT|,|$URL$mack-co-girls-winter-ruffle-fleece-hat.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mack-and-co-girls-winter-ruffle-fleece-hat-1.jpg||-||Mack and Co Little Girls Winter Coat in Bubble Hem|,|New from Mack and Co, this designer winter coat for girls is a gorgeous piece she will adore wearing all winter long. The light pink faux fur is covered with a rose print. Large, sparkly buttons run in a line on the front of the coat and fasten for a warm fit. A large ruffle in leopard print creates the luxurious collar. The swing fit of this coat ruffles out from the empire waist and is finished with a fun bubble hemline. 100% Polyester. Machine wash lukewarm. Dry on low. |,|$64.00$|,||,|MACK-CO-LITTLE-GIRLS-WINTER-COAT-BUBBLE-HEM|,|$URL$mack-co-little-girls-winter-coat-bubble-hem.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mack-and-co-little-girls-winter-coat-in-bubble-hem-1.jpg||-||Mack and Co Polka Dot Puffer Coat for Girls|,|Part of their new 2014 creations, this fabulous little girls winter coat is dotted with fun! The black coat is covered with large white polka dots. The cozy fit is finished with a bubble hemline. A large hood is wrapped with a ruffle trim that falls down the front of the coat. This coat is lined with a soft fleece in bold pink. 100% Polyester. Machine Wash in Cold Water on Gently Cycle. Tumble Dry Low. |,|$86.00$|,||,|MACK-CO-POLKA-DOT-PUFFER-COAT-GIRLS|,|$URL$mack-co-polka-dot-puffer-coat-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mack-and-co-polka-dot-puffer-coat-for-girls-1.jpg||-||Mack and Co Ruffle Fleece Coat for Girls in Blue|,|In a gorgeous tiffany blue, this new designer coat for girls is from Mack and Co. The coat features two rows of double ruffles that frame the large buttons that fall down the front of this coat. Pearl beads are found accenting these ruffles. The hemline and the collar are finished with a twisting ruffle while her sleeves have ruffle bells. The fit relaxes at her waist, allowing the fabric to move freely with her steps. 100% Polyester. Machine wash lukewarm. Dry on low. |,|$66.00$|,||,|MACK-CO-RUFFLE-FLEECE-COAT-GIRLS-BLUE|,|$URL$mack-co-ruffle-fleece-coat-girls-blue.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mack-and-co-ruffle-fleece-coat-for-girls-in-blue-17.jpg||-||Mack and Co Winter Coat for Little Girls Polka Dot Pink|,|An adorable design, this new polka dot winter coat for girls comes from Mack and Co. The black fleece is covered with a large, white polka dot print. A wide ruffle creates a collar and falls gracefully upon the front. A cute pink fleece bow is found decorating the design and complimenting the large pink buttons that her fingers fasten up the front. The ruffled hemline is accented by the bell ruffle cuffs on both sleeves. 100% Polyester. Machine wash lukewarm. Dry on low. |,|$58.00$|,||,|MACK-CO-WINTER-COAT-LITTLE-GIRLS-POLKA-DOT-PINK|,|$URL$mack-co-winter-coat-little-girls-polka-dot-pink.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mack-and-co-winter-coat-for-little-girls-polka-dot-pink-1.jpg||-||Made to Match Black Rosettes and Lace Headband|,|A perfect compliment to her designer holiday gown, this new handmade girls headband is just splendid! The sweet ivory lace band stretches to fit on her head and boasts of its floral design. A trio of flowers sits off centered on her head. The largest flower is made with layered black lace and silky satin while a two tone rosette is created with ivory tulle and black chiffon to match the small flower caught in the middle. Made to match Biscotti Standing Ovation and Cach Cach Bowtique Dresses and Outfits. |,|$21.75$|,||,|GIRLS-HOLIDAY-HEADBAND-LACE-ROSETTES|,|$URL$girls-holiday-headband-lace-rosettes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/made-to-match-black-rosettes-and-lace-headband-12.jpg||-||Made to Match Giggle Moon Happy and Joyful Girls Headband|,|^|Sure to be the highlight of her outfits, this new headband was handmade specifically to match the new Giggle Moon collection ""Happy and Joyful."" The black lace band stretches to fit around her head while a fan of printed petals add a unique shape. Three unique flowers are grouped together created with a satin pink, heat trimmed edges, and a sparkling black fabric that is soft to the touch. MEDIUM (2T-4T) ONLY.  ^||,|$27.00$|,||,|MADE-TO-MATCH-GIGGLE-MOON-HAPPY-JOYFUL-GIRLS-HEADBAND|,|$URL$made-to-match-giggle-moon-happy-joyful-girls-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/made-to-match-giggle-moon-happy-and-joyful-girls-headband-3.jpg||-||Made to Match Harvest Party Girls Headband|,|^|In a trendy oversized fashion, this new girls hair piece is designed to compliment her new Giggle Moon outfits! Made with colors to match the ""Harvest Party"" collection, this fabulous flower headband is made from a stretch lace that fits around her head. The large green and brown flower features a soft ivory center and two orange flowers sitting beside it. The blend of texture makes this piece truly artful! SIZE LARGE (4-ADULT) ONLY LEFT.  ^||,|$14.00$|,||,|MADE-MATCH-HARVEST-PARTY-GIRLS-HEADBAND|,|$URL$made-match-harvest-party-girls-headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/made-to-match-harvest-party-girls-headband-1.jpg||-||Mae Li Rose Fancy Pink Sweater for Girls|,|^|A sweet design from lovely Mae Li Rose, this new girls sweater is an adorable that will receive compliments every time she wears it. The light pink fabric is a little heavier to help provide warmth during the cooler months while her long sleeves are finished with a ribbed knit cuff. Her hood is trimmed with a crochet lace ribbon while the word ""Love"" is spelled out with daisy appliques. The front pocket is finished with a single, ivory chiffon bow. The sweatshirt is dressed up with a fancy hemline layered in ivory tulle and eyelet fabric! 100% cotton, machine wash and hang to dry. ^||,|$29.00$|,||,|MAE-LI-ROSE-FANCY-PINK-SWEATER-GIRLS|,|$URL$mae-li-rose-fancy-pink-sweater-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mae-li-rose-fancy-pink-sweater-for-girls-1.jpg||-||Mae Li Rose Frilly Sweater and Leggings for Girls Love|,|^|Created by Mae Li Rose, this new girls outfit is a part of their darling fall line. The grey sweatshirt has a comfortable hood with a crochet lace ribbon trim. The word ""Love"" is written upon the front with flower appliques. A cute bow sits upon the joey pocket. The hem is dressed with a sheer ruffle and a cute addition of eyelet fabric. Beneath the sweater we find matching grey leggings. A touch of lace and a sheer bow is found on both legs. Top: 100% Cotton. Machine Wash Cold, Inside Out. Hang Dry. Pants: Cotton/Spandex Blend. Machine Wash, Inside Out in Cold Water. Hang Dry. ^||,|$47.00$|,||,|MAE-LI-ROSE-FRILLY-SWEATER-LEGGINGS-GIRLS-LOVE|,|$URL$mae-li-rose-frilly-sweater-leggings-girls-love.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mae-li-rose-frilly-sweater-and-leggings-for-girls-love-1.jpg||-||Mae Li Rose Girls Ivory Leggings with Flowers|,|A cute touch beneath her new skirts or dresses, these elegant girls leggings come from Mae Li Rose. The fabric is created with a soft stretch that hugs her skin. The waist also offers stretch with the elastic band. The hem of both legs is dressed with a quaint crochet ruffle finished with a glitter edge. A single leg is decorated with a cute floral design just above the hem, layered with glitter tulle and finished with a gleaming center. Cotton/Spandex Blend. Machine wash inside out in cold water. Hang Dry. |,|$15.00$|,||,|MAE-LI-ROSE-GIRLS-IVORY-LEGGINGS-FLOWERS|,|$URL$mae-li-rose-girls-ivory-leggings-flowers.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mae-li-rose-girls-ivory-leggings-with-flowers-17.jpg||-||Mae Li Rose Girls Ivory Long Sleeve Top Holiday Lace|,|Mae Li Rose is now offering this fabulous long sleeve top has a part of their fall and winter collection. The soft ivory shade makes it a simple task to pair with a skirt or pants for a fabulously darling outfit. A sheer ruffle wraps around the neckline finished with a scallop edge and textured with an ivory dot pattern. Matching ruffles fall down the front dresses with silver beads and a dusty rose ribbon bow. Two buttons fasten on the back. A final touch of lacey accent is found on both cuffs. Cotton/Spandex Blend. Wash in Cold Water. Inside Out. Hang Dry. |,|$28.00$|,||,|MAE-LI-ROSE-GIRLS-IVORY-LONG-SLEEVE-TOP-HOLIDAY-LACE|,|$URL$mae-li-rose-girls-ivory-long-sleeve-top-holiday-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mae-li-rose-girls-ivory-long-sleeve-top-holiday-lace-1.jpg||-||Mae Li Rose Girls Pink Legging with Bows|,|Designed by Mae Li Rose, these new girls leggings are simply cute! The pink cotton fabric has a slightly peachy tone to its hue, a perfect compliment to many skin types. Both knees are dressed with a crochet butterfly applique. Two bows flutter by the wings to complete the decoration. The leggings are long and are made with a fabric that allows stretch. Pair these leggings with the Mae Li Rose Fancy Pink Sweater for Girls! Fabric: 95% cotton, 5 % spandex. Machine wash and hang to dry. |,|$13.00$|,||,|MAE-LI-ROSE-GIRLS-PINK-LEGGING-BOWS|,|$URL$mae-li-rose-girls-pink-legging-bows.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mae-li-rose-girls-pink-legging-with-bows-1.jpg||-||Mae Li Rose Lace Dress in Ivory|,|Absolutely gorgeous, this new Mae Li Rose dress is a real dream. The soft ivory shade is easy to wear at any occasion while the sleeveless cut allows it to carry through the seasons with ease. The bodice is covered with a crochet lace overlay in the same neutral shade. A large tulle bow is found on her back to match the full skirt. The layers of soft tulle build the volume of the skirt and give it a great tutu feel. |,|$42.00$|,||,|MAE-LI-ROSE-LACE-DRESS-IVORY|,|$URL$mae-li-rose-lace-dress-ivory.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mae-li-rose-lace-dress-in-ivory-1.jpg||-||Mae Li Rose Leggings for Girls Scalloped Lace|,|New from Mae Li Rose, these fabulous girls leggings look great beneath her fancy skirts and dresses. The ivory leggings have a great stretch that is comfortable to wear. The waist also stretches with the elastic band. The bottom of both legs are finished with a fancy hemline. The layers of textured tulle fall down into a scallop hemline and decorated with silver beads. A single quaint bow is placed at the top of the hem. Cotton/Spandex Blend. Machine Wash Inside Out. Cold Water. Hang Dry. |,|$18.00$|,||,|MAE-LI-ROSE-LEGGINGS-GIRLS-SCALLOPED-LACE|,|$URL$mae-li-rose-leggings-girls-scalloped-lace.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mae-li-rose-leggings-for-girls-scalloped-lace-17.jpg||-||Mae Li Rose Mint Green Girls Dress|,|Gorgeous from neckline to hem, this new designer toddler dress was created with care by Mae Li Rose. The gown is created from a trendy color for spring and summer. The bodice features a lacey overlay and a sleeveless neckline. The large tulle bow found on the back is a perfect detail! The skirt is a fun flirty blend of layers of sugar sweet tulle finished with an uneven hemline. She can wear this dress to weddings, birthdays, dance recitals, and more! |,|$42.00$|,||,|MAE-LI-ROSE-MINT-GREEN-GIRLS-DRESS|,|$URL$mae-li-rose-mint-green-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mae-li-rose-mint-green-girls-dress-1.jpg||-||Mae Li Rose Peach Dress with Shoulder Ties|,|Mae Li Rose is now offering this gorgeous designer party dress for girls as a part of their spring and summer collection. The peachy pink fabric resembles the beauty of new blooms while the unique style is sure to be loved by all! The sleeveless bodice completed with girly tulle ties placed upon both shoulders while the fabric gathers at the waistline. The skirt of the dress is covered with swirling rosettes that produce great texture and interest.The gown is finished with a fun bubble hemline. |,|$42.00$|,||,|MAE-LI-ROSE-PEACH-DRESS-SHOULDER-TIES|,|$URL$mae-li-rose-peach-dress-shoulder-ties.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mae-li-rose-peach-dress-with-shoulder-ties-17.jpg||-||Mae Li Rose Pink Leggings for Infants|,|Created to match her wonderful new hoodie, this infant girl leggings come from designer Mae Li Rose. These leggings feature a soft rose pink shade that creates the perfect match. The soft fabric is delicate on her skin while the waist is a comfortable elastic stretch. The knees are dressed with darling white hearts. The hem of both legs are finished with a matching white ruffle. |,|$14.00$|,||,|MAE-LI-ROSE-PINK-LEGGINGS-INFANTS|,|$URL$mae-li-rose-pink-leggings-infants.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mae-li-rose-pink-leggings-for-infants-1.jpg||-||Mae Li Rose Pink Party Dress|,|^|From designer Mae Li Rose, this new fabulous little girls dress is a real gem. The sleeveless bodice is covered with an ivory crochet overlay that brings a beautifully feminine touch. The back is adorned by a large, pink tulle bow. The skirt gains volume from the layers of soft pink tulle that fall to an uneven hemline. This gown is perfect for any spring or summer occasion and would look positively radiant on flower girl! The skirt is lined with a matching light pink. SIZE 5 ONLY LEFT. ^||,|$42.00$|,||,|MAE-LI-ROSE-PINK-PARTY-DRESS|,|$URL$mae-li-rose-pink-party-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mae-li-rose-pink-party-dress-17.jpg||-||Maria Casero Chevron Stripe Girls Dress|,|A trendy new piece from designer Maria Casero, this girls dress is available in sizes 4 to 6X. The messina knit fabric is designed with a chevron or zig zag stripe including colors like yellow, pink, black, and green. The cut is a relaxed fit and the half sleeves are finished with a double bell. 100% polyester. Hand wash cold, hang to dry. |,|$49.00$|,||,|MARIA-CASERO-CHEVRON-STRIPE-GIRLS-DRESS|,|$URL$maria-casero-chevron-stripe-girls-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/maria-casero-chevron-stripe-girls-dress-2.jpg||-||Maria Casero Tween Grey Sequin Dress|,|Soft and comfortable enough for all day wear, this new tween dress comes from Maria Casero. The grey knit is cut for a straight shape dress that allows slight stretch. Silver sequins cover both of her shoulders and cap sleeves. A matching sparkle line falls down the center of the front. 100% polyester. Dry clean only. |,|$49.00$|,||,|MARIA-CASERO-TWEEN-GREY-SEQUIN-DRESS|,|$URL$maria-casero-tween-grey-sequin-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/maria-casero-tween-grey-sequin-dress-2.jpg||-||Meg Dana Cream Flower Clip - Girls Hair Clip|,|Classic and extremely chic, she'll adore this cream flower hair clip. The color is saturated in the center, fading to a lighter cream on the outer petals. The center of this beautiful three and a half inch flower is decorated with silver and white rhinestones. Simple satin covered alligator clip. |,|$15.00$|,||,|MEG-DANA-CREAM-FLOWER-CLIP-GIRLS-HAIR-CLIP|,|$URL$meg-dana-cream-flower-clip-girls-hair-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/meg-dana-cream-flower-clip-girls-hair-clip-10.jpg||-||Meg Dana Dazzle Coral Hairclip|,|About 2 inches across, this feminine girls hair clip features a pretty coral rose with shiny rhinestones. By Meg Dana. |,|$14.00$|,||,|MEG-DANA-DAZZLE-CORAL-HAIRCLIP|,|$URL$meg-dana-dazzle-coral-hairclip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/meg-dana-dazzle-coral-hairclip-6.jpg||-||Meg Dana Green Headband with Yellow Flowers|,|Yellow flowers and a green headband by Meg Dana. |,|$21.00$|,||,|MEG-DANA-GREEN-HEADBAND-YELLOW-FLOWER|,|$URL$meg-dana-green-headband-yellow-flower.html|,|http://ep.yimg.com/ay/yhst-17102259411242/meg-dana-green-headband-with-yellow-flowers-10.jpg||-||Meg Dana Purple Flower Clip - Girls Hair Clip|,|She'll love this brilliant purple flower hair clip, new from Meg Dana. The three and a half inch stunning purple flower features a cluster of purple rhinestones at the center, adding sparkle to this beautiful clip. Simple satin covered alligator clip. |,|$15.00$|,||,|MEG-DANA-PURPLE-FLOWER-CLIP-GIRLS-HAIR-CLIP|,|$URL$meg-dana-purple-flower-clip-girls-hair-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/meg-dana-purple-flower-clip-girls-hair-clip-10.jpg||-||Meg Dana Red Hair Clip with Feather|,|A V style hairclip is adorned with a stunning red feather by Meg Dana. About 4 inches long, 3 red rhinestones add shimmer. |,|$11.00$|,||,|MEG-DANA-RED-FEATHER-CLIP|,|$URL$meg-dana-red-feather-clip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/meg-dana-red-hair-clip-with-feather-10.jpg||-||Meg Dana Silver Satin Bow with Rhinestones Headband|,|Covered with silver satin, this girls headband has a bow at one side. Rhinestones add pretty shimmer. By Meg Dana. |,|$22.13$|,||,|MEG-DANA-SILVER-BOW--HEADBAND|,|$URL$meg-dana-silver-bow--headband.html|,|http://ep.yimg.com/ay/yhst-17102259411242/meg-dana-silver-satin-bow-with-rhinestones-headband-11.jpg||-||Meg Dana Yellow Rose Hairclip|,|A single yellow rose is embellished with rhinestones in this pretty girls hairclip by Meg Dana. About 1.5 inches across. |,|$14.00$|,||,|YELLOW-ROSE-HAIRCLIP|,|$URL$yellow-rose-hairclip.html|,|http://ep.yimg.com/ay/yhst-17102259411242/meg-dana-yellow-rose-hairclip-7.jpg||-||Mim Pi Baby Girls Star Top with Fringe Skirt|,|Matching her older sisters new outfits from Mim Pi, this baby set is too cute! The blue top offers her long sleeves finished with a scallop trim to match the neckline. The front of the top boasts of a sequin star made with all colors and sizes. Paired with a fitted skirt that boasts of a pull on fit waist. The tiers of fringe mix beautiful colors together while the fringe is sure to dance with her movement. Made from cotton/lycra, machine washable. |,|$39.00$|,||,|MIM-PI-BABY-GIRLS-STAR-TOP-FRINGE-SKIRT|,|$URL$mim-pi-baby-girls-star-top-fringe-skirt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-baby-girls-star-top-with-fringe-skirt-2.jpg||-||Mim Pi Baby Girls Striped Tights|,|To go with her new top and fringe skirt set, these infant tights are unbeatable from Mim Pi. The grey tights boast of the blue stripes that are interrupted with bright colored stripes half way to her knee. Another punch of color is received on both the toe and the heel of both feet. Made from a cotton blend. Machine wash warm, do not tumble dry. |,|$12.60$|,||,|MIM-PI-BABY-GIRLS-STRIPED-TIGHTS|,|$URL$mim-pi-baby-girls-striped-tights.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-baby-girls-striped-tights-2.jpg||-||Mim Pi Back to School Dress Speckled Blue|,|^|Filled with a creative new look that is fun and delightful, this girls dress is proud to accompany her on school days. From Mim Pi, this dress features a bodice with loose fit sleeves that have a faux long sleeve layer beneath in bright pink. The neckline is accented with two tassels and dainty pink scallop trimmings. A pink tie becomes a bow around her waist, giving shape to the dress. The same speckled blue fabric continues down the skirt to the pink hem. Made from cotton/lycra. Machine washable. SIZE 4 ONLY LEFT. ^||,|$38.40$|,||,|MIM-PI-BACK-SCHOOL-DRESS-SPECKLED-BLUE|,|$URL$mim-pi-back-school-dress-speckled-blue.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-back-to-school-dress-speckled-blue-2.jpg||-||Mim Pi Blue and White Flower Socks|,|^|From European designer Mim Pi, these blue and white flower socks will tickle her fancy. The petite flower design is done in white with a red center over a blue background. These knee high socks will be so cute with her favorite dress, skirt or shorts. Made from a cotton blend. Machine wash warm, do not tumble dry. SIZE 8-10 ONLY LEFT.  ^||,|$6.00$|,||,|MIM-PI-BLUE-WHITE-FLOWER-SOCKS|,|$URL$mim-pi-blue-white-flower-socks.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-blue-and-white-flower-socks-13.jpg||-||Mim Pi Blue Gingham Girls School Dress|,|^|Filled with the fun and lively styles we can always count on from designer girls clothing brand Mim Pi, this new dress is perfect for all her planned fun this fall. The long sleeve dress features a bright colorful yoke with a zipper in the center. The collar and cuffs help define the style while a pink fabric bow is tied around her waist. The blue and white gingham print covers the entire piece. Made from cotton/lycra. Machine washable. SIZE 4 ONLY LEFT.  ^||,|$45.00$|,||,|MIM-PI-BLUE-GINGHAM-GIRLS-SCHOOL-DRESS|,|$URL$mim-pi-blue-gingham-girls-school-dress.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-blue-gingham-girls-school-dress-2.jpg||-||Mim Pi Blue Girls Shirt with Fashionista|,|^|From designer Mim Pi, this new girls top will be the talk of all her friends. The blue faux shorts sleeves features long sleeves in a solid grey. The pink trimming found around the neckline is also seen on the sleeves. The front of the shirt is graced by a doll-like print of a fashionable girl. Not only do we find embellishments on her outfit, but also on her extravagant hair, made mostly of fun sequins. Made from cotton/lycra, machine washable. (1) 4 ONLY LEFT. ^||,|$26.40$|,||,|MIM-PI-BLUE-GIRLS-SHIRT-FASHIONISTA|,|$URL$mim-pi-blue-girls-shirt-fashionista.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-blue-girls-shirt-with-fashionista-2.jpg||-||Mim Pi Blue Romper for Girls with Belt|,|Unlike any other piece in her closet, this new girls romper is prepared for every kind of fun that she has planned this summer. From the center of the neckline we find a trio of features dangling on the bodice, accented with stitching and sequins. The thin shoulder straps are found on her shoulders while the waist is tied with a thin braided belt. The bottom of the romper continues in the light blue fabric. This piece is a killer outfit all on its own! 95% cotton 5% lycra. Wash inside out with similar colors. |,|$48.00$|,||,|MIM-PI-BLUE-ROMPER-GIRLS-BELT|,|$URL$mim-pi-blue-romper-girls-belt.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-blue-romper-for-girls-with-belt-1.jpg||-||Mim Pi Blue Scarf|,|Matching new arrivals from designer Mim Pi, this adorable accessory is sure to be one of her favorites for the summer! The long scarf can be worn in several different ways. The ends are tied to create long tassels. The blue native print has touches of pink found throughout. 100% cotton. Wash separately inside out. |,|$17.25$|,||,|MIM-PI-BLUE-SCARF|,|$URL$mim-pi-blue-scarf.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-blue-scarf-1.jpg||-||Mim Pi Blue Summer Top for Girls|,|A creative new top just in time for summer, this darling design is one from Mim Pi. The geometric pattern blends blues, pink, and lime with ease. The short flutter sleeves are covered with ruffles of fabric. The wide neckline is embellished by a light pink rick rack ribbon. Pair the short sleeve top with a new pair of Mim Pi shorts or a cute summer skirt. Viscose/Lycra. Hand wash inside out cold water. Dry flat. |,|$33.75$|,||,|MIM-PI-BLUE-SUMMER-TOP-GIRLS|,|$URL$mim-pi-blue-summer-top-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-blue-summer-top-for-girls-1.jpg||-||Mim Pi Braided Tank Top for Girls|,|^|New from Mim Pi, this girls tank top is a great piece that has a casual look without sacrificing her individual style. The top boasts of a ""A"" line fit and a single pocket that is placed upon the front. The neckline is slightly curved while framed with wide straps. The straps come together to create a thick braid down the center down her back. The small touch of lime green stitching coordinated with the cool, bright blue that is inspired by the sunny skies. 95% Cotton 5% Lycra. Wash inside out with like colors. Size 7 and Size 10 Only Left ^||,|$17.25$|,||,|MIM-PI-BRAIDED-TANK-TOP-GIRLS|,|$URL$mim-pi-braided-tank-top-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-braided-tank-top-for-girls-1.jpg||-||Mim Pi Chevron Stripe Girls Tights|,|Matching her new outfits from Mim Pi, these adorable girls tights are too cute to miss out on. The grey tights boast of a bright pink waist band to match the toes and heel of both feet. From the top of her ankles, the chevron stripes start building up her legs in fun bright colors. Made from a cotton blend. Machine wash warm, do not tumble dry. |,|$13.80$|,||,|MIM-PI-CHEVRON-STRIPE-GIRLS-TIGHTS|,|$URL$mim-pi-chevron-stripe-girls-tights.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-chevron-stripe-girls-tights-3.jpg||-||Mim Pi Embroidered Tunic Top in White|,|^|Carefree, this fabulous new Mim Pi girls tunic top is sure to look fabulous as she plays in the sun. The top features a flutter short sleeve that is created with a wide fabric that cascades down both sides. The front of the bodice has a soft ""V"" shape that is accented with embroidered flowers and a small touch of pink threading. The back of the top has a single button that closes the top of a narrow keyhole. The waistline is smocked with a comfortable stretch. The solid white fabric is light weight and easy to layer if needed. The colors and style speak to the individual look of all Mim Pi. 100% cotton. Wash separately with similar color. ^||,|$40.50$|,||,|MIM-PI-EMBROIDERED-TUNIC-TOP-WHITE|,|$URL$mim-pi-embroidered-tunic-top-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-embroidered-tunic-top-in-white-1.jpg||-||Mim Pi Flower Tank Top for Girls|,|From the fabulously creative designer, Mim Pi, this new girls tank is covered with graceful flowers and a beautiful blend of colors. The scoop neckline features a unique version of the popular racer back style that boasts of its lime green trimming. The front of the top is divided down the front between two coordinating patterns of blooms. All of the colors found in this top are an easy match to many accessories or bottoms to create darling outfits. 95% cotton 5% Elasthan. Wash inside out with similar colors. |,|$24.75$|,||,|MIM-PI-FLOWER-TANK-TOP-GIRLS|,|$URL$mim-pi-flower-tank-top-girls.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-flower-tank-top-for-girls-1.jpg||-||Mim Pi Girls Blue Legging|,|Mim Pi has created these bold leggings specifically to go with their fabulous new creations. The bright blue is a similar shade to the sky while a pop of lime green is found in the accenting ribbon on the hem of both legs as well as around the waist. The fabric offers her a stretch fit that is comfortable and close to her skin. The side of her left leg has a small decoration in pink stitching topped with a button. 95% Cotton 5% Lycra. Wash inside out with similar colors. |,|$17.25$|,||,|MIM-PI-GIRLS-BLUE-LEGGING|,|$URL$mim-pi-girls-blue-legging.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-girls-blue-legging-1.jpg||-||Mim Pi Girls Dress with Stripes|,|A casual dress for girls, this new summer creation comes from Mim Pi. The straight neckline is framed with thin straps that boast of the two circle chain links that are found on both shoulders. An embroidered design is found on the front of the neckline, creating a trendy chevron stripe. The dress is raced with the light pink stripes from front to back. Tucks in the fabric create the shaped fit. The hemline is ruffled and has a small pop of lime green found in its stitching. 95% Cotton. 5% Elasthan. Wash inside out with similar colors. |,|$39.00$|,||,|MIM-PI-GIRLS-DRESS-STRIPES|,|$URL$mim-pi-girls-dress-stripes.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-girls-dress-with-stripes-1.jpg||-||Mim Pi Girls Romper in Blue|,|^|A fun new creation, this girls romper comes from the whimsical brand Mim Pi. The bodice features a chevron strip found on the blue print fabric. The straight neckline has thin straps and is accented with a small tassel. The waistline is cinched with ties on both sides to give shape. The attached shorts carry on the native print. 100% cotton. Wash inside out. SIZE 5 AND 7 ONLY LEFT.  ^||,|$40.50$|,||,|MIM-PI-GIRLS-ROMPER-BLUE|,|$URL$mim-pi-girls-romper-blue.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-girls-romper-in-blue-1.jpg||-||Mim Pi Girls Skirt with Colored Fringe|,|^|A creative new arrival from the designer behind Mim Pi, this darling girls skirt is one that she will love to mix and match! The soft stretch fit found in the waist is provided by elastic. The bottom of the skirt tiered in vibrant fringe from light blue, pink, green, and navy. Cute little pom poms dangle just above. Be sure to look at all the new girls tops that will match perfectly! Made from cotton/lycra, machine washable. SIZE 4 AND 9 LEFT. ^||,|$38.40$|,||,|MIM-PI-GIRLS-SKIRT-COLORED-FRINGE|,|$URL$mim-pi-girls-skirt-colored-fringe.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-girls-skirt-with-colored-fringe-3.jpg||-||Mim Pi Girls Striped Skirt in Blue|,|^|The perfect pair to several of the new tops from their summer collection, designer Mim Pi is now offering this short girls skirt. The cut of the skirt has an ""A"" line that opens slightly from the waist to the hem. The elastic waistline is comfortable while the colorful belt is softly tied around her and finished with large tassels. The blue and white stripe around the skirt while two pockets are found upon the front. 100% cotton. Wash separately inside out. ^||,|$33.00$|,||,|MIM-PI-GIRLS-STRIPED-SKIRT-BLUE|,|$URL$mim-pi-girls-striped-skirt-blue.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-girls-striped-skirt-in-blue-1.jpg||-||Mim Pi Girls Summer Dress in White|,|Designer Mim Pi has newly created this wonderful girls summer dress that is sure to make her feel like a free spirit under the sun. The long sleeve bodice is created with a light weight, white fabric and is lined with pink scallop ribbon. Both sleeves are home to a garden of embroidered flowers. This decoration matches the ring of posies that run around the wide neckline. Pleats open from the front center of the neck. A pink ribbon is tied around her waist in a bow. The full circle shape drapes around her legs, with extra fabric that looks fabulous as she twirls about. The tiers of the skirt are subtly defined while the hem is wrapped with the same pink found on the bodice. 100% cotton. Wash inside out with similar colors. |,|$48.00$|,||,|MIM-PI-GIRLS-SUMMER-DRESS-WHITE|,|$URL$mim-pi-girls-summer-dress-white.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-girls-summer-dress-in-white-1.jpg||-||Mim Pi Girls T-Shirt with Sequin Star|,|With plenty of fun new pieces that match this top perfectly, it will not be hard to create your own dreamy outfits filled with Mim Pi fun. The long sleeve top boasts of a blue bodice and grey sleeves. Both cuffs add just a small touch of shimmer. The front of the top is bright from the radiant sequin star that makes its home in the center. Different colors and sizes of sequins create this masterpiece. The neckline is decorated by a sweet pink scallop. Made from cotton/lycra, machine washable. |,|$26.40$|,||,|MIM-PI-GIRLS-T-SHIRT-SEQUIN-START|,|$URL$mim-pi-girls-t-shirt-sequin-start.html|,|http://ep.yimg.com/ay/yhst-17102259411242/mim-pi-girls-t-shirt-with-sequin-star-3.jpg||-||Mim Pi Girls Tights Hearts and Stripes|,|A cute way to finish off her funky new outfits from Mim Pi, these